Where commands include: ./configure '--build=x86_64-redhat-linux-gnu' '--host=x86_64-redhat-linux-gnu' '--program-prefix=' '--disable-dependency-tracking' '--prefix=/usr' '--exec-prefix=/usr' '--bindir=/usr/bin' '--sbindir=/usr/sbin' '--sysconfdir=/etc' '--datadir=/usr/share' '--includedir=/usr/include' '--libdir=/usr/lib64' '--libexecdir=/usr/libexec' '--localstatedir=/var' '--sharedstatedir=/var/lib' '--mandir=/usr/share/man' '--infodir=/usr/share/info' '--enable-shared' '--disable-static' '--docdir=/usr/share/doc/GraphicsMagick' '--with-lcms2' '--with-magick_plus_plus' '--with-modules' '--with-perl' '--with-perl-options=INSTALLDIRS=vendor ' '--with-quantum-depth=16' '--enable-quantum-library-names' '--with-threads' '--with-wmf' '--with-x' '--with-xml' '--without-dps' '--without-gslib' '--with-gs-font-dir=/usr/share/GraphicsMagick-1.3.38/urw-fonts' 'build_alias=x86_64-redhat-linux-gnu' 'host_alias=x86_64-redhat-linux-gnu' 'CFLAGS=-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protection' 'LDFLAGS=-Wl,-z,relro -Wl,-z,now -specs=/usr/lib/rpm/redhat/redhat-hardened-ld' 'CXXFLAGS=-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protection' 'PKG_CONFIG_PATH=:/usr/lib64/pkgconfig:/usr/share/pkgconfig' Configured using the command: %.1024s -fopenmp -O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protection -Wall -pthread-I/usr/include/freetype2 -I/usr/include/libxml2-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protection -pthread-Wl,-z,relro -Wl,-z,now -specs=/usr/lib/rpm/redhat/redhat-hardened-ld-llcms2 -lfreetype -lXext -lSM -lICE -lX11 -lbz2 -lz -lltdl -lm -lpthreadUsage: %.1024s [options ...] file [ [options ...] file ...] -authenticate value decrypt image with this password -backdrop display image centered on a backdrop -colormap type Shared or Private -colors value preferred number of colors in the image -colorspace type alternate image colorspace -crop geometry preferred size and location of the cropped image -debug events display copious debugging information -define values Coder/decoder specific options -delay value display the next image after pausing -density geometry horizontal and vertical density of the image -depth value image depth -display server display image to this X server -dither apply Floyd/Steinberg error diffusion to image -gamma value level of gamma correction -geometry geometry preferred size and location of the Image window -help print program options -interlace type None, Line, Plane, or Partition -limit type value Disk, File, Map, Memory, Pixels, Width, Height or Threads resource limit -log format format of debugging information -matte store matte channel if the image has one -map type display image using this Standard Colormap -monitor show progress indication -monochrome transform image to black and white -noop do not apply options to image -pause seconds to pause before reanimating -remote command execute a command in a remote display process -rotate degrees apply Paeth rotation to the image horizontal and vertical sampling factors -scenes range image scene range -size geometry width and height of image -treedepth value color tree depth -trim trim image edges -type type image type -verbose print detailed information about the image -version print version information -visual type display image using this visual type Constant, Edge, Mirror, or Tile -window id display image to background of this windowIn addition to those listed above, you can specify these standard Xresources as command line options: -background, -bordercolor,-borderwidth, -font, -foreground, -iconGeometry, -iconic, -name,-mattecolor, -shared-memory, or -title.By default, the image format of `file' is determined by its magicnumber. To specify a particular image format, precede the filenamewith an image format name and a colon (i.e. ps:image) or specify theimage type as the filename suffix (i.e. image.ps). Specify 'file' as'-' for standard input or output. Press any button to map or unmap the Command widgetUsage: %.1024s options command ... Where options include one of: -concurrent run multiple commands in parallel -duration duration duration to run benchmark (in seconds) -iterations loops number of command iterations per benchmark -rawcsv CSV output (threads,iterations,user_time,elapsed_time) -stepthreads step step benchmark with increasing number of threads Followed by some other arbitrary GraphicsMagick command.
The -concurrent option requires use of -iterations or -duration.
Example usages: gm benchmark -concurrent -duration 10 convert input.miff -minify output.miff gm benchmark -iterations 10 convert input.miff -minify output.miff gm benchmark -duration 3 -stepthreads 2 convert input.miff -minify null:Usage: %.1024s [options ...] reference [options ...] compare [options ...] -auto-orient orient (rotate) images so they are upright -compress type image compression type -define values coder/decoder specific options -display server get image or font from this X server -endian type multibyte word order (LSB, MSB, or Native) -file filename write difference image to this file color to use when annotating difference pixels pixel highlight style (assign, threshold, tint, xor) -maximum-error maximum total difference before returning error -metric comparison metric (MAE, MSE, PAE, PSNR, RMSE)Usage: %.1024s [options ...] image [options ...] composite [ [options ...] mask ] [options ...] composite -affine matrix affine transform matrix -blue-primary point chomaticity blue primary point -comment string annotate image with comment -compose operator composite operator -displace geometry shift image pixels defined by a displacement map -dispose method Undefined, None, Background, Previous -dissolve value dissolve the two images a given percent -encoding type text encoding type -filter type use this filter when resizing an image -font name render text with this font -geometry geometry location of the composite image -gravity type which direction to gravitate towards -green-primary point chomaticity green primary point -label name ssign a label to an image -negate replace every pixel with its complementary color +page reset current page offsets to default -page geometry size and location of an image canvas -profile filename add ICM or IPTC information profile to image -quality value JPEG/MIFF/PNG compression level -recolor matrix apply a color translation matrix to image channels -red-primary point chomaticity red primary point +repage reset current page offsets to default -repage geometry adjust current page offsets by geometry -resize geometry resize the image -scene value image scene number -set attribute value set image attribute +set attribute unset image attribute -sharpen geometry sharpen the image -stegano offset hide watermark within an image -stereo combine two image to create a stereo anaglyph -strip strip all profiles and text attributes from image -thumbnail geometry resize the image (optimized for thumbnails) -tile repeat composite operation across image -transform affine transform image -units type PixelsPerInch, PixelsPerCentimeter, or Undefined -unsharp geometry sharpen the image -watermark geometry percent brightness and saturation of a watermark -white-point point chomaticity white point -write filename write image to this fileUsage: %.1024s [options ...] file [ [options ...] file ...] [options ...] file -adjoin join images into a single multi-image file -antialias remove pixel-aliasing -append append an image sequence -asc-cdl spec apply ASC CDL transform -auto-orient orient (rotate) image so it is upright -average average an image sequence -background color background color pixels below the threshold become black -blur geometry blur the image -border geometry surround image with a border of color -bordercolor color border color -box color set the color of the annotation bounding box -channel type extract a particular color channel from image -charcoal radius simulate a charcoal drawing -chop geometry remove pixels from the image interior -clip apply first clipping path if the image has one -clippath apply named clipping path if the image has one -coalesce merge a sequence of images -colorize value colorize the image with the fill color -contrast enhance or reduce the image contrast -convolve kernel convolve image with the specified convolution kernel -cycle amount cycle the image colormap -deconstruct break down an image sequence into constituent parts -despeckle reduce the speckles within an image -draw string annotate the image with a graphic primitive -edge radius apply a filter to detect edges in the image -emboss radius emboss an image -enhance apply a digital filter to enhance a noisy image -equalize perform histogram equalization to an image -extent composite image on background color canvas image -fill color color to use when filling a graphic primitive -flatten flatten a sequence of images -flip flip image in the vertical direction -flop flop image in the horizontal direction -format "string" output formatted image info for 'info:' format -frame geometry surround image with an ornamental border -fuzz distance colors within this distance are considered equal -gaussian geometry gaussian blur an image -geometry geometry perferred size or location of the image -gravity type horizontal and vertical text/object placement -hald-clut clut apply a Hald CLUT to the image -implode amount implode image pixels about the center -intent type Absolute, Perceptual, Relative, or Saturation -label name assign a label to an image -lat geometry local adaptive thresholding -level value adjust the level of image contrast -linewidth width the line width for subsequent draw operations -list type Color, Delegate, Format, Magic, Module, Resource, or Type -loop iterations add Netscape loop extension to your GIF animation -magnify interpolate image to double size -map filename transform image colors to match this set of colors -mask filename set the image clip mask -mattecolor color specify the color to be used with the -frame option -median radius apply a median filter to the image -minify interpolate the image to half size -modulate value vary the brightness, saturation, and hue -morph value morph an image sequence -mosaic create a mosaic from an image sequence -motion-blur radiusxsigma+angle simulate motion blur -noise radius add or reduce noise in an image -normalize transform image to span the full range of colors -opaque color change this color to the fill color -operator channel operator rvalue apply a mathematical or bitwise operator to channel -ordered-dither channeltype NxN ordered dither the image -orient orientation set image orientation attribute -paint radius simulate an oil painting -ping efficiently determine image attributes -pointsize value font point size -preview type image preview type -raise value lighten/darken image edges to create a 3-D effect -random-threshold channeltype LOWxHIGH random threshold the image -region geometry apply options to a portion of the image -render render vector graphics +render disable rendering vector graphics -resample geometry resample to horizontal and vertical resolution -roll geometry roll an image vertically or horizontally -sample geometry scale image with pixel sampling -scale geometry scale the image -seed value pseudo-random number generator seed value -segment values segment an image -shade degrees shade the image using a distant light source -shave geometry shave pixels from the image edges -shear geometry slide one edge of the image along the X or Y axis -solarize threshold negate all pixels above the threshold level -spread amount displace image pixels by a random amount -stroke color graphic primitive stroke color -strokewidth value graphic primitive stroke width -swirl degrees swirl image pixels about the center -texture filename name of texture to tile onto the image background -threshold value threshold the image -tile filename tile image when filling a graphic primitive -transparent color make this color transparent within the image -undercolor color annotation bounding box color -view FlashPix viewing transforms -wave geometry alter an image along a sine wave pixels above the threshold become whiteIn additiion, define any key value pairs required by your script. For conjure -size 100x100 -color blue -foo bar script.msl -edge factor apply a filter to detect edges in the image -immutable displayed image cannot be modified -negate replace every pixel with its complementary color +progress disable progress monitor and busy cursor -remote command execute a command in an remote display process -segment value segment an image -update seconds detect when image file is modified and redisplay -window_group id exit program when this window id is destroyed -write filename write image to a file-borderwidth, -font, -foreground, -iconGeometry, -iconic, -mattecolor,-name, -shared-memory, -usePixmap, or -title. 1 press to map or unmap the Command widget 2 press and drag to magnify a region of an image 3 press to load an image from a visual image directoryUsage: %.1024s [options ...] file [ [options ...] file ... ] -format "string" output formatted image characteristics Where options include: -echo on|off echo command back to standard out, default is off -escape unix|windows force use Unix or Windows escape format for command line argument parsing, default is platform dependent -fail text when feedback is on, output the designated text if the command returns error, default is 'FAIL' -feedback on|off print text (see -pass and -fail options) feedback after each command to indicate the result, default is off -help print program options -pass text when feedback is on, output the designated text if the command executed successfully, default is 'PASS' -prompt text use the given text as command prompt. use text 'off' or empty string to turn off prompt. default to 'GM> ' if and only if batch mode was entered with no file argument -stop-on-error on|off when turned on, batch execution quits prematurely when any command returns error
Unix escape allows the use backslash(\), single quote(') and double quote(") in the command line. Windows escape only uses double quote("). For example,
Orignal Unix escape Windows escape [a\b\c\d] [a\\b\\c\\d] [a\b\c\d] [Text with space] [Text\ with\ space] ["Text with space"] [Text with (")] ['Text with (")'] ["Text with ("")"] [Mix: "It's a (\)"] ["Mix: \"It's a (\\)\""] ["Mix: ""It's a (\)"""] -blur factor apply a filter to blur the image border width -colorspace type alternate image colorsapce -display server query font from this X server -font name font to use when annotating with text -format string output formatted image characteristics -geometry geometry preferred tile and border sizes -gravity direction which direction to gravitate towards -mattecolor color color to be used with the -frame option -mode type Frame, Unframe, or Concatenate -shadow add a shadow beneath a tile to simulate depth -stroke color color to use when stroking a graphic primitive -strokewidth value stroke (line) width -tile geometry number of tiles per row and column -title string thumbnail title-borderwidth, -font, -mattecolor, or -title By default, the image format of `file' is determined by its magic -blur radius blur the image -create-directories create output directories if required -format type image format type write output files to directory -fill color color for annotating or changing opaque color -preserve-timestamp preserve original timestamps of the file -resize geometry perferred size or location of the image -scene number image scene number -sharpen radius sharpen the imageUsage: %.1024s [options ...] [ file ] -border include image borders in the output image -descend obtain image by descending window hierarchy -display server X server to contact -frame include window manager frame -pause value seconds delay between snapshots -screen select image from root window -silent operate silently, i.e. don't ring any bells -snaps value number of screen snapshots -window id select window with this id or nameBy default, 'file' is written in the MIFF image format. Tospecify a particular image format, precede the filename with an imageformat name and a colon (i.e. ps:image) or specify the image type asthe filename suffix (i.e. image.ps). Specify 'file' as '-' forUsage: %.1024s [options ...] [file|-]
Use '-' to read command from standard input without default prompt.(*image)->signature == MagickSignaturecomposite_image->signature == MagickSignaturemask_image->signature == MagickSignatureformatted_text != (const char *) NULLError: Missing value for %s option Error: Invalid value for %s option: %s Error: unexpected parameter: %s Normalized Absolute ============ ========== "Threads","Iterations","User Time","Elapsed Time" Results: %ld threads %ld iter %.2fs user %.6fs total %.3f iter/s %.3f iter/cpu%s%.2fs user %.2fs system %.0f%% cpu %.6f total Error: command line exceeded %d characters. Error: command line exceeded %d parameters. command_semaphore == (SemaphoreInfo *) NULLFailed to load profile from file "%s"Transform using %s profile "%s", %lu bytesAdding %s profile "%s", %lu bytes(*images)->signature == MagickSignatureoptions->input_filename != (char *) NULLrename to backup %.1024s=>%.1024s Error preserving file timestamps issue multiple commands in interactive or batch modebenchmark one of the other commandsexecute a Magick Scripting Language (MSL) XML scriptconvert an image or sequence of imagesdisplay an image on a workstation running Xobtain usage message for named commanddescribe an image or image sequencecapture an application or X server screentransform an image or sequence of imagescreate a composite image (in a grid) from separate imagestime one of the other commands��M�������������������������@�,�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�T�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]��]�]�]�]�]���\�]��]�]�]�]�]�]�]���]�]��]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]���\�]��]�]�]�]�]�]�]���]�]��T�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$�d$��"�d$�T"�#�#�"�d$�� �t �d$�d$��t�d$�d$�d$�d$�d$����d$�d�;�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>�t>��=�t>�t=�t>�=��<�t>�t>�<�;�t>�t>�o;�t>�t>� ;�t>�t>�:��q�<q�p�Tp��o�o�Tn�,n�k�4s�4s�k��i�Di�m�l�n�h��f��e�e�e�d�Q��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?��?������%����)����X����¶�?��?��d������?��H����������ͮ�~������������������������������V����������������������������������������������������������������������������l�������������n��������������&��n����������$������T�����������������������������������������������������������������������P�� � �� �p ���p�@�������0�������p����0���`�3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3��3�3�3�L3��2�2�\2��1�$2�|1��3��3�1�L1�1��0�0�0�D0��/�/�\/�/��.�߆�P|���{�������������&{���������{���y�����������������������������߆�P|���{�������������&{���������{���y��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H��H����К�P��H��P�����X��@��H��H����О�؛���@���������������������������G�����������������������������������G�������D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�$��L�������d��T�D�D���$��D��D���d��D����3�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�D�X3�H;��;�8�`:�9�7��6��:�D�D��7�7�`7�D�`9� 9�;�p6� 6�D��5�5�animatecomparecompositeconjureconvertdisplayidentifyimportmogrifymontageTimeImageCommandTimeImageCommandMontageImageCommandTransmogrifyImageMogrifyImageCommandMogrifyImagesAmpersandTranslateTextMogrifyImageMogrifyImageMagickInitializeCommandInfoMagickCommandIdentifyImageCommandConjureImageCommandConcatenateImagesConvertImageCommandConvertImageCommandCompositeImageListCompositeImageCommandCompositeImageCommandCompareImageCommandCompareImageCommandBenchmarkImageCommandBenchmarkImageCommand�����z�@�?>@R���Q@�������?9@�b@(@HH�8F�(F�F�E�(H�H�H�G��G��G�E��E�hE�E�E�xE�G��F��F�hE�F�8H�HH�G�G�xG�hG�XG�HG��E�8G�E�E�xE�E��G�G�F�F�F�xF�G�(G�F��F�`F�G���x��x����0�����x��x��x��x��x��x��x��x��x����������CompositeImagemagick/composite.c[%s] Applying undercolor...canvas_image != (Image *) NULLcanvas_image->signature == MagickSignature[%%s] Composite %s image pixels ...[%s] Composite image pixels ...��mB0@�@? ���A�>��@���@I@!!!!magick/compress.c[%s] Huffman decode image...[%s] Huffman encode image...GROUP4RAWjpeg:preserve-settings=TRUEimage->ascii85 != (Ascii85Info *) NULLpixels != (unsigned char *) NULLPackbitsEncode2ImagePackbitsEncode2ImageLZWEncode2ImageHuffmanEncode2ImageHuffmanEncode2ImageHuffmanDecodeImageHuffmanDecodeImageAscii85EncodeAscii85Flush5
: \ y � � � � 1Vz���Dh��� < ] k � � � #Gb����/?g����5Kk�����!Ad���$C]y����<Wn����� %BXn�����>c�����;h~�����*Kl�����2Mr����+;_s�����0>^r�����$>]�����*@\m�����#Hf~����7Tj����� 4Ng���� @ N ^ u � � � � � !!$!L!\!t!�!�!�!�!"2"O"o"�"�"�"�"#$#G#c#}#�#�#�# $$>$X$k$�$�$�$�$�$%<%d%�%�%�%�%�%& &5&N&e&�&�&�&�&�&�&')'@'Z'm'�'�'�'(((=(V(p(�(�(�(�(�()))E)\)v)�)�)�)�)�)**:*L*d*�*�*�*�*�*+'+A+{+�+�+�+�+�+,2,N,g,�,�,�,�,�,-#-6-E-Y-q-�-�-�-�-�-.9.h.�.�.�./N/i/�/�/�/�/0&0F0b0�0�0�0�0�01!1C1^1u1�1�1�1�1202J2_2y2�2�2�2�23#3;3U3s3�3�3�3�3�34*4>4[4y4�4�4�4�45$5>5U5v5�5�5�5�5�566,6J6d6�6�6�6�6�6717Q7r7�7�7�7�7 8"8B8^8|8�8�8�8�89:9[9}9�9�9�9�9:":8:S:p:�:�:�:�:�:;*;C;w;�;�;�;�;<*<E<a<o<<�<�<�<�<="=0=@=`=�=�=�=�=>0>T>l>�>�>�>�>�>?/?D?Y?m?�?�?�?�?@ @>@Y@s@�@�@�@�@ A#A;ARAkA�A�A�A�A�A�AB%1Unable to create blobUnable to deduce image formatUnable to obtain current offsetUnable to open fileUnable to read fileUnable to read to offsetUnable to seek to offsetUnable to write blobUnrecognized image formatdefault errordefault warningCache nexus contains no pixelsInconsistent persistent cache depthPixel cache dimensions incompatible with image dimensionsPixel cache is not openUnable to allocate cache viewUnable to clone cacheUnable to extend cacheUnable to get cache nexusUnable to get pixels from cacheUnable to open cacheUnable to persist pixel cacheUnable to read pixel cacheUnable to sync cache (check temporary file disk space)disk allocation failedUnable to extend pixel cachedefault warningArithmetic overflowColormap size exceeds limitColormap type not supportedColorspace model is not supportedColor type not supportedCompression not validData encoding scheme is not supportedData storage type is not supportedCoder did not return an image (this is a bug, please report it!)Delta-PNG is not supportedDivision by zeroEncrypted WPG image file not supportedFractal compression not supportedImage column or row size is not supportedImage does not have a matte channelImage is not tilesImage type not supportedIncompatible size of doubleIrregular channel geometry not supportedJNG compression is not supportedJPEG compression is not supportedJPEG embedding failedLocation type is not supportedMap storage type is not supportedMSB order not supported bitmapMulti-dimensional matrices are not supportedMultiple record list not supportedNo 8BIM data is availableNo APP1 data is availableNo bitmap on clipboardNo color profile availableNo data returnedNo image vector graphicsNo IPTC info was foundNo IPTC profile availableNumber of images is not supportedOnly continuous tone picture supportedOnly level zero files SupportedPNG compression is not supportedPNG library is too oldRLE compression not supportedSubsampling requires that image width be evenly divisible by twoUnable to copy profileUnable to create a DCUnable to create bitmapUnable to decompress imageUnable to Initialize FPX libraryUnable to open blobUnable to read aspect ratioUnable to read CIELAB imagesUnable to read summary infoUnable to set affine matrixUnable to set aspect ratioUnable to set color twistUnable to set contrastUnable to set filtering valueUnable to set image commentUnable to set image titleUnable to set JPEG levelUnable to set region of interestUnable to set summary infoUnable to translate textUnable to write MPEG parametersUnable to write to temporary fileUnable to zip-compress imageUnsupported bits per sampleUnsupported cell type in the matrixUnsupported number of columnsUnsupported number of rowsUnsupported samples per pixelWebP decoding failed: user abortWebP encoding failed: unknown reasonWebP encoding failed: bad dimensionWebP encoding failed: bad writeWebP encoding failed: bitstream out of memoryWebP encoding failed: File too big (> 4GB)WebP encoding failed: invalid configurationWebP encoding failed: null parameterWebP encoding failed: out of memoryWebP encoding failed: partition 0 overflow (> 512K)WebP encoding failed: partition overflow (> 16M)WebP encoding failed: user abortInvalid WebP configuration parameters suppliedWebP failed: invalid parameterZIP compression is not supporteddefault errorLossless to lossy JPEG conversioninclude element nested too deeplyRegistry key lookup failed. Package is not properly installed on this machine.String token maximum length exceededUnable to access configuration fileUnable to access font fileUnable to access log configuration fileUnable to access module filedefault errorUnable to change to working directoryUnable to get current working directoryUnable to restore current working directorydefault warningAn error has occurred reading from fileAn error has occurred writing to fileColormap exceeded colors limitCompression not validCorrupt imageImage file or blob does not contain any image dataImage file has no scenesImage type not supportedImproper image headerInsufficient image data in fileInvalid colormap indexinvalid file format versionLength and filesize do not matchMissing a required image channelNegative or zero image sizeNon OS2 BMP header size less than 40Not enough tiles found in levelStatic planes value not equal to 1Subsampling requires that image width be evenly divisible by twoToo much image data in fileUnable to read colormap from dump fileUnable to read color profileUnable to read extension blockUnable to read generic profileUnable to read image dataUnable to read image headerUnable to read IPTC profileUnable to read pixmap from dump fileUnable to read sub image dataUnable to read VID imageUnable to read window name from dump fileUnable to runlength decode imageUnable to uncompress imageUnexpected end-of-fileUnexpected sampling factorUnknown pattern typeUnrecognized bits per pixelUnrecognized compressionUnrecognized number of colorsUnrecognized XWD headerUnsupported bits per sampleUnsupported number of planesUnable to persist keyCompression not validCorrupt image (some data returned)Improper image headerInvalid colormap indexLength and filesize do not matchNegative or zero image sizeNon OS2 header size errorCorrupt PCD image, skipping to sync byteStatic planes value not equal to oneUnable to parse embedded profileUnrecognized bits per pixelUnrecognized image compressionDelegate failedFailed to allocate argument list.Failed to allocate Ghostscript interpreter.Failed to compute output sizeFailed to find Ghostscript (not installed?).Failed to render fileFailed to scan fileNo tag foundPostscript delegate failedUnable to create imageUnable to create image componentUnable to decode image fileUnable to encode image fileUnable to initialize FPX libraryUnable to initialize WMF libraryUnable to manage JP2 streamUnable to write SVG formatWebP library ABI does not match header ABI (build issue!)default errordefault warningAlready pushing pattern definitionarithmetic overflowdrawing recursion detectedtext value does not convert to floattext value does not convert to integerinvalid primitive argumentNon-conforming drawing primitive definitionprimitive arithmetic overflowtoo many coordinatesunable to draw on imageUnable to printunbalanced graphic context push-popunbalanced push-popunreasonable affine matrixunreasonable dash polygon lengthunreasonable gradient image sizevector path truncateddefault errorNot a relative URLNot currently pushing pattern definitionURL not foundUnable to create temporary fileUnable to open fileUnable to write filedefault errordefault warningangle is discontinuousCMYKA image lacks an alpha channel (indexes)Colorspace color profile mismatchimage colorspace differsimage colorspace mismatchimage difference exceeds limitimage does not contain resolutionimage is not colormappedimage opacity differsImage sequence is requiredimage size differsInvalid colormap indexleft and right image sizes differno images were foundno images were loadedno [LOCALE] image attributetoo many clusterunable to append imageUnable to assign profileunable to average imageunable to coalesce imageunable to compare imagesunable to create image mosaicunable to create stereo imageunable to deconstruct image sequenceunable to export image pixelsunable to flatten imageUnable to get clip maskUnable to get composite maskunable to handle image channelunable to import image pixelsunable to resize imageunable to segment imageUnable to set clip maskUnable to set composite maskunable to shear imagewidth or height exceeds limitUnable to persist keydefault warningDPS library is not availableFPX library is not availableFreeType library is not availableJPEG compression library is not availableLCMS encoding not enabledLZW encoding not enabledNo decode delegate for this image formatNo encode delegate for this image formatTIFF library is not availableXML library is not availableX Window library is not availableZLIB compression library is not availabledefault errordefault warningFailed to close moduleFailed to find symbolUnable to load moduleUnable to register image formatUnrecognized moduleUnable to initialize module loaderdefault warningdefault errordefault errorUser requested termination (via signal)default warningbevel width is negativecolor separated image requiredframe is less than image sizegeometry dimensions are zerogeometry does not contain imagehald clut image dimensions are invalidimages are not the same sizesize must exceed bevel widthimage smaller than kernel widthimage smaller than radiusimage widths or heights differinput images already specifiedInvalid subimage specificationkernel radius is too smallkernel width must be an odd numberMatrix is not square (%s elements)Matrix size is out of rangeMissing an image filenameOption '%s' requires an argument or argument is malformedMust specify a image nameMust specify image sizeNo Binary Large OBjects definedNo images definedNon-zero width and height requiredNo profile name was givenNull blob argumentReference image requiredReference is not my typeRegion area exceeds implementation limitRequest did not return an imageStegano image requiredStereo image requiredSubimage specification returns no imagesTile is not bounded by image dimensionsUnable to add or remove profileunable to average image sequenceunable to blur imageunable to chop imageUnable to color matrix imageUnable to constitute imageUnable to convolve imageUnable to edge imageUnable to equalize imageUnable to filter imageunable to format image meta dataUnable to frame imageunable to oil paint imageUnable to paint imageUnable to raise imageUnable to sharpen imageUnable to threshold imageUnable to wave imageUnrecognized attributeUnrecognized channel typeUnrecognized colorUnrecognized colormap typeUnrecognized image colorspaceUnrecognized command '%s'. Use -help for a usage summary or see manual.Unrecognized compose operatorUnrecognized dispose methodUnrecognized elementUnrecognized endian typeUnrecognized gravity typeUnrecognized highlight styleUnrecognized image compressionUnrecognized image filterUnrecognized image formatUnrecognized image modeUnrecognized image typeUnrecognized intent typeUnrecognized interlace typeUnrecognized list typeUnrecognized error metricUnrecognized mode typeUnrecognized noise typeUnrecognized operatorUnrecognized optionUnrecognized PerlMagick methodUnrecognized pixel mapUnrecognized preview typeUnrecognized resource typeUnrecognized typeUnrecognized units typeUnrecognized virtual pixel methodUnsupported sampling factorImproper arguments supplied, please see manualInvalid colorspace typeInvalid endian typeInvalid image typeInvalid interlace typeMissing an image filenameOption '%s' requires an argument or argument is malformedNo images were loadedOption length exceeds limitRequest did not return an imageUnable to open XServerUnable to persist keyUnrecognized colormap typeUnrecognized colorspace typeunrecognized dispose methodUnrecognized endian typeUnrecognized filter typeunrecognized compression typeUnrecognized image typeUnrecognized interlace typeUnrecognized optionUnrecognized resource typeUnrecognized virtual pixel methodUnrecognized colorimage expectedimage info expectedstructure size mismatchUnable to get registry IDUnable to locate imageUnable to set registrydefault errordefault warningDisk space limit exceeded (see -limit Disk)Image pixel height limit exceeded (see -limit Height)Image pixel limit exceeded (see -limit Pixels)Image pixel width limit exceeded (see -limit Width)Memory allocation failedPixel nexus height limit exceeded (see -limit Height)Pixel nexus limit exceeded (see -limit Pixels)Pixel nexus width limit exceeded (see -limit Width)No pixels defined in cachePixel cache allocation failedRead limit exceeded (see -limit Read)unable to add ICC Color profileunable to add generic profileunable to add IPTC profileunable to add or remove profileunable to allocate coefficientsUnable to allocate colormapunable to allocate ICC profileUnable to allocate imageunable to allocate stringUnable to annotate imageunable to average image sequenceunable to clone drawing wandunable to clone imageunable to compute image signatureunable to constitute imageunable to convert fontunable to convert strings to tokensUnable to create colormapunable to create color transformunable to create command widgetunable to create image groupUnable to create image montageunable to create X windowunable to crop imageunable to despeckle imageunable to determine image classunable to determine the number of image colorsunable to dither imageunable to draw on imageunable to edge imageunable to emboss imageunable to enhance imageunable to floodfill imageunable to gamma correct imageunable to get best icon sizeunable to get from registryUnable to get package infounable to interpret MSL imageunable to level imageunable to magnify imageUnable to manage colorUnable to map imageUnable to map image sequenceunable to median filter imageunable to motion blur imageunable to noise filter imageunable to normalize imageunable to open color profileunable to quantize imageunable to quantize image sequenceunable to read text chunkunable to read X imageunable to read X server colormapunable to resize imageunable to rotate imageunable to sample imageunable to scale imageunable to select imageunable to sharpen imageunable to shave imageunable to shear imageunable to sort image colormapunable to threshold imageunable to transform colorspaceMemory allocation failedSemaphore operation failedunable to allocate ascii85 infounable to allocate cache infounable to allocate cache viewunable to allocate color infounable to allocate dash patternunable to allocate delegate infounable to allocate derivatesunable to allocate draw contextunable to allocate draw infounable to allocate drawing wandunable to allocate gamma mapunable to allocate imageunable to allocate image pixelsunable to allocate log infounable to allocate magic infounable to allocate magick infounable to allocate magick mapunable to allocate module infounable to allocate montage infounable to allocate quantize infounable to allocate random kernelunable to allocate registry infounable to allocate semaphore infounable to allocate stringunable to allocate type infounable to allocate wandunable to animate image sequenceunable to clone blob infounable to clone cache infounable to clone imageunable to clone image infounable to concatenate stringunable to convert textunable to create colormapunable to destroy semaphoreunable to display imageunable to escape stringunable to initialize semaphoreunable to interpret MSL imageunable to lock semaphoreunable to obtain random bytes from operating systemunable to unlock semaphoreMemory allocation failedimage does not contain the stream geometryno stream handler is definedPixel cache is not openUnable to acquire pixel streamUnable to set pixel streamUnable to sync pixel streamdefault errordefault warningFont name not specifiedFont substitution requiredUnable to get type metricsUnable to initialize freetype libraryUnable to read fontUnrecognized font encodingdefault errordefault warninginvalid colormap index `%.1024sWand API not implemented `%.1024sWand contains no image indices `%.1024sWand contains no images `%.1024sColor is not known to serverNo window with specified ID existsStandard Colormap is not initializedUnable to connect to remote displayUnable to create bitmapUnable to create colormapUnable to create pixmapUnable to create propertyUnable to create standard colormapUnable to display image infoUnable to get propertyUnable to get Standard ColormapUnable to get visualUnable to grab mouseUnable to load fontUnable to match visual to Standard ColormapUnable to open X serverUnable to read X attributesUnable to read X window imageUnrecognized colormap typeUnrecognized gravity typeUnrecognized visual specifierUnable to allocate X hintsUnable to create X cursorUnable to create graphic contextunable to create standard colormapUnable to create text propertyUnable to create X imageUnable to create X pixmapUnable to create X windowunable to display imageunable to dither imageUnable to get pixel infoUnable to get visualUnable to load fontUnable to make X windowUnable to open X serverUnable to view fontsUnable to get visualUsingDefaultVisualUnableToCreateBlobUnableToDeduceImageFormatUnableToObtainOffsetUnableToOpenFileUnableToReadFileUnableToReadToOffsetUnableToSeekToOffsetUnableToWriteBlobUnrecognizedImageFormat Default DefaultEmptyCacheNexusInconsistentPersistentCacheDepth PixelCacheDimensionsMisMatchPixelCacheIsNotOpenUnableToAllocateCacheViewUnableToCloneCacheUnableToExtendCacheUnableToGetCacheNexusUnableToGetPixelsFromCacheUnableToOpenCacheUnableToPeristPixelCacheUnableToReadPixelCacheUnableToSyncCacheDiskAllocationFailedUnableToExtendPixelCacheDefaultArithmeticOverflowColormapTooLargeColormapTypeNotSupportedColorspaceModelIsNotSupportedColorTypeNotSupported CompressionNotValid!DataEncodingSchemeIsNotSupported"DataStorageTypeIsNotSupported#DecodedImageNotReturned$DeltaPNGNotSupported%DivisionByZero&EncryptedWPGImageFileNotSupported'FractalCompressionNotSupported(ImageColumnOrRowSizeIsNotSupported)ImageDoesNotHaveAMatteChannel*ImageIsNotTiled+ImageTypeNotSupported,IncompatibleSizeOfDouble-IrregularChannelGeometryNotSupported.JNGCompressionNotSupported/JPEGCompressionNotSupported0JPEGEmbeddingFailed1LocationTypeIsNotSupported2MapStorageTypeIsNotSupported3MSBByteOrderNotSupported4MultidimensionalMatricesAreNotSupported5MultipleRecordListNotSupported6No8BIMDataIsAvailable7NoAPP1DataIsAvailable8NoBitmapOnClipboard9NoColorProfileAvailable:NoDataReturned;NoImageVectorGraphics<NoIPTCInfoWasFound=NoIPTCProfileAvailable>NumberOfImagesIsNotSupported?OnlyContinuousTonePictureSupported@OnlyLevelZerofilesSupportedAPNGCompressionNotSupportedBPNGLibraryTooOldCRLECompressionNotSupportedDSubsamplingRequiresEvenWidthEUnableToCopyProfileFUnableToCreateADCGUnableToCreateBitmapHUnableToDecompressImageIUnableToInitializeFPXLibraryJUnableToOpenBlobKUnableToReadAspectRatioLUnableToReadCIELABImagesMUnableToReadSummaryInfoNUnableToSetAffineMatrixOUnableToSetAspectRatioPUnableToSetColorTwistQUnableToSetContrastRUnableToSetFilteringValueSUnableToSetImageCommentsTUnableToSetImageTitleUUnableToSetJPEGLevelVUnableToSetRegionOfInterestWUnableToSetSummaryInfoXUnableToTranslateTextYUnableToWriteMPEGParametersZUnableToWriteTemporaryFile[UnableToZipCompressImage\UnsupportedBitsPerSample]UnsupportedCellTypeInTheMatrix^UnsupportedNumberOfColumns_UnsupportedNumberOfRows`UnsupportedSamplesPerPixelaWebPDecodingFailedUserAbortbWebPEncodingFailedcWebPEncodingFailedBadDimensiondWebPEncodingFailedBadWriteeWebPEncodingFailedBitstreamOutOfMemoryfWebPEncodingFailedFileTooBiggWebPEncodingFailedInvalidConfigurationhWebPEncodingFailedNULLParameteriWebPEncodingFailedOutOfMemoryjWebPEncodingFailedPartition0OverflowkWebPEncodingFailedPartitionOverflowlWebPEncodingFailedUserAbortmWebPInvalidConfigurationnWebPInvalidParameteroZipCompressionNotSupportedpDefaultqLosslessToLossyJPEGConversionrIncludeElementNestedTooDeeplysRegistryKeyLookupFailedtStringTokenLengthExceededuUnableToAccessConfigureFilevUnableToAccessFontFilewUnableToAccessLogFilexUnableToAccessModuleFileyDefaultzUnableToChangeToWorkingDirectory{UnableToGetCurrentDirectory|UnableToRestoreCurrentDirectory}Default~AnErrorHasOccurredReadingFromFileAnErrorHasOccurredWritingToFile�ColormapExceedsColorsLimit�CompressionNotValid�CorruptImage�ImageFileDoesNotContainAnyImageData�ImageFileHasNoScenes�ImageTypeNotSupported�ImproperImageHeader�InsufficientImageDataInFile�InvalidColormapIndex�InvalidFileFormatVersion�LengthAndFilesizeDoNotMatch�MissingImageChannel�NegativeOrZeroImageSize�NonOS2HeaderSizeError�NotEnoughTiles�StaticPlanesValueNotEqualToOne�SubsamplingRequiresEvenWidth�TooMuchImageDataInFile�UnableToReadColormapFromDumpFile�UnableToReadColorProfile�UnableToReadExtensionBlock�UnableToReadGenericProfile�UnableToReadImageData�UnableToReadImageHeader�UnableToReadIPTCProfile�UnableToReadPixmapFromDumpFile�UnableToReadSubImageData�UnableToReadVIDImage�UnableToReadWindowNameFromDumpFile�UnableToRunlengthDecodeImage�UnableToUncompressImage�UnexpectedEndOfFile�UnexpectedSamplingFactor�UnknownPatternType�UnrecognizedBitsPerPixel�UnrecognizedImageCompression�UnrecognizedNumberOfColors�UnrecognizedXWDHeader�UnsupportedBitsPerSample�UnsupportedNumberOfPlanes�UnableToPersistKey�CompressionNotValid�CorruptImage�ImproperImageHeader�InvalidColormapIndex�LengthAndFilesizeDoNotMatch�NegativeOrZeroImageSize�NonOS2HeaderSizeError�SkipToSyncByte�StaticPlanesValueNotEqualToOne�UnableToParseEmbeddedProfile�UnrecognizedBitsPerPixel�UnrecognizedImageCompression�DelegateFailed�FailedToAllocateArgumentList�FailedToAllocateGhostscriptInterpreter�FailedToComputeOutputSize�FailedToFindGhostscript�FailedToRenderFile�FailedToScanFile�NoTagFound�PostscriptDelegateFailed�UnableToCreateImage�UnableToCreateImageComponent�UnableToDecodeImageFile�UnableToEncodeImageFile�UnableToInitializeFPXLibrary�UnableToInitializeWMFLibrary�UnableToManageJP2Stream�UnableToWriteSVGFormat�WebPABIMismatch�Default�Default�AlreadyPushingPatternDefinition�ArithmeticOverflow�DrawingRecursionDetected�FloatValueConversionError�IntegerValueConversionError�InvalidPrimitiveArgument�NonconformingDrawingPrimitiveDefinition�PrimitiveArithmeticOverflow�TooManyCoordinates�UnableToDrawOnImage�UnableToPrint�UnbalancedGraphicContextPushPop�UnbalancedPushPop�UnreasonableAffineMatrix�UnreasonableDashPolygonLength�UnreasonableGradientSize�VectorPathTruncated�Default�NotARelativeURL�NotCurrentlyPushingPatternDefinition�URLNotFound�UnableToCreateTemporaryFile�UnableToOpenFile�UnableToWriteFile�Default�Default�AngleIsDiscontinuous�CMYKAImageLacksAlphaChannel�ColorspaceColorProfileMismatch�ImageColorspaceDiffers�ImageColorspaceMismatch�ImageDifferenceExceedsLimit�ImageDoesNotContainResolution�ImageIsNotColormapped�ImageOpacityDiffers�ImageSequenceIsRequired�ImageSizeDiffers�InvalidColormapIndex�LeftAndRightImageSizesDiffer�NoImagesWereFound�NoImagesWereLoaded�NoLocaleImageAttribute�TooManyClusters�UnableToAppendImage�UnableToAssignProfile�UnableToAverageImage�UnableToCoalesceImage�UnableToCompareImages�UnableToCreateImageMosaic�UnableToCreateStereoImage�UnableToDeconstructImageSequence�UnableToExportImagePixels�UnableToFlattenImage�UnableToGetClipMask�UnableToGetCompositeMaskUnableToHandleImageChannelUnableToImportImagePixelsUnableToResizeImageUnableToSegmentImageUnableToSetClipMaskUnableToSetCompositeMaskUnableToShearImageWidthOrHeightExceedsLimitUnableToPersistKey Default DPSLibraryIsNotAvailableFPXLibraryIsNotAvailableFreeTypeLibraryIsNotAvailable JPEGLibraryIsNotAvailableLCMSLibraryIsNotAvailableLZWEncodingNotEnabledNoDecodeDelegateForThisImageFormatNoEncodeDelegateForThisImageFormatTIFFLibraryIsNotAvailableXMLLibraryIsNotAvailableXWindowLibraryIsNotAvailableZipLibraryIsNotAvailableDefaultDefaultFailedToCloseModuleFailedToFindSymbolUnableToLoadModuleUnableToRegisterImageFormatUnrecognizedModuleUnableToInitializeModuleLoaderDefaultDefault Default!UserRequestedTerminationBySignal"Default#BevelWidthIsNegative$ColorSeparatedImageRequired%FrameIsLessThanImageSize&GeometryDimensionsAreZero'GeometryDoesNotContainImage(HaldClutImageDimensionsInvalid)ImagesAreNotTheSameSize*ImageSizeMustExceedBevelWidth+ImageSmallerThanKernelWidth,ImageSmallerThanRadius-ImageWidthsOrHeightsDiffer.InputImagesAlreadySpecified/InvalidSubimageSpecification0KernelRadiusIsTooSmall1KernelWidthMustBeAnOddNumber2MatrixIsNotSquare3MatrixOrderOutOfRange4MissingAnImageFilename5MissingArgument6MustSpecifyAnImageName7MustSpecifyImageSize8NoBlobDefined9NoImagesDefined:NonzeroWidthAndHeightRequired;NoProfileNameWasGiven<NullBlobArgument=ReferenceImageRequired>ReferenceIsNotMyType?RegionAreaExceedsLimit@RequestDidNotReturnAnImageASteganoImageRequiredBStereoImageRequiredCSubimageSpecificationReturnsNoImagesDTileNotBoundedByImageDimensionsEUnableToAddOrRemoveProfileFUnableToAverageImageSequenceGUnableToBlurImageHUnableToChopImageIUnableToColorMatrixImageJUnableToConstituteImageKUnableToConvolveImageLUnableToEdgeImageMUnableToEqualizeImageNUnableToFilterImageOUnableToFormatImageMetadataPUnableToFrameImageQUnableToOilPaintImageRUnableToPaintImageSUnableToRaiseImageTUnableToSharpenImageUUnableToThresholdImageVUnableToWaveImageWUnrecognizedAttributeXUnrecognizedChannelTypeYUnrecognizedColorZUnrecognizedColormapType[UnrecognizedColorspace\UnrecognizedCommand]UnrecognizedComposeOperator^UnrecognizedDisposeMethod_UnrecognizedElement`UnrecognizedEndianTypeaUnrecognizedGravityTypebUnrecognizedHighlightStylecUnrecognizedImageCompressiondUnrecognizedImageFiltereUnrecognizedImageFormatfUnrecognizedImageModegUnrecognizedImageTypehUnrecognizedIntentTypeiUnrecognizedInterlaceTypejUnrecognizedListTypekUnrecognizedMetriclUnrecognizedModeTypemUnrecognizedNoiseTypenUnrecognizedOperatoroUnrecognizedOptionpUnrecognizedPerlMagickMethodqUnrecognizedPixelMaprUnrecognizedPreviewTypesUnrecognizedResourceTypetUnrecognizedTypeuUnrecognizedUnitsTypevUnrecognizedVirtualPixelMethodwUnsupportedSamplingFactorxUsageErroryInvalidColorspaceTypezInvalidEndianType{InvalidImageType|InvalidInterlaceType}MissingAnImageFilename~MissingArgumentNoImagesWereLoaded�OptionLengthExceedsLimit�RequestDidNotReturnAnImage�UnableToOpenXServer�UnableToPersistKey�UnrecognizedColormapType�UnrecognizedColorspaceType�UnrecognizedDisposeMethod�UnrecognizedEndianType�UnrecognizedFilterType�UnrecognizedImageCompressionType�UnrecognizedImageType�UnrecognizedInterlaceType�UnrecognizedOption�UnrecognizedResourceType�UnrecognizedVirtualPixelMethod�UnrecognizedColor�ImageExpected�ImageInfoExpected�StructureSizeMismatch�UnableToGetRegistryID�UnableToLocateImage�UnableToSetRegistry�Default�Default�CacheResourcesExhausted�ImagePixelHeightLimitExceeded�ImagePixelLimitExceeded�ImagePixelWidthLimitExceeded�MemoryAllocationFailed�NexusPixelHeightLimitExceeded�NexusPixelLimitExceeded�NexusPixelWidthLimitExceeded�NoPixelsDefinedInCache�PixelCacheAllocationFailed�ReadLimitExceeded�UnableToAddColorProfile�UnableToAddGenericProfile�UnableToAddIPTCProfile�UnableToAddOrRemoveProfile�UnableToAllocateCoefficients�UnableToAllocateColormap�UnableToAllocateICCProfile�UnableToAllocateImage�UnableToAllocateString�UnableToAnnotateImage�UnableToAverageImageSequence�UnableToCloneDrawingWand�UnableToCloneImage�UnableToComputeImageSignature�UnableToConstituteImage�UnableToConvertFont�UnableToConvertStringToTokens�UnableToCreateColormap�UnableToCreateColorTransform�UnableToCreateCommandWidget�UnableToCreateImageGroup�UnableToCreateImageMontage�UnableToCreateXWindow�UnableToCropImage�UnableToDespeckleImage�UnableToDetermineImageClass�UnableToDetermineTheNumberOfImageColors�UnableToDitherImage�UnableToDrawOnImage�UnableToEdgeImage�UnableToEmbossImage�UnableToEnhanceImage�UnableToFloodfillImage�UnableToGammaCorrectImage�UnableToGetBestIconSize�UnableToGetFromRegistry�UnableToGetPackageInfo�UnableToInterpretMSLImage�UnableToLevelImage�UnableToMagnifyImage�UnableToManageColor�UnableToMapImage�UnableToMapImageSequence�UnableToMedianFilterImage�UnableToMotionBlurImage�UnableToNoiseFilterImage�UnableToNormalizeImage�UnableToOpenColorProfile�UnableToQuantizeImage�UnableToQuantizeImageSequence�UnableToReadTextChunk�UnableToReadXImage�UnableToReadXServerColormap�UnableToResizeImage�UnableToRotateImage�UnableToSampleImage�UnableToScaleImage�UnableToSelectImage�UnableToSharpenImage�UnableToShaveImage�UnableToShearImage�UnableToSortImageColormap�UnableToThresholdImage�UnableToTransformColorspace�MemoryAllocationFailed�SemaporeOperationFailed�UnableToAllocateAscii85Info�UnableToAllocateCacheInfo�UnableToAllocateCacheView�UnableToAllocateColorInfo�UnableToAllocateDashPattern�UnableToAllocateDelegateInfo�UnableToAllocateDerivatives�UnableToAllocateDrawContext�UnableToAllocateDrawInfo�UnableToAllocateDrawingWand�UnableToAllocateGammaMap�UnableToAllocateImage�UnableToAllocateImagePixels�UnableToAllocateLogInfo�UnableToAllocateMagicInfo�UnableToAllocateMagickInfo�UnableToAllocateMagickMap�UnableToAllocateModuleInfo�UnableToAllocateMontageInfo�UnableToAllocateQuantizeInfo�UnableToAllocateRandomKernel�UnableToAllocateRegistryInfo�UnableToAllocateSemaphoreInfo�UnableToAllocateString�UnableToAllocateTypeInfo�UnableToAllocateWand�UnableToAnimateImageSequenceUnableToCloneBlobInfoUnableToCloneCacheInfoUnableToCloneImageUnableToCloneImageInfoUnableToConcatenateStringUnableToConvertTextUnableToCreateColormapUnableToDestroySemaphoreUnableToDisplayImage UnableToEscapeString UnableToInitializeSemaphoreUnableToInterpretMSLImageUnableToLockSemaphore UnableToObtainRandomEntropyUnableToUnlockSemaphoreMemoryAllocationFailedImageDoesNotContainTheStreamGeometryNoStreamHandlerIsDefinedPixelCacheIsNotOpenUnableToAcquirePixelStreamUnableToSetPixelStreamUnableToSyncPixelStreamDefaultDefaultFontNotSpecifiedFontSubstitutionRequiredUnableToGetTypeMetricsUnableToInitializeFreetypeLibraryUnableToReadFontUnrecognizedFontEncodingDefaultDefault InvalidColormapIndex!WandAPINotImplemented"WandContainsNoImageIndexs#WandContainsNoImages$ColorIsNotKnownToServer%NoWindowWithSpecifiedIDExists&StandardColormapIsNotInitialized'UnableToConnectToRemoteDisplay(UnableToCreateBitmap)UnableToCreateColormap*UnableToCreatePixmap+UnableToCreateProperty,UnableToCreateStandardColormap-UnableToDisplayImageInfo.UnableToGetProperty/UnableToGetStandardColormap0UnableToGetVisual1UnableToGrabMouse2UnableToLoadFont3UnableToMatchVisualToStandardColormap4UnableToOpenXServer5UnableToReadXAttributes6UnableToReadXWindowImage7UnrecognizedColormapType8UnrecognizedGravityType9UnrecognizedVisualSpecifier:UnableToAllocateXHints;UnableToCreateCursor<UnableToCreateGraphicContext=UnableToCreateStandardColormap>UnableToCreateTextProperty?UnableToCreateXImage@UnableToCreateXPixmapAUnableToCreateXWindowBUnableToDisplayImageCUnableToDitherImageDUnableToGetPixelInfoEUnableToGetVisualFUnableToLoadFontGUnableToMakeXWindowHUnableToOpenXServerIUnableToViewFontsJUnableToGetVisualKUsingDefaultVisualLBlob/Error�Blob/FatalError �Blob/Warning OCache/Error�Cache/FatalError�Cache/WarningYCoder/Error�Coder/FatalErrorp�Coder/Warningq^Configure/Errorr�Configure/FatalErroryConfigure/Warning}�Corrupt/Image/Error~�Corrupt/Image/FatalError��Corrupt/Image/Warning�EDelegate/Error��Delegate/FatalError��Delegate/Warning�;Draw/Error��Draw/FatalError��Draw/Warning�hFile/Open/Error��File/Open/FatalError��File/Open/Warning�JImage/Error��Image/FatalError�Image/Warning mMissing/Delegate/Error �Missing/Delegate/FatalError�Missing/Delegate/Warning@Module/Error�Module/FatalError�Module/WarningcMonitor/Error�Monitor/FatalError Monitor/Warning"�Option/Error#�Option/FatalErrory�Option/Warning�6Registry/Error��Registry/FatalError�Registry/Warning��Resource/Limit/Error��Resource/Limit/FatalError��Resource/Limit/Warning.Stream/Error�Stream/FatalError�Stream/WarningTType/Error�Type/FatalError�Type/Warning1Wand/Error �XServer/Error$�XServer/FatalError:XServer/WarningJ|LBlobCacheCoderConfigure Corrupt/ImageDelegateDrawFile/OpenImageMissing/DelegateModuleMonitor!Option$Registry'Resource/Limit*Stream-Type0Wand3XServer46<magicklog>eventsgenerationsUnknownEventOptionMissingDelegateCorruptImageFileOpenStreamCoderTemporaryFileTransformXServerUserMonitorLocaleDeprecateRegistryConfigureFatalErrorWarning%04d%02d%02d%02d%02d%02d%ld:%-9.6f%02d:%02d:%02d%0.3fu%%</log> <?xml version="1.0"?> <log> <record> <pid>%ld</pid> <module>%.1024s</module> <line>%lu</line> <domain>%.1024s</domain> <event>%.1024s</event> </record> Set log event mask: %smagick/log.clog_info == (LogInfo *) NULL(default)MAGICK_DEBUGlog.mgk%.1024s: <include /> nested too deeply <timestamp>%.1024s</timestamp> <elapsed-time>%ld:%-9.6f</elapsed-time> <user-time>%0.3f</user-time> <function>%.1024s</function> <severity>%.1024s</severity> ������=��=��=��=��@��=��=����=��=��=��=��=��=��=��=��=��=��=��=��=��=��=��=��=��=��=��=��=��������=��=��=��=��@��=��=����(������9��9����9��9��9��9�����9��9��9��9�����9��9��9��9�����9��9��9��9����9��9��9��9����9��9��9��9����9��9��9��9��~��9��9��9��9��m��9��9��9��9��\��9��9��9��9��K��9��9��9��9��:��9��9��9��9��)��9��9��9��9����9��9��9��9����9��9��9��9����������9��9���������9��9����9��9��9��9��������������������������|��l��������4��������������SetLogEventMaskInitializeLogInfononedisabledstdoutstderrxmlfiletxtfilewin32debug win32eventlog noneinformation�d�warning,�error��fatalerror �configure __annotaterender<<transform KKlocaleVVcoder 22x11@QRcache�--blob##deprecate WWuserRRresourcetemporaryfile FFexception option@
P1P3P4P5P6P7 332P7%!8BPSSFW95#?RADIANCEVIEW= R�CTSFW94�Y�j�?XML?xmlLBLSIZENJPL1I���ƚ�WPC#definegimp xcf* XPM *8BIM#( EMF2#0="�"��MM*II*MM+II+ due to signal () "... magick/magick.cDestroy MagickInitialize MagickMAGICK_IOBUF_SIZEMAGICK_CODER_STABILITYBROKENUNSTABLEPRIMARYmagick != (char *) NULL%9s %c %c%c%c %.1024s <!-- %s --> <modulemap> </modulemap> image/x-%.1024sabortquittingname != (const char *) NULLvideo/aviapplication/dicomapplication/pdfapplication/postscriptimage/g3faximage/vnd.fpximage/gifimage/jpegvideo/x-mngvideo/mpegimage/pngimage/svg+xmlimage/tiffimage/vnd.wap.wbmpHangupInterruptQuitIllegal InstructionAbortArithmetic ExceptionBus ErrorSegmentation FaultBroken PipeAlarm ClockTerminatedChild Status ChangedCPU time limit exceededFile size limit exceededFailed to restore prior signal handler for signal ID %d!Restored prior signal handler for signal ID %d!Registered signal handler for signal ID %dFailed to register signal handler for signal ID %d!Warning: module registrations are still present!magick != (const unsigned char *) NULLIgnoring unreasonable MAGICK_IOBUF_SIZE of %ld bbytesmagick_semaphore == (SemaphoreInfo *) NULLmodule_semaphore == (SemaphoreInfo *) NULLPath: "%s" Name: "%s" Filename: "%s" Format L Mode Description --------------------------------------------------------------------------------
Meaning of 'L': P=Primary, S=Stable, U=Unstable <!-- Magick Module Alias Map (modules.mgk) --> <module magick="%s" name="%s" /> magick_info != (MagickInfo *) NULLmagick_info->signature == MagickSignatureimage/cgm;Version=4;ProfileId=WebCGMUnregisterMagickInfoSetMagickInfoRegisterMagickInfoIsMagickConflictInitializeMagickInfoListMagickCondSignalQuitProgressMonitorInitializeMagickExGetMagickInfoArrayGetImageMagickDestroyMagickMagickSetFileSystemBlockSize
!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~������������������������������������������������������������������������������������������������������������������������������@� �`��P�0�p��H�(�h��X�8�x��D�$�d��T�4�t��L�,�l��\�<�|��B�"�b��R�2�r� �J�*�j��Z�:�z��F�&�f��V�6�v��N�.�n��^�>�~��A�!�a��Q�1�q� �I�)�i��Y�9�y��E�%�e��U�5�u� �M�-�m��]�=�}��C�#�c��S�3�s��K�+�k��[�;�{��G�'�g��W�7�w��O�/�o��_�?��magick/map.cobject != 0object->reference_count == 0map != 0key != 0clone != 0deallocate != 0map->reference_count == 0iterator != 0iterator->member != 0MagickMapAllocateMapMagickMapAllocateIteratorobject->signature == MagickSignaturemap->signature == MagickSignatureiterator->signature == MagickSignatureMagickMapRemoveEntryMagickMapIteratePreviousMagickMapIterateNextMagickMapIterateToFrontMagickMapIterateToBackMagickMapDereferenceIteratorMagickMapDeallocateIteratorMagickMapDeallocateMapMagickMapAllocateIteratorMagickMapClearMapMagickMapCloneMapMagickMapCloneMapMagickMapAllocateMapMagickMapDestroyObjectMagickMapAllocateObjectMagickMapAddEntryMagickMapAddEntryMagickMapAccessEntrymagick/memory.c((ptrdiff_t) p - sizeof(MagickMemoryResource_T)) > 0(&memory_resource)->signature == MagickSignature ��0��@�������_MagickResourceLimitedMemoryGetSizeAttribute_MagickReallocateResourceLimitedMemory[Built In]Unloading "%s" module ...magick/module.cJP2"%.1024s: %.1024s"<modulelist != (char **) NULL*.laIM_MOD_function != (char *) NULLMAGICK_CODER_MODULE_PATHMAGICK_FILTER_MODULE_PATHtag != (const char *) NULLtag != (char *) NULL%.1024s.la"%.256s: %.256s"%.64sImagemodules.mgkMagick Module module != (const char *) NULLRegister%sImageUnregister%sImageLoading all modules .../usr/lib64/GraphicsMagick-1.3.38/modules-Q16/coders//usr/lib64/GraphicsMagick-1.3.38/modules-Q16/filters/Module path: Buffer overflow of component "%s"Module path: Skipping invalid path component "%s" (%s)Searching for coder module file "%s" ...Searching for filter module file "%s" ...Searching for module file "%s" in path "%s"Invoking "%.1024s" filter moduleMethod name "%.1024s" was not found in module "%.1024s"!Returned from "%.1024s" filter moduleOpening module at path "%s" ...entry->signature == MagickSignatureFunction "%s" in module "%s" at address %pSearching for module "%s" using file name "%s"GetModuleList did not return any modulesGetModuleListForDirectoryOpenModulesTagToFunctionNameRegisterModuleOpenModuleOpenModuleReadModuleConfigureFileInitializeModuleSearchPathInitializeModuleSearchPathFindMagickModuleFindMagickModuleTagToFilterModuleNameExecuteModuleProcessExecuteModuleProcessUnloadModuleUnregisterModule3FRDCRAW8BIMMETA8BIMTEXTMETA8BIMWTEXTMETA APP1METAAPP1JPEGMETAARWDCRAWAVIFHEIFBGRAYBIEJBIGBIGTIFFTIFFBMP2BMPBMP3BMPBRFBRAILLECGRAYCALCALSCINCINEONCMYKACMYKCR2DCRAWCRWDCRAWCURICONDCRDCRAWDCXPCXDNGDCRAWEPDFPDFEPIPSEPSPSEPS2PS2EPS3PS3EPSFPSEPSIPSEPT2EPTEPT3EPTERFDCRAWEXIFMETAFILEURLFRACTALPLASMAFTPURLGGRAYG3FAXGIF87GIFGRANITELOGOGRAYAGRAYGROUP4RAWTIFF HLOGOHEICHEIFHTMHTMLHTTPURLICBTGAICCMETAICMMETAICOICONICODIBDIBIMAGELOGOIPTCMETAIPTCTEXTMETAIPTCWTEXTMETA ISOBRLBRAILLEISOBRL6BRAILLEJ2CJP2JBGJBIGJNGPNGJPCJP2JPGJPEGKGRAYK25DCRAWKDCDCRAWLOCALECLOCALELOCALEHLOCALELOCALEMCLOCALEMGRAYM2VMPEGMEFDCRAWMNGPNGMPGMPEGMRWDCRAWNEFDCRAWNETSCAPELOGOOGRAYORFDCRAWP7PNMPALUYVYPAMPNMPATTERNLOGOPBMPNMPCDSPCDPCTPICTPEFDCRAWPFATTFPFBTTFPGMPNMPGXJP2PICONXPMPMXPMPNG24PNGPNG32PNGPNG8PNGPPMPNMPTIFTIFFRGRAYRAFDCRAWRASSUNRGBARGBROSELOGOSHTMLHTMLSR2DCRAWSRFDCRAWSVGZSVGTEXTTXTTIFTIFFUBRLBRAILLEUBRL6BRAILLEVDATGAVSTTGAX3FDCRAWXMPMETAXTRNARRAYXTRN XTRNBLOBXTRNXTRNFILEXTRNXTRNIMAGEXTRN XVVIFFYGRAYmagick/monitor.ctext != (const char *) NULLmonitor_semaphore == (SemaphoreInfo *) NULLMagickMonitorInitializeMagickMonitormagick/montage.c120x120+4+3>6x4images != (Image *) NULL[%s] Create image tiles...%.1024s!%ldx%ld%+ld%+ld%lux%lu+0+0montage_info->signature == MagickSignaturemontage_info != (MontageInfo *) NULL[%s] Create visual image directory...MontageImagesMontageImagesGetMontageInfoDestroyMontageInfo�J@magick/omp_data_view.cindex < data_set->nviewsAssignThreadViewDataAccessThreadViewDataByIdAccessThreadViewDataAllocateThreadViewDataArrayAllocateThreadViewDataSetx5��P7��P7���7���7��08��08��P6��P6��P6��x5���6��9��89��89��h9��h9���9���9���8���8���8��9���8��:��H:��H:��x:��x:���:���:���9���9���9��:���9���:���<���<�� =�� =���=���=���;���;���;���:�� <��h>���>���>���>���>���>���>��@>��@>��@>��h>���=���?���?���?��@��@��@@��@@��p?��p?��p?���?��?��`@��(A��(A��`A��`A���A���A���@���@���@��`@���@���A��xB��xB���B���B���B���B���A���A���A���A�� B��C���D���D��XE��XE���E���E���C���C���C��C��PD���F���F���F���F���F��(G��(G��pF��pF��pF���F�� F���G�� H�� H��PH��PH���H���H���G���G���G���G��XG���H���J���J���J���J��`K��`K���I���I���I���H���I���K���L���L���L���L�� L�� L��PL��PL��PL���K���K���L��N��N���M���M��8N��8N��@M��@M��@M���L��pM���N��XO��XO���O���O���O���O���N���N���N���N��`N��P��Q��Q��@Q��@Q���Q���Q��pP��pP��pP��P���P���Q���R���R���R���R��S��S��R��R��R���Q��@R���S���S���S��T��T��8T��8T���S���S���S���S��0S��`U���T���T���U���U���U���U���T���T���T��`U��U���W��9X��9X��iX��iX���X���X���X��YW���X���W���W��@Z���Y���Y���Z���Z���Z���Z���Y���Y���Y��@Z���Y��`\���[���[���\���\���\���\���[���[���[��`\��\�� ^��p`��p`���`���`��pa��pa��H_��H_��H_�� ^���_���f��pd���e��Xc���e��pf��`f�� f���f���f���f���f���f���f���f���e���e��pe��`e��Pe��@e���e���e���e���e��f��f��Pf��@f��0f��QuantumOperatorImageMultivalue[%%s] Apply operator '%s %g (%g%%%%)' to channel '%s'...magick/operator.cmagick/paint.c[%s] Setting opaque color...[%s] Setting transparent color... TransparentImageOpaqueImageMatteFloodfillImageMatteFloodfillImageColorFloodfillImageColorFloodfillImagemagick/pixel_cache.cWidth %lu > %lu "%.1024s"Height %lu > %lu "%.1024s"image->cache != (Cache) NULLview_info != (View *) NULL%ld > %lu "%.1024s"memory-mappeddiskimage->cache != (void *) NULL%.1024s[%ld]remove %.1024s (%.1024s)cache_info != (Cache) NULLdestroy cache %.1024scache != (Cache*) NULLmodify+clone %.1024sunoptimized clonememory => memory clonedisk => memory clonememory => disk clonedisk => disk cloneModifyCache failed! Clone persistent cachecache_info->signature == MagickSignatureTotal pixels %lu > %lu "%.1024s"Xoffset abs(%ld) > %lu "%.1024s"Y offset abs(%ld) > %lu "%.1024s"Failed to allocate %lu bytes for nexus staging (region pixels=%lu, region width=%lu, region height=%lu, cache columns=%lu)!Image dimensions: %lux%lu, Cache dimensions: %lux%luview_info->signature == MagickSignatureview_info != (const View *) NULLopen %.1024s (%.1024s) storage_class=%s, colorspace=%sUnable to extend pixel cache from %lu bytes by %lu bytes to %lu bytesopen %.1024s (%.1024s[%d], %.1024s, %.1024s) storage_class=%s, colorspace=%sview_info->nexus_info.signature == MagickSignaturedestroy skipped (still referenced %ld times) %.1024snexus_info->signature == MagickSignaturecache_info != (_CacheInfoPtr_) NULLreference (reference count now %ld) %.1024sFailed to write row %ld at file offset %ld. Wrote %ld rather than %lu bytes (%s).offset != (magick_off_t *) NULLAttach persistent cache %.1024sUsurp resident persistent cacheSyncImagePixelsExSyncImagePixelsWriteCacheIndexesWriteCacheIndexesWriteCachePixelsWriteCachePixelsCompositeCacheNexusCompositeCacheNexusClipCacheNexusSyncCacheNexusSyncCacheNexusSyncCacheViewPixelsSetImageVirtualPixelMethodSetImagePixelsExSetImagePixelsSetCacheViewPixelsReferenceCacheReferenceCachePersistCachePersistCacheOpenCacheViewOpenCacheOpenCacheClonePixelCacheModifyCacheModifyCacheInterpolateColorGetPixelCachePresentGetPixelCacheInCoreGetPixelCacheAreaGetPixelsGetOnePixelGetIndexesGetImageVirtualPixelMethodGetImagePixelsExGetImagePixelsGetCacheViewRegionGetCacheViewIndexesGetCacheViewImageSetCacheNexusGetCacheNexusGetCacheNexusGetCacheViewPixelsGetCacheViewAreaGetCacheInfoDestroyImagePixelsDestroyCacheInfoDestroyCacheInfoDeinitializeCacheViewCheckImagePixelLimitsAcquireOnePixelAcquireImagePixelsAcquireCacheViewIndexesReadCacheIndexesReadCacheIndexesReadCachePixelsReadCachePixelsSetNexusSetNexusAcquireCacheNexusAcquireCacheNexusAcquireCacheViewPixelsAccessMutablePixelsAccessMutableIndexesAccessImmutableIndexesAccessCacheViewPixelsAllocateThreadViewSet�>magick/pixel_iterator.coptions != (PixelIteratorOptions *) NULLInitializePixelIteratorOptionsmagick/plasma.csegment != (SegmentInfo *) NULLPlasmaImageLabV2CMYYUV (Lu'v')LabYUVK (Lu'v'K)HSVHLSYxyMCH1MCH2MCH3MCH4MCH5MCH6MCH7MCH8MCH9MCH10MCH11MCH12MCH13MCH14MCH15ANYNo error textlcms: #%u, %smagick/profile.cUnableToTransformColorspacename != (const char **) NULLProfile name too long! (%s)Removing %s profile8bimiptcicm���������������������������p���`���P���@���0��� �����������������������������������p���`���P���@���0��� ������SetImageProfileSetImageProfilelcmsReplacementErrorHandlerProfileImageProfileImageNextImageProfileGetImageProfileAppendImageProfileAdding %s profile with length %ld bytesNew Profile: %lu bytes, Existing Profile: %lu bytesSource pixel format: COLORSPACE=%s SWAPFIRST=%d FLAVOR=%d PLANAR=%d ENDIAN16=%d DOSWAP=%d EXTRA=%d CHANNELS=%d BYTES=%dTarget pixel format: COLORSPACE=%s SWAPFIRST=%d FLAVOR=%d PLANAR=%d ENDIAN16=%d DOSWAP=%d EXTRA=%d CHANNELS=%d BYTES=%dPerforming pseudo class color conversionCompleted pseudo class color conversionPerforming direct class color conversion[%s] Color Transform Pixels...Completed direct class color conversionmagick/quantize.c[%s] Classify colors...[%s] Reduce colors: %lu...[%s] Assign colors...map_image != (Image *) NULL[%s] Ordered dither...quantize_info != (QuantizeInfo *) NULLquantize_info->signature == MagickSignaturemap_image->signature == MagickSignaturequantize_info != (const QuantizeInfo *) NULLQuantizeImagesQuantizeImagesQuantizeImageQuantizeImage�0��<��@�p�L�| ��,���`�P�l�\�8��4��H�x�D�t(��$���h�X�d�TOrderedDitherImageMapImagesMapImagesAssignImageColorsClassifyImageColorsMapImageMapImageGrayscalePseudoClassImageGrayscalePseudoClassImageGetQuantizeInfoGetImageQuantizeErrorDestroyQuantizeInfoCompressImageColormap��l{��@Bmagick/registry.cid=%ldregistry_semaphore == (SemaphoreInfo *) NULLSetMagickRegistryInitializeMagickRegistryGetMagickRegistryGetImageFromMagickRegistrymagick/random.c/dev/urandomInitializeMagickRandomGenerator[MVG:%.1024s]magick/render.cpush %.512spush %.512s %.512spopmoveto ghostlinemoveto openmovetolinetodown begin vector-path end vector-path %g,%g %s begin active-edge end active-edge edge %lu: direction: %s ghostline: %s bounds: %g,%g - %g,%g %g,%g begin draw-polygon end draw-polygon[%s] Affine composite...Inverse affine divisor: %g begin draw-stroke-polygon end draw-stroke-polygon begin clip-path %.1024send clip-pathbegin draw-imageMAGICK_SKIP_RENDERINGarcclip-ruleclip-unitsdecoratefill-rulefill-opacityfont-familyfont-sizefont-stretchfont-stylefont-weightbolderlightergradient-unitsdefsgradientgraphic-contextpatternpushradial[MVG:%.1024s-geometry]%gx%g%+g%+gpattern x ordinate (%g)pattern width (%g)pattern height (%g)pattern dimensions %lux%luroundRectangleskewXskewYstop-colorstroke-antialiasstroke-dasharraystroke-dashoffsetstroke-linecapstroke-linejoinstroke-miterlimitstroke-opacitystroke-widthsvg-complianttextctextdxextextdytextrtextxtextytext-aligncentertext-anchorstartmiddletext-antialiastext-undercolortranslateviewbox %.*si < number_pointsj < (long) number_pointsj+k < (long) number_pointsCcSsQqTtattribute not recognized: %c begin draw-primitive affine: %g,%g,%g,%g,%g,%g end draw-primitivedata:http://https://ftp://%gx%g!ColorPrimitive %ld,%ld %sMattePrimitive %ld,%ld %sTextPrimitive %ld,%ldImagePrimitive %ld,%ld begin open (%ld) %ld: %g,%g %ld: %g,%g (duplicate) end last (%ld) end open (%ld) begin draw-dashMaximum length: %g, Scale: %g end draw-dash[%s] Render...end draw-image begin mask %.1024send composite-pathend pattern-pathPrimitive "%s" id "%s" not definedprimitive_info != (PrimitiveInfo *) NULLcomposite != (const Image *) NULLcomposite->signature == MagickSignaturedraw_info != (const DrawInfo *) NULLdraw_info->primitive != (char *) NULL(unsigned long) i < number_pointsbegin pattern-path %.1024s %.1024s_�����������������A����������P���������� ��������I�������u��������0��p�����=�����������������������������������A����������P���������� ��������I�������u��������0��p�����=�������A�������4�4�D��4�4�4�4������\�� �x���T�X������$�u�4�������7�������������������������������>����_ ���� ��������B��������������������7�������������������������������>����_ ���� ��������B����������������������������������w����[��GetDrawInfoDrawPatternPathDrawPatternPathClonePolygonInfoLogPolygonInfoConvertPathToPolygonLogPathInfoConvertPrimitiveToPathDrawPolygonPrimitiveDrawPolygonPrimitiveTraceStrokePolygonDrawStrokePolygonDrawDashPolygonLogPrimitiveInfoDrawPrimitiveTracePathTraceBezierTraceEllipsePrimitiveInfoReallocInsertAttributeIntoInputStreamExtractTokensBetweenPushPopDrawImageRecurseInDrawImageDrawImageDrawCompositeMaskDrawCompositeMaskDrawClipPathDrawClipPathInverseAffineMatrixDrawAffineImageDestroyDrawInfo[DrawImageRecursion]-DT�!�?-DT�!�?pC�����A�p= ף@�dy���=�G�z��?-C��6�-C��6?��m´��yCx�D��wA@�@C��@�p@�>DT�!�?UUUUUU@[%s] Minify...[%s] Resize...Normalmagick/resize.c%s exit Vertical Filter%s exit Horizontal Filter[%s] Magnify... Horizontal/VerticalVertical/HorizontalResize filter order: %s[%s] Scale...Vertical Filter: %lux%lu => %lux%lu (y_factor %g, blur %g, span %lu) ...Horizontal Filter: %lux%lu => %lux%lu (x_factor %g, blur %g, span %lu) ...Magnifying image of size %lux%lu to %lux%luMinifying image of size %lux%lu to %lux%lu((int) filter >= 0) && ((int) filter <= SincFilter)Resizing image of size %lux%lu to %lux%lu using %s filterSampling image of size %lux%lu to %lux%lu[%s] Sample (%lux%lu --> %lux%lu) image...Scaling image of size %lux%lu to %lux%luZoomImageScaleImageScaleImageSampleImageSampleImage�S_ǼC�@� ��@�2e��@��m.�L�@��>�f�Y@�?�~����u@�h�=P��@,�N�˟z@V��@'�T@����E@�5�i��?Ef�F3�@�J˜�@�>)��@�ha�eB�@k��{bi@�?Ef�F3�@X�Cۤ�@����}��@nd�{y�@�W��dj@�e�`�?=h#�OD"u�9��C�Y�8� kC�qxn��B�0J���^B�--*7�A��Q�a�6A>f��@�?=h#�?D���������Ca���_�Y�z�ڈ�B�]@s��@:n�A �a��Q��J��>�@HorizontalFilterVerticalFilterResizeImageResizeImageMinifyImageMinifyImageMagnifyImageMagnifyImage��?�z�G��?{�G�z�?>f��@ �a��Q��J��>�@k��{bi@�W��dj@�e�`�?��>�f�Y@����E@�5�i��?�;f���?q= ףp�?H�z�G�?Q6�3E��?�9��8���?������ ��q�q�?�������?�q�q�?9��8��ؿ������ @���Unlimited----%s %s%s/%s/%smagick/resource.c%c%s%8s: %10s (%s) Set %s resource limit to %s%sMAGICK_LIMIT_DISKMAGICK_LIMIT_FILESMAGICK_LIMIT_MAPMAGICK_LIMIT_MEMORYMAGICK_LIMIT_PIXELSMAGICK_LIMIT_WIDTHMAGICK_LIMIT_HEIGHTMAGICK_LIMIT_READ%i CPU cores are availableOMP_NUM_THREADSfilespixelsResource Limits (Q%d, %d bits/pixel, %dbit address) ----------------------------------------------------
IEC Binary Ranges: Ki = "kibi" (2^10) Mi = "mebi" (2^20) Gi = "gibi" (2^30) Ti = "tebi" (2^40) Pi = "pebi" (2^50) Ei = "exbi" (2^60) Ignored bogus request to set %s resource limit to %ld%sTotal physical memory %ld MB (%ld pages and %ld bytes per page)OMP_NUM_THREADS requests %i threadsSystem file open limits are %lu soft, %lu hardIncreasing file open soft limit from %lu to %luSetMagickResourceLimitLiberateMagickResourceInitializeMagickResourcesAcquireMagickResource[%s] Segment... %03u: %ld %03u: %d magick/segment.cRed Histogram: Green Histogram: Blue Histogram: Red Extrema: Green Extrema: Blue Extrema: Removing Cluster (usage count %lu, %.5f%%) %d-%d %d-%d %d-%d=============================================== Fuzzy c-Means Statistics Cluster Threshold = %g%% Weighting Exponent = %g Total Number of Clusters = %lu Total Number of Vectors = %g Cluster Threshold = %g vectors
MagickXAnimateImagesMagickXAnimateImagesMagickXAnimateBackgroundImageMagickXAnimateBackgroundImage�U�U�U�UBUTTONS Press any button to map or unmap the Command widget.COMMAND WIDGET The Command widget lists a number of sub-menus and commands. They are Animate Open Play Step Repeat Auto Reverse Speed Slower Faster Direction Forward Reverse Help Overview Browse Documentation About Animate Image Info Quit Menu items with a indented triangle have a sub-menu. They are represented above as the indented items. To access a sub-menu item, move the pointer to the appropriate menu and press a button and drag. When you find the desired sub-menu item, release the button and the command is executed. Move the pointer away from the sub-menu if you decide not to execute a particular command.KEYBOARD ACCELERATORS Accelerators are one or two key presses that effect a particular command. The keyboard accelerators that animate(1) understands is: Ctl+O Press to open an image from a file. space Press to display the next image in the sequence. < Press to speed-up the display of the images. Refer to -delay for more information. > Press to slow the display of the images. Refer to -delay for more information. F1 Press to display helpful information about animate(1). Find Press to browse documentation about ImageMagick. ? Press to display information about the image. Press any key or button to erase the information. This information is printed: image name; image size; and the total number of unique colors in the image. Ctl-q Press to discard all images and exit program. %ux%u%+d%+d magick/display.cUnable to configure X image:Font NameFont ColorBox ColorRotate TextDismissApplyAnnotate %+d%+d Browser...SelectUnable to load font:-90-45-30180Dialog...Enter rotation angle:OK%ux%u%+d%+dOperators %+ld%+ld Help Viewer - Image CompositeKey press: 0x%lx (%.1024s)Help Viewer - Image CopyHelp Viewer - Image CropHelp Viewer - Image CutRectifyHelp Viewer - Image CropgHelp Viewer - Image CutgSelect Image to Load:LoadEnter any delay in seconds:GrabTEXTTILEUYVYXCEnter the image geometry:Unknown format: %.1024sUnable to restore directory:OverwriteJPGEnter JPEG quality:EPSPDFPS2LetterTabloidLedgerLegalStatementExecutiveA3A4A5B4B5FolioQuarto10x14612x792>Select page geometry:%dx%d!%s "%s"Unable to save file:print:%sUnable to print image:DeleteUnable to delete image file:Enter image geometry:NewxcDirectory%f %wx%h %bOperatorPasteUnable to paste X imageResizeUnable to cut X imageUnable to rotate X imageEnter shear geometry:Enter roll geometry:Unable to trim X image100.0/100.0/Maximum number of colors:EmbossEnter the noise radius:Reduce NoiseLapacianAdd NoiseEnter threshold value:Enter the edge detect radius:Detect EdgesBevel width:Smooth threshold:Enter the swirl angle:Enter the mask radius:Oil PaintEnter the charcoal radius:Charcoal DrawUnable to annotate X imageUnable to draw on the X imageUnable to pixel edit X imageMethodBorder ColorFuzzMatte ValueUndo2%10%15%OkOpaqueEnter matte value (0 - %lu):Help Viewer - Matte EditUnable to composite X imageEnter border geometry:Add BorderEnter frame geometry:Add FrameUnable to edit image comment@%.1024slaunch:%sUnable to launch image editorEnhanceEffectsF/XMiscellanySave...Print...RedoFlopFlipRotate RightRotate LeftHue...Saturation...Brightness...Gamma...EqualizeNormalizeMap...Quantize...Sharpen...Blur...Edge Detect...Spread...Oil Paint...Charcoal Draw...Zoom ImageShow Preview...Show HistogramShow MatteROIEdge DetectCharcoal DrawingPreviewpreview:%sshow:%sUnable to show image previewhistogram:%sUnable to show histogrammatte:%sUnable to show matte Background the image... Slide ShowHelp Viewer - Displayunknown preview typehorizontalverticalHelp Viewer - Image ChopPixel ColorHelp Viewer - Image Rotation %.2fElementStipplefill rectanglefill circlefill ellipsefill polygonBrickDiagonalScalesWavyTranslucentOpen...xbm:%.1024sEnter line width: %+d%+dColor EditImage EditNextFormerSelect...Delete...New...Visual Directory...Half SizeOriginal SizeDouble SizeRefreshRestoreRotate...Shear...Roll...Trim EdgesAdd Noise...Annotate...Color...Matte...Composite...Add Border...Add Frame...Comment...Launch...Region of Interest...Background...Slide Show...Preferences...About DisplayPrintGraphicsMagick%s: %.1024s[%lu]%s: %.1024s[%lu of %lu]%s: %.1024s%.1024s.magnifyMagnify %uXWindow id: 0x%lx (magnify)Pan Icon%.1024s.panWindow id: 0x%lx (pan)UpdateTile VerbImage file does not exist:Really delete tileShort CutsMagnifyKey press: %d 0x%lx (%.1024s)Help Viewer - Image PanDo you want to save itYour image changed.(B��(B��PB��(B���B���B��B��(B��(B��(B��(B��(B���C��(B��(B��(B��(B��(B���C���C��(B��(B��0D��(B��(B��(B��(B��(B��(B��(B��(B��(B��(B���D��xQ��(R��HS��hT��hP���M���W���W���X��Z���Y���W���W���W���W���W���W���W���W���W���W���W���W���W���W���W���W���W���W���W���W���W���W���W���W���W���W���W���m���m��hm���m���l���i��0i���m���m���m���m���m��Xh��,p���o��Lo���n��[n�� v���v���v���v��8u��8u���v���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u���u�� v���v���v���v��8u��`���`���Ў��`���P���ȍ�����`���`���`���`���`���p���d�����,���������,���,��������������������������������������������,���,���,���������,���,���,���,���,���,���,���,���,���,���,���,���,��������(��H��x���������������h���h�����������������h��p���������H��0������������������(���� ��h�����������������h���0�����`���ز��P���ȳ��H���ȴ������ص��p�����������P�����������H�������8��x�����x�X�������8�X�������������8����������������������������0�������H�������H��8��� ��y'��p�p�H�p�������p�p�p�p�p����?��������������^�������������������X�����������������������@��E���C���B��B���A���A��\A���X��aX��3X��X���X��<H��<H��G���G���G��\G��\G��\G��\G���F���F��(O��(O���H���N���N���M���M���M���M��PH��PH���N���N��KH���N���N���M���M���M���M��$H��$H��(H��(H��H���N���N���M���M���M���M���G���G���N���N��lQ��\N��\N��\M��\M��\M��\M���G���G���N���N���G��0N��0N��0M��0M��0M��0M���G���G��df��d��tc��a��g��$g���f��8���8���������������8���x���x���8���8���8���؎��8���x���8���8���������8���8�����x���8���8���8���8���8���x���8���8���8���8�����������\���S���.������� ���WWWWWWWR HIJKLMN89:;<=,-./0134567 !"#$%&'()*+ MagickXCompositeImage%&'()*+ !"#$56/034 MagickXPasteImage,-.01234567890MagickXConfigureImage789:;
!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGJKLMNOPQRST24567893 J J WWWWWWWWWWMagickXDisplayImageMagickXDisplayImageMagickXDisplayBackgroundImageMagickXDisplayBackgroundImageIn rotate mode, the Command widget has these options: Pixel Color black blue cyan green gray red magenta yellow white Browser... Direction horizontal vertical Help DismissChoose a background color from the Pixel Color sub-menu.Additional background colors can be specified with the colorbrowser. You can change the menu colors by setting the Xresources pen1 through pen9.If you choose the color browser and press Grab, you canselect the background color by moving the pointer to thedesired color on the screen and press any button.Choose a point in the image window and press this button andhold. Next, move the pointer to another location in theimage. As you move a line connects the initial location andthe pointer. When you release the button, the degree ofimage rotation is determined by the slope of the line youjust drew. The slope is relative to the direction youchoose from the Direction sub-menu of the Command widget.To cancel the image rotation, move the pointer back to thestarting point of the line and release the button.In region of interest mode, the Command widget has theseoptions: Help DismissTo define a region of interest, press button 1 and drag.The region of interest is defined by a highlighted rectanglethat expands or contracts as it follows the pointer. Onceyou are satisfied with the region of interest, release thebutton. You are now in apply mode. In apply mode theCommand widget has these options: File Save... Print... Edit Undo Redo Transform Flop Flip Rotate Right Rotate Left Enhance Hue... Saturation... Brightness... Gamma... Spiff Dull Equalize Normalize Negate Grayscale Map... Quantize... Effects Despeckle Emboss Reduce Noise Sharpen... Blur... Threshold... Edge Detect... Spread... Shade... Raise... Segment... F/X Solarize... Swirl... Implode... Wave... Oil Painting... Charcoal Drawing... Miscellany Image Info Zoom Image Show Preview... Show Histogram Show Matte Help DismissYou can make adjustments to the region of interest by movingthe pointer to one of the rectangle corners, pressing abutton, and dragging. Finally, choose an image processingtechnique from the Command widget. You can choose more thanone image processing technique to apply to an area.Alternatively, you can move the region of interest beforeapplying another image processing technique. To exit, pressDismiss.A small window appears showing the location of the cursor inthe image window. You are now in paste mode. To exitimmediately, press Dismiss. In paste mode, the Commandwidget has these options: Operators over in out atop xor plus minus add subtract difference replace Help DismissChoose a composite operation from the Operators sub-menu ofthe Command widget. How each operator behaves is describedbelow. Image window is the image currently displayed onyour X server and image is the image obtained with the FileBrowser widget.Over The result is the union of the two image shapes, with image obscuring image window in the region of overlap.In The result is simply image cut by the shape of image window. None of the image data of image window is in the result.Out The resulting image is image with the shape of image window cut out.Atop The result is the same shape as image image window, with image obscuring image window where the image shapes overlap. Note this differs from over because the portion of image outside image window's shape does not appear in the result.Xor The result is the image data from both image and image window that is outside the overlap region. The overlap region is blank.Plus The result is just the sum of the image data. Output values are cropped to 255 (no overflow). This operation is independent of the matte channels.Minus The result of image - image window, with underflow cropped to zero. The matte channel is ignored (set to 255, full coverage).Add The result of image + image window, with overflow wrapping around (mod 256).Subtract The result of image - image window, with underflow wrapping around (mod 256). The add and subtract operators can be used to perform reversible transformations.Difference The result of abs(image - image window). This is useful for comparing two very similar images.Copy The resulting image is image window replaced with image. Here the matte information is ignored.CopyRed The red layer of the image window is replace with the red layer of the image. The other layers are untouched.CopyGreen The green layer of the image window is replace with the green layer of the image. The other layers are untouched.CopyBlue The blue layer of the image window is replace with the blue layer of the image. The other layers are untouched.CopyOpacity The matte layer of the image window is replace with the matte layer of the image. The other layers are untouched.The image compositor requires a matte, or alpha channel inthe image for some operations. This extra channel usuallydefines a mask which represents a sort of a cookie-cutterfor the image. This is the case when matte is 255 (fullcoverage) for pixels inside the shape, zero outside, andbetween zero and 255 on the boundary. If image does nothave a matte channel, it is initialized with 0 for any pixelmatching in color to pixel location (0,0), otherwise 255.Note that matte information for image window is not retainedfor colormapped X server visuals (e.g. StaticColor,StaticColor, GrayScale, PseudoColor). Correct compositingbehavior may require a TrueColor or DirectColor visual or aStandard Colormap.Choosing a composite operator is optional. The defaultoperator is replace. However, you must choose a location topaste your image and press button 1. Press and hold thebutton before releasing and an outline of the image willappear to help you identify your location.The actual colors of the pasted image is saved. However,the color that appears in image window may be different.For example, on a monochrome screen image window will appearblack or white even though your pasted image may havemany colors. If the image is saved to a file it is writtenwith the correct colors. To assure the correct colors aresaved in the final image, any PseudoClass image is promotedto DirectClass (see miff(5)). To force a PseudoClass imageto remain PseudoClass, use -colors.When an image exceeds the width or height of the X serverscreen, display maps a small panning icon. The rectanglewithin the panning icon shows the area that is currentlydisplayed in the the image window. To pan about the image,press any button and drag the pointer within the panningicon. The pan rectangle moves with the pointer and theimage window is updated to reflect the location of therectangle within the panning icon. When you have selectedthe area of the image you wish to view, release the button.Use the arrow keys to pan the image one pixel up, down,left, or right within the image window.The panning icon is withdrawn if the image becomes smallerthan the dimensions of the X server screen.Matte information within an image is useful for someoperations such as image compositing (See IMAGECOMPOSITING). This extra channel usually defines a maskwhich represents a sort of a cookie-cutter for the image.This is the case when matte is 255 (full coverage) forpixels inside the shape, zero outside, and between zero and255 on the boundary.A small window appears showing the location of the cursor inthe image window. You are now in matte edit mode. To exitimmediately, press Dismiss. In matte edit mode, the Commandwidget has these options: Method point replace floodfill filltoborder reset Border Color black blue cyan green gray red magenta yellow white Browser... Fuzz 0% 2% 5% 10% 15% Dialog... Matte Opaque Transparent Dialog... Undo Help DismissChoose a matte editing method from the Method sub-menu ofthe Command widget. The point method changes the matte valueof any pixel selected with the pointer until the button isis released. The replace method changes the matte value ofany pixel that matches the color of the pixel you select witha button press. Floodfill changes the matte value of any pixelthat matches the color of the pixel you select with a buttonpress and is a neighbor. Whereas filltoborder changes the mattevalue any neighbor pixel that is not the border color. Finallyreset changes the entire image to the designated matte value.Choose Matte Value and pick Opaque or Transarent. For other valuesselect the Dialog entry. Here a dialog appears requesting a mattevalue. The value you select is assigned as the opacity value of theselected pixel or pixels.Now, press any button to select a pixel within the imagewindow to change its matte value.If the Magnify widget is mapped, it can be helpful in positioningyour pointer within the image (refer to button 2).Matte information is only valid in a DirectClass image.Therefore, any PseudoClass image is promoted to DirectClass(see miff(5)). Note that matte information for PseudoClassis not retained for colormapped X server visuals (e.g.StaticColor, StaticColor, GrayScale, PseudoColor) unless youimmediately save your image to a file (refer to Write).Correct matte editing behavior may require a TrueColor orDirectColor visual or a Standard Colormap.BUTTONS The effects of each button press is described below. Three buttons are required. If you have a two button mouse, button 1 and 3 are returned. Press ALT and button 3 to simulate button 2. 1 Press this button to map or unmap the Command widget. 2 Press and drag to define a region of the image to magnify. 3 Press and drag to choose from a select set of commands. This button behaves differently if the image being displayed is a visual image directory. Here, choose a particular tile of the directory and press this button and drag to select a command from a pop-up menu. Choose from these menu items: Open Next Former Delete Update If you choose Open, the image represented by the tile is displayed. To return to the visual image directory, choose Next from the Command widget. Next and Former moves to the next or former image respectively. Choose Delete to delete a particular image tile. Finally, choose Update to synchronize all the image tiles with their respective images.COMMAND WIDGET The Command widget lists a number of sub-menus and commands. They are File Open... Next Former Select... Save... Print... Delete... New... Visual Directory... Quit Edit Undo Redo Cut Copy Paste View Half Size Original Size Double Size Resize... Apply Refresh Restore Transform Crop Chop Flop Flip Rotate Right Rotate Left Rotate... Shear... Roll... Trim Edges Enhance Brightness... Saturation... Hue... Gamma... Sharpen... Dull Equalize Normalize Negate Grayscale Map... Quantize... Effects Despeckle Emboss Reduce Noise Add Noise Sharpen... Blur... Threshold... Edge Detect... Spread... Shade... Painting... Segment... F/X Solarize... Swirl... Implode... Wave... Oil Painting... Charcoal Drawing... Image Edit Annotate... Draw... Color... Matte... Composite... Add Border... Add Frame... Comment... Launch... Region of Interest... Miscellany Image Info Zoom Image Show Preview... Show Histogram Show Matte Background... Slide Show Preferences... Help Overview Browse Documentation About Display Menu items with a indented triangle have a sub-menu. They are represented above as the indented items. To access a sub-menu item, move the pointer to the appropriate menu and press a button and drag. When you find the desired sub-menu item, release the button and the command is executed. Move the pointer away from the sub-menu if you decide not to execute a particular command.KEYBOARD ACCELERATORS Accelerators are one or two key presses that effect a particular command. The keyboard accelerators that display(1) understands is: Ctl+O Press to open an image from a file. space Press to display the next image. If the image is a multi-paged document such as a Postscript document, you can skip ahead several pages by preceeding this command with a number. For example to display the fourth page beyond the current page, press 4n. backspace Press to display the former image. If the image is a multi-paged document such as a Postscript document, you can skip behind several pages by preceeding this command with a number. For example to display the fourth page preceeding the current page, press 4space. Ctl+S Press to write the image to a file. Ctl+P Press to print the image to a Postscript printer. Ctl+D Press to delete an image file. Ctl+N Press to create a blank canvas. Ctl+Q Press to discard all images and exit program. Ctl+Z Press to undo last image transformation. Ctl+R Press to redo last image transformation. Ctl+X Press to cut a region of the image. Ctl+C Press to copy a region of the image. Ctl+V Press to paste a region to the image. < Press to half the image size. - Press to return to the original image size. > Press to double the image size. % Press to resize the image to a width and height you specify.Cmd-A Press to make any image transformations permanent. By default, any image size transformations are applied to the original image to create the image displayed on the X server. However, the transformations are not permanent (i.e. the original image does not change size only the X image does). For example, if you press > the X image will appear to double in size, but the original image will in fact remain the same size. To force the original image to double in size, press > followed by Cmd-A. @ Press to refresh the image window. C Press to crop the image. [ Press to chop the image. H Press to flop image in the horizontal direction. V Press to flip image in the vertical direction. / Press to rotate the image 90 degrees clockwise. \ Press to rotate the image 90 degrees counter-clockwise. * Press to rotate the image the number of degrees you specify. S Press to shear the image the number of degrees you specify. R Press to roll the image. T Press to trim the image edges. Shft-H Press to vary the image hue. Shft-S Press to vary the color saturation. Shft-L Press to vary the color brightness. Shft-G Press to gamma correct the image. Shft-C Press to sharpen the image contrast. Shft-Z Press to dull the image contrast. = Press to perform histogram equalization on the image. Shft-N Press to perform histogram normalization on the image. Shft-~ Press to negate the colors of the image. . Press to convert the image colors to gray. Shft-# Press to set the maximum number of unique colors in the image. F2 Press to reduce the speckles in an image. F3 Press to eliminate peak noise from an image. F4 Press to add noise to an image. F5 Press to sharpen an image. F6 Press to delete an image file. F7 Press to threshold the image. F8 Press to detect edges within an image. F9 Press to emboss an image. F10 Press to displace pixels by a random amount. F11 Press to negate all pixels above the threshold level. F12 Press to shade the image using a distant light source. F13 Press to lighten or darken image edges to create a 3-D effect. F14 Press to segment the image by color. Meta-S Press to swirl image pixels about the center. Meta-I Press to implode image pixels about the center. Meta-W Press to alter an image along a sine wave. Meta-P Press to simulate an oil painting. Meta-C Press to simulate a charcoal drawing. Alt-A Press to annotate the image with text. Alt-D Press to draw on an image. Alt-P Press to edit an image pixel color. Alt-M Press to edit the image matte information. Alt-V Press to composite the image with another. Alt-B Press to add a border to the image. Alt-F Press to add an ornamental border to the image. Alt-Shft-! Press to add an image comment. Ctl-A Press to apply image processing techniques to a region of interest. Shft-? Press to display information about the image. Shft-+ Press to map the zoom image window. Shft-P Press to preview an image enhancement, effect, or f/x. F1 Press to display helpful information about display(1). Find Press to browse documentation about ImageMagick. 1-9 Press to change the level of magnification. Use the arrow keys to move the image one pixel up, down, left, or right within the magnify window. Be sure to first map the magnify window by pressing button 2. Press ALT and one of the arrow keys to trim off one pixel from any side of the image.The cursor changes to a crosshair to indicate you are indraw mode. To exit immediately, press Dismiss. In draw mode,the Command widget has these options: Element point line rectangle fill rectangle circle fill circle ellipse fill ellipse polygon fill polygon Color black blue cyan green gray red magenta yellow white transparent Browser... Stipple Brick Diagonal Scales Vertical Wavy Translucent Opaque Open... Width 1 2 4 8 16 Dialog... Undo Help DismissChoose a drawing primitive from the Element sub-menu.Choose a color from the Color sub-menu. Additionalcolors can be specified with the color browser.If you choose the color browser and press Grab, you canselect the color by moving the pointer to the desiredcolor on the screen and press any button. The transparentcolor updates the image matte channel and is useful forimage compositing.Choose a stipple, if appropriate, from the Stipple sub-menu.Additional stipples can be specified with the file browser.Stipples obtained from the file browser must be on disk in theX11 bitmap format.Choose a width, if appropriate, from the Width sub-menu. Tochoose a specific width select the Dialog widget.Choose a point in the Image window and press button 1 andhold. Next, move the pointer to another location in theimage. As you move, a line connects the initial location andthe pointer. When you release the button, the image isupdated with the primitive you just drew. For polygons, theimage is updated when you press and release the button withoutmoving the pointer.To cancel image drawing, move the pointer back to thestarting point of the line and release the button.In crop mode, the Command widget has these options: Help DismissTo define a cropping region, press button 1 and drag. Thecropping region is defined by a highlighted rectangle thatexpands or contracts as it follows the pointer. Once youare satisfied with the cropping region, release the button.You are now in rectify mode. In rectify mode, the Commandwidget has these options: Crop Help DismissYou can make adjustments by moving the pointer to one of thecropping rectangle corners, pressing a button, and dragging.Finally, press Crop to commit your cropping region. Toexit without cropping the image, press Dismiss.In copy mode, the Command widget has these options: Help DismissTo define a copy region, press button 1 and drag. Thecopy region is defined by a highlighted rectangle thatexpands or contracts as it follows the pointer. Once youare satisfied with the copy region, release the button.You are now in rectify mode. In rectify mode, the Commandwidget has these options: Copy Help DismissYou can make adjustments by moving the pointer to one of thecopy rectangle corners, pressing a button, and dragging.Finally, press Copy to commit your copy region. Toexit without copying the image, press Dismiss.In cut mode, the Command widget has these options: Help DismissTo define a cut region, press button 1 and drag. Thecut region is defined by a highlighted rectangle thatexpands or contracts as it follows the pointer. Once youare satisfied with the cut region, release the button.You are now in rectify mode. In rectify mode, the Commandwidget has these options: Cut Help DismissYou can make adjustments by moving the pointer to one of thecut rectangle corners, pressing a button, and dragging.Finally, press Cut to commit your copy region. Toexit without cutting the image, press Dismiss.First a widget window is displayed requesting you to enter animage name. Press Composite, Grab or type a file name.Press Cancel if you choose not to create a composite image.When you choose Grab, move the pointer to the desired windowand press any button.If the Composite image does not have any matte information,you are informed and the file browser is displayed again.Enter the name of a mask image. The image is typicallygrayscale and the same size as the composite image. If theimage is not grayscale, it is converted to grayscale and theresulting intensities are used as matte information.A small window appears showing the location of the cursor inthe image window. You are now in composite mode. To exitimmediately, press Dismiss. In composite mode, the Commandwidget has these options: Operators Over In Out Atop Xor Plus Minus Add Subtract Difference Multiply Bumpmap Copy CopyRed CopyGreen CopyBlue CopyOpacity Clear Dissolve Displace Help DismissChoose a composite operation from the Operators sub-menu ofthe Command widget. How each operator behaves is describedbelow. Image window is the image currently displayed onyour X server and image is the image obtained with the FileBrowser widget.Over The result is the union of the two image shapes, with image obscuring image window in the region of overlap.In The result is simply image cut by the shape of image window. None of the image data of image window is in the result.Out The resulting image is image with the shape of image window cut out.Atop The result is the same shape as image image window, with image obscuring image window where the image shapes overlap. Note this differs from over because the portion of image outside image window's shape does not appear in the result.Xor The result is the image data from both image and image window that is outside the overlap region. The overlap region is blank.Plus The result is just the sum of the image data. Output values are cropped to 255 (no overflow). This operation is independent of the matte channels.Minus The result of image - image window, with underflow cropped to zero. The matte channel is ignored (set to 255, full coverage).Add The result of image + image window, with overflow wrapping around (mod 256).Subtract The result of image - image window, with underflow wrapping around (mod 256). The add and subtract operators can be used to perform reversible transformations.Difference The result of abs(image - image window). This is useful for comparing two very similar images.Multiply The result of image * image window. This is useful for the creation of drop-shadows.Bumpmap The result of surface normals from image * image window.Copy The resulting image is image window replaced with image. Here the matte information is ignored.CopyRed The red layer of the image window is replace with the red layer of the image. The other layers are untouched.CopyGreen The green layer of the image window is replace with the green layer of the image. The other layers are untouched.CopyBlue The blue layer of the image window is replace with the blue layer of the image. The other layers are untouched.CopyOpacity The matte layer of the image window is replace with the matte layer of the image. The other layers are untouched.The image compositor requires a matte, or alpha channel inthe image for some operations. This extra channel usuallydefines a mask which represents a sort of a cookie-cutterfor the image. This is the case when matte is 255 (fullcoverage) for pixels inside the shape, zero outside, andbetween zero and 255 on the boundary. If image does nothave a matte channel, it is initialized with 0 for any pixelmatching in color to pixel location (0,0), otherwise 255.If you choose Dissolve, the composite operator becomes Over. Theimage matte channel percent transparency is initialized to factor.The image window is initialized to (100-factor). Where factor is thevalue you specify in the Dialog widget.Displace shifts the image pixels as defined by a displacementmap. With this option, image is used as a displacement map.Black, within the displacement map, is a maximum positivedisplacement. White is a maximum negative displacement andmiddle gray is neutral. The displacement is scaled to determinethe pixel shift. By default, the displacement applies in both thehorizontal and vertical directions. However, if you specify a mask,image is the horizontal X displacement and mask the vertical Ydisplacement.Note that matte information for image window is not retainedfor colormapped X server visuals (e.g. StaticColor,StaticColor, GrayScale, PseudoColor). Correct compositingbehavior may require a TrueColor or DirectColor visual or aStandard Colormap.Choosing a composite operator is optional. The defaultoperator is replace. However, you must choose a location tocomposite your image and press button 1. Press and hold thebutton before releasing and an outline of the image willappear to help you identify your location.The actual colors of the composite image is saved. However,the color that appears in image window may be different.For example, on a monochrome screen image window will appearblack or white even though your composited image may havemany colors. If the image is saved to a file it is writtenwith the correct colors. To assure the correct colors aresaved in the final image, any PseudoClass image is promotedto DirectClass (see miff(5)). To force a PseudoClass imageto remain PseudoClass, use -colors.In color edit mode, the Command widget has these options: Method point replace floodfill filltoborder reset Pixel Color black blue cyan green gray red magenta yellow white Browser... Border Color black blue cyan green gray red magenta yellow white Browser... Fuzz 0% 2% 5% 10% 15% Dialog... Undo Help DismissChoose a color editing method from the Method sub-menuof the Command widget. The point method recolors any pixelselected with the pointer until the button is released. Thereplace method recolors any pixel that matches the color ofthe pixel you select with a button press. Floodfill recolorsany pixel that matches the color of the pixel you select witha button press and is a neighbor. Whereas filltoborder recolorsany neighbor pixel that is not the border color. Finally resetchanges the entire image to the designated color.Next, choose a pixel color from the Pixel Color sub-menu.Additional pixel colors can be specified with the colorbrowser. You can change the menu colors by setting the Xresources pen1 through pen9.Now press button 1 to select a pixel within the image windowto change its color. Additional pixels may be recolored asprescribed by the method you choose.If the Magnify widget is mapped, it can be helpful in positioningyour pointer within the image (refer to button 2).The actual color you request for the pixels is saved in theimage. However, the color that appears in your image windowmay be different. For example, on a monochrome screen thepixel will appear black or white even if you choose thecolor red as the pixel color. However, the image saved to afile with -write is written with red pixels. To assure thecorrect color text in the final image, any PseudoClass imageis promoted to DirectClass (see miff(5)). To force aPseudoClass image to remain PseudoClass, use -colors.In chop mode, the Command widget has these options: Direction horizontal vertical Help DismissIf the you choose the horizontal direction (this is thedefault), the area of the image between the two horizontalendpoints of the chop line is removed. Otherwise, the areaof the image between the two vertical endpoints of the chopline is removed.Select a location within the image window to begin your chop,press and hold any button. Next, move the pointer toanother location in the image. As you move a line willconnect the initial location and the pointer. When yourelease the button, the area within the image to chop isdetermined by which direction you choose from the Commandwidget.To cancel the image chopping, move the pointer back to thestarting point of the line and release the button.In annotate mode, the Command widget has these options: Font Name fixed variable 5x8 6x10 7x13bold 8x13bold 9x15bold 10x20 12x24 Browser... Font Color black blue cyan green gray red magenta yellow white transparent Browser... Font Color black blue cyan green gray red magenta yellow white transparent Browser... Rotate Text -90 -45 -30 0 30 45 90 180 Dialog... Help DismissChoose a font name from the Font Name sub-menu. Additionalfont names can be specified with the font browser. You canchange the menu names by setting the X resources font1through font9.Choose a font color from the Font Color sub-menu.Additional font colors can be specified with the colorbrowser. You can change the menu colors by setting the Xresources pen1 through pen9.If you select the color browser and press Grab, you canchoose the font color by moving the pointer to the desiredcolor on the screen and press any button.If you choose to rotate the text, choose Rotate Text from themenu and select an angle. Typically you will only want torotate one line of text at a time. Depending on the angle youchoose, subsequent lines may end up overwriting each other.Choosing a font and its color is optional. The default fontis fixed and the default color is black. However, you mustchoose a location to begin entering text and press button 1.An underscore character will appear at the location of thepointer. The cursor changes to a pencil to indicate you arein text mode. To exit immediately, press Dismiss.In text mode, any key presses will display the character atthe location of the underscore and advance the underscorecursor. Enter your text and once completed press Apply tofinish your image annotation. To correct errors press BACKSPACE. To delete an entire line of text, press DELETE. Anytext that exceeds the boundaries of the image window isautomatically continued onto the next line.The actual color you request for the font is saved in theimage. However, the color that appears in your image windowmay be different. For example, on a monochrome screen thetext will appear black or white even if you choose the colorred as the font color. However, the image saved to a filewith -write is written with red lettering. To assure thecorrect color text in the final image, any PseudoClass imageis promoted to DirectClass (see miff(5)). To force aPseudoClass image to remain PseudoClass, use -colors.�U�U�U�U�������������������������� ��AA>>� ��AA>>DD��""DD��""DD��""DD��""����`�`�`�`�����`�`�`�`�Configure Image: %dx%d=>%lux%luHelp Viewer - Image AnnotationPress dismiss and choose an image to use as a mask.Your image does not have the required matte information.Enter the blend factor (0.0 - 99.9%):Enter the horizontal and vertical scale:Unable to change to directory:Select Postscript Page Geometry:Unable to open temporary file:Enter resize geometry (e.g. 640x480, 200%):Enter percent change in image hue (0-200):Enter percent change in color saturation (0-200):Enter percent change in color brightness (0-200):Enter gamma value (e.g. 1.0/1.0/1.6):Enter the emboss radius and standard deviation:Select a type of noise to add to your image:Enter the sharpen radius and standard deviation:Enter the blur radius and standard deviation:Enter the displacement amount:Enter the azimuth and elevation of the light source:Enter the solarize factor (0 - 99.9%):Enter the implosion/explosion factor (-1.0 - 1.0):Enter the amplitude and length of the wave:Enter fuzz factor (0.0 - 99.9%):Help Viewer - Region of InterestSelect an enhancement, effect, or F/X:Image does not have any matte informationEnter window id (id 0x00 selects window with pointer):Pause how many 1/100ths of a second between images:Unable to read X bitmap image:magick/widget.cdisplay != (Display *) NULLDon't SaveYesreason != (char *) NULLdescription != (char *) NULLCancelaction != (char *) NULLquery != (char *) NULLreply != (char *) NULLDitherGradationConstrain ratioNon-progressiveColor shadingactivity != (char *) NULLlist != (const char **) NULLtitle != (char *) NULLitem != (char *) NULLtask != (const char *) NULLEnter color name:ResetPattern:Name:#%02x%02x%02xColor is unknown to X server:Unable to obtain fonts names:UnableToViewFontsMemoryAllocationFailedBackUnable to read directory:Enter filename:HomeUpDirectory:File name:%.1024s%.1024s%.1024sSelect image format type:title != (const char *) NULLwindows != (MagickXWindows *) NULLselections != (const char **) NULLwindow_info != (MagickXWindowInfo *) NULLUnable to obtain colors names:Unable to get current directory:resource_info != (MagickXResourceInfo *) NULL%lu mega-bytes of memory in the undo edit cache textlist != (const char **) NULLp@���?���<���:���:���:���:���:���>���:���:���:���:���:���>���>���:���:��?���:���:���:���:���:���:���:���:���:���:��(@��)D��)D��PC��PC��`C��PC��PC��)D��)D��)D���C��)D���C��)D��)D��)D��)D��)D��)D��)D��)D��)D��)D��)D��)D��)D��)D��)D��)D��)D��)D��PC��0G��0G��8J��0G���K���J���H��hH��@H��0G��0G��0G��H��0G��0G��0G��0G��0G��0G��0G��0G��0G���G��0G��0G��0G��0G��0G��0G��0G��0G��0G��0G��G��`Z��`Z���`��Hb���a�� `���^���^��`^��`Z��`Z��`Z���^��`Z��`Z��`Z��`Z��`Z��`Z��`Z��`Z��`Z���]��`Z��`Z��`Z��`Z��`Z��`Z��8Z�� Y��`X��`Z���W��0s��0s������H������r�����~���~��0s��0s��0s���~��0s��0s��0s��0s��0s��0s��x~��0s��0s��~��0s��0s��0s��0s��0s��0s���}���|��pr��0s��H|��x���.��z���.��m���]���M���@���.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��.��x���.��z���.��m���]���M���@������������4�������t���t���t�������t���t���t���t���t���t���t���t���t���\������������������� ���X���0���������������С�����������������������������`�������������������������������������������е��x����������8������س����������������������������������������������������������������ز������X������8�����X������X���������������X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X���X�����X������X���������������\��\��<������E��t��l�<�\��\��\����\��\��\��\��\��\����\��\��d�\��\��\��\��\��\��4�4�\�\����9������w�����j��Z��J��7�����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������9������w�����j��Z��J��7��h��h��p ��!��p��M��������X��h��h��h����h��h��h��h��h��h����h��h�����h��h��h��h��h��h��P��(��P��h������,���,��g3���,��Z3��J3��:3��t3���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,���,��g3���,��Z3��J3��:3��t3���8���8��t<���8���=���<��4;��;���:���8���8���8���:���8���8���8���8���8���8���8���8���8��:���8���8���8���8���8���8���8���8���8���8���8���K���K���W���K���V���K��V���U���U���K���K���K���U���K���K���K���K���K���K��lU���K���K���T���K���K���K���K���K���K���T���S���K���K��lX���\��RT���]��RT���]���]���]���]��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT��RT���\��RT���]��RT���]���]���]���]��MagickXTextViewWidgetdisplay image centered on a backdropconfirm on program exitcorrect image for display gammadisplay warning messagesapply Floyd/Steinberg error diffusion to imageuse a shared colormap for colormapped X visualsdisplay images as an X server pixmapMagickXPreferencesWidgetMagickXNoticeWidgetMagickXMonitorWidgetMagickXMenuWidgetMagickXListBrowserWidgetMagickXInfoWidgetMagickXFontBrowserWidgetMagickXFileBrowserWidgetMagickXDialogWidgetMagickXConfirmWidgetx@����?���s��q��|�q��v�qnv��spn3��s�q�;����9>x��?�|p�����8����8���9�����q<�� �|<���?~x��8��@�8��@w0�����-0�����8�0�����p��8?@`p|��=@t�>�9�6�?��6��� �������0`xx`�8�`�����������p`����p0���p�`� `� 83`x�?`�qb��9��0���9�|��8�r�8����><�>����c�x�����i0x��=<8�����8��?��l�6���=��`��{�<�y��g���MagickXCommandWidgetMagickXColorBrowserWidgetBrowse and Selecmagick/xwindow.cshm detatch at address 0x%perror != (XErrorEvent *) NULLIPC_RMIDshm control id=%d cmd=%scolor != (XColor *) NULLunknown visual classStaticGrayStaticColorPseudoColorDirectColorGrayScale_HP_RGB_SMOOTH_MAP_LISTstaticgraystaticcolorpseudocolortruecolordirectcolordefaultRGB_%.1024s_MAP_XSETROOT_IDDisplay gamma: %.1024s