*** Round %d, deleting %d addresses *** *** Flush remains incomplete after %d rounds. *** Failed to process link information Can't restore address dump from a terminal Magic mismatch (%d elems, %x magic) Warning: %s option is not mutable from userspace Warning: %s option can be set only for IPv6 addresses Not enough information: "dev" argument is required. Warning: Executing wildcard deletion to stay compatible with old scripts. Explicitly specify the prefix length (%s/%d) to avoid this warning. This special behaviour is likely to disappear in further releases, fix your scripts! Broadcast can be set only for IPv4 addresses preferred_lft is greater than valid_lft autojoin needs multicast address RX: %*s %*s %*s %*s %*s %*s %*s%s RX errors:%*s %*s %*s %*s %*s %*s%*s%*s%s TX: %*s %*s %*s %*s %*s %*s %*s%s TX errors:%*s %*s %*s %*s %*s %*s%sioctl(SIOCGIFTXQLEN) failed: %s RX: bytes packets mcast bcast Not sending a binary stream to stdout Can't write magic to dump file VF min/max rate API not supported Command "%s" is unknown, try "ip address help". prefix label %u dev is invalid label is invalid Not enough information: "prefix" argument is required. Not enough information: "label" argument is required. "ip addrlabel show" does not take any arguments. "ip addrlabel flush" does not allow extra arguments Usage: ip addrlabel { add | del } prefix PREFIX [ dev DEV ] [ label LABEL ] ip addrlabel [ list | flush | help ] Command "%s" is unknown, try "ip addrlabel help". realm%s Cannot open "%s": %s -1Cannot flush routing cache as to viavia %s expires %dsec expireserror %u users %u usersused %u ipid 0x%04llx ipidts 0x%llxtsage %usec tsagecachetable id value is invalid Invalid VRF cachedclonedTOS value is invalid invalid "protocol" node type value is invalid oifiifinvalid mark valueinvalid realms rootexact"tos" value is invalid "expires" value is invalid invalid "scope" value "mtu" value is invalid hoplimit"hoplimit" value is invalid advmss"mss" value is invalid reorderingrtt"rtt" value is invalid rto_min"rto_min" value is invalid "window" value is invalid "cwnd" value is invalid initcwnd"initcwnd" value is invalid initrwnd"initrwnd" value is invalid features"features" value not valid quickack"quickack" value is invalid congctlrttvar"rttvar" value is invalid ssthresh"ssthresh" value is invalid "realm" value is invalid onlinknhid"id" value is invalid "protocol" value is invalid "table" value is invalid prefmediumhigh"pref" value is invalid ttl-propagatefastopen_no_cookieweight"weight" is invalid Error: cannot parse nexthop deadpervasivenotifyunresolvedrt_offloadrt_traprt_offload_failedvia Not a route: %08x %08x %08x 0/%d from %s 0/%unhid %u tos %s proto %s prefsrcsrc mark 0x%llx mark %u uid %u %s cache rejectdst-natsrc-natmasqdst-directsrc-directredirectedredirectfastroute%x>metric %d ecn %gs %ums congestionpref %sttl-propogatettl-propogate %snh_info nh_info nexthopsOifs: %s nexthop (ttl>%d)ttlweight %d connectedinvalid UID fibmatchinvalid sport invalid dport Invalid "ipproto" value An error :-) Not a route? Failed to connect the route prependappendtestFailed to restore: ftellFailed to restore: fseekUsage: ip route { list | flush } SELECTOR ip route save SELECTOR ip route restore ip route showdump ip route get [ ROUTE_GET_FLAGS ] ADDRESS [ from ADDRESS iif STRING ] [ oif STRING ] [ tos TOS ] [ mark NUMBER ] [ vrf NAME ] [ uid NUMBER ] [ ipproto PROTOCOL ] [ sport NUMBER ] [ dport NUMBER ] ip route { add | del | change | append | replace } ROUTE SELECTOR := [ root PREFIX ] [ match PREFIX ] [ exact PREFIX ] [ table TABLE_ID ] [ vrf NAME ] [ proto RTPROTO ] [ type TYPE ] [ scope SCOPE ] ROUTE := NODE_SPEC [ INFO_SPEC ] NODE_SPEC := [ TYPE ] PREFIX [ tos TOS ] [ table TABLE_ID ] [ proto RTPROTO ] [ scope SCOPE ] [ metric METRIC ] [ ttl-propagate { enabled | disabled } ] INFO_SPEC := { NH | nhid ID } OPTIONS FLAGS [ nexthop NH ]... NH := [ encap ENCAPTYPE ENCAPHDR ] [ via [ FAMILY ] ADDRESS ] [ dev STRING ] [ weight NUMBER ] NHFLAGS FAMILY := [ inet | inet6 | mpls | bridge | link ] OPTIONS := FLAGS [ mtu NUMBER ] [ advmss NUMBER ] [ as [ to ] ADDRESS ] [ rtt TIME ] [ rttvar TIME ] [ reordering NUMBER ] [ window NUMBER ] [ cwnd NUMBER ] [ initcwnd NUMBER ] [ ssthresh NUMBER ] [ realms REALM ] [ src ADDRESS ] [ rto_min TIME ] [ hoplimit NUMBER ] [ initrwnd NUMBER ] [ features FEATURES ] [ quickack BOOL ] [ congctl NAME ] [ pref PREF ] [ expires TIME ] [ fastopen_no_cookie BOOL ] TYPE := { unicast | local | broadcast | multicast | throw | unreachable | prohibit | blackhole | nat } TABLE_ID := [ local | main | default | all | NUMBER ] SCOPE := [ host | link | global | NUMBER ] NHFLAGS := [ onlink | pervasive ] RTPROTO := [ kernel | boot | static | NUMBER ] PREF := [ low | medium | high ] TIME := NUMBER[s|ms] BOOL := [1|0] FEATURES := ecn ENCAPTYPE := [ mpls | ip | ip6 | seg6 | seg6local | rpl | ioam6 | xfrm ] ENCAPHDR := [ MPLSLABEL | SEG6HDR | SEG6LOCAL | IOAM6HDR | XFRMINFO ] SEG6HDR := [ mode SEGMODE ] segs ADDR1,ADDRi,ADDRn [hmac HMACKEYID] [cleanup] SEGMODE := [ encap | encap.red | inline | l2encap | l2encap.red ] SEG6LOCAL := action ACTION [ OPTIONS ] [ count ] ACTION := { End | End.X | End.T | End.DX2 | End.DX6 | End.DX4 | End.DT6 | End.DT4 | End.DT46 | End.B6 | End.B6.Encaps | End.BM | End.S | End.AS | End.AM | End.BPF } OPTIONS := OPTION [ OPTIONS ] OPTION := { flavors FLAVORS | srh SEG6HDR | nh4 ADDR | nh6 ADDR | iif DEV | oif DEV | table TABLEID | vrftable TABLEID | endpoint PROGNAME } FLAVORS := { FLAVOR[,FLAVOR] } FLAVOR := { psp | usp | usd | next-csid } IOAM6HDR := trace prealloc type IOAM6_TRACE_TYPE ns IOAM6_NAMESPACE size IOAM6_TRACE_SIZE XFRMINFO := if_id IF_ID [ link_dev LINK ] ROUTE_GET_FLAGS := [ fibmatch ] /proc/sys/net/ipv4/route/flush*** IPv4 routing cache is flushed. *** Flush not completed after %ld seconds, %d entries remain ***
*** Round %d, deleting %d entries *** Can't restore route dump from a terminal "ip route flush" requires arguments. use nexthop syntax to specify multiple via "reordering" value is invalid "quickack" value should be 0 or 1 "ttl-propagate" value is invalid "fastopen_no_cookie" value is invalid "fastopen_no_cookie" value should be 0 or 1 Error: "nexthop" or end of line is expected instead of "%s" Error: unexpected end of line after "nexthop" need at least a destination address Warning: /%u as prefix is invalid, only /32 (or none) is supported. Warning: /%u as prefix is invalid, only /128 (or none) is supported. Command "%s" is unknown, try "ip route help". X��X����������������������X�����������@�@Usage: ip rule { add | del } SELECTOR ACTION ip rule { flush | save | restore } ip rule [ list [ SELECTOR ]] SELECTOR := [ not ] [ from PREFIX ] [ to PREFIX ] [ tos TOS ] [ fwmark FWMARK[/MASK] ] [ iif STRING ] [ oif STRING ] [ pref NUMBER ] [ l3mdev ] [ uidrange NUMBER-NUMBER ] [ ipproto PROTOCOL ] [ sport [ NUMBER | NUMBER-NUMBER ] [ dport [ NUMBER | NUMBER-NUMBER ] ] ACTION := [ table TABLE_ID ] [ protocol PROTO ] [ nat ADDRESS ] [ realms [SRCREALM/]DSTREALM ] [ goto NUMBER ] SUPPRESSOR SUPPRESSOR := [ suppress_prefixlength NUMBER ] [ suppress_ifgroup DEVGROUP ] TABLE_ID := [ local | main | default | NUMBER ] "ip rule add" requires arguments. "ip rule del" requires arguments. suppress_prefixlength value is invalid Invalid "suppress_ifgroup" value "iif"/"dev" not a valid ifnameWarning: route NAT is deprecated table can not be specified for l3mdev rules "ip rule save" does not take any arguments. Can't restore rule dump from a terminal Command "%s" is unknown, try "ip rule help". Multicast rules are only supported for IPv4/IPv6, was: %i notorderpreference value is invalid fwmark value is invalid fwmask value is invalid tun_id"tun_id" value is invalid invalid table ID suppress_prefixlengthsup_plsuppress_ifgroupsup_group"oif" not a valid ifnamel3mdevuidrange%u-%uinvalid UID range map-to%hu-%huinvalid port range invalid dport range gotoinvalid target Failed to parse rule type%u: not from srclenfrom %sdstlen to %s tos %s fwmark %#llx/%#llxfwmask iif [detached]iif_detached oif oif_detached lookup [l3mdev-table] uidrange %uuid_startuid_end ipproto %s sport %usport_startsport_end dport %udport_startdport_end tun_id %llu lookup %s suppress_prefixlength %dsuppress_prefixlen suppress_ifgroup %s realms %s/flow_from realms flow_to map-to %snat_gateway masquerade goto %u goto %s [unresolved] nop proto %sfrom value is invalid to value is invalid Usage: ip netns list ip netns add NAME ip netns attach NAME PID ip netns set NAME NETNSID ip [-all] netns delete [NAME] ip netns identify [PID] ip netns pids NAME ip [-all] netns exec [NAME] cmd ... ip netns monitor ip netns list-id [target-nsid POSITIVE-INT] [nsid POSITIVE-INT] NETNSID := auto | POSITIVE-INT /proc/self/ns/net: %s. Continuing anyway. rtnl_send(RTM_GETNSID): %s. Continuing anyway. Cannot remove namespace file "%s": %s Cannot open network namespace: %s No netns name and PID specified Cannot open netns runtime directory "%s": %s Warning: could not flock netns runtime directory "%s": %s mount --make-shared %s failed: %s mount --bind %s %s failed: %s Cannot create namespace file "%s": %s Failed to create a new network namespace "%s": %s BUG: wrong nlmsg len %d in %s BUG: NETNSA_NSID is missing %s Failed to open directory %s:%s "netnsid" value should be >= 0Cannot open network namespace "%s": %s RTM_GETNSID is not supported by the kernel. "target-nsid" value is invalid"target-nsid" value should be >= 0Specified string '%s' is not a pid Command "%s" is unknown, try "ip netns help". /proc/self/ns/netmalloc/var/run/netnsNo netns name specified extra arguments specified Stat of netns failed: %s /proc/Open of /proc failed: %s /proc/%s/ns/net netns: %s mkdir %s failed: %s inotify_init failed: %s inotify_add_watch failed: %s read failed: %s add %s delete %s setnsInvalid PID: %s Cannot open init namespace/proc/%d/ns/netBind %s -> %s failed: %s current-nsid unassigned current-nsid %d current-nsid..(iproute2 netns name: %s) (id: %d)No nsid specified Invalid "netnsid" valueselfInvalid netns name "%s" list-idtarget-nsid"nsid" value is invalid"nsid" value should be >= 0identifypidsNo command specified attachprint_nsid/proc/self/ns/neblackholeunreachableprohibitthrowxresolve #��0#��p#���#���#��`#��@#��P#���#���#���#���#��Usage: ip tunnel { add | change | del | show | prl | 6rd } [ NAME ] [ mode { gre | ipip | isatap | sit | vti } ] [ remote ADDR ] [ local ADDR ] [ [i|o]seq ] [ [i|o]key KEY ] [ [i|o]csum ] [ prl-default ADDR ] [ prl-nodefault ADDR ] [ prl-delete ADDR ] [ 6rd-prefix ADDR ] [ 6rd-relay_prefix ADDR ] [ 6rd-reset ] [ ttl TTL ] [ tos TOS ] [ [no]pmtudisc ] [ dev PHYS_DEV ]
Where: NAME := STRING ADDR := { IP_ADDRESS | any } TOS := { STRING | 00..ff | inherit | inherit/STRING | inherit/00..ff } TTL := { 1..255 | inherit } KEY := { DOTTED_QUAD | NUMBER } You managed to ask for more than one tunnel mode. Keys are not allowed with ipip and sit tunnels A broadcast tunnel requires a source address ttl != 0 and nopmtudisc are incompatible cannot determine tunnel mode (ipip, gre, vti or sit) Unsupported protocol family: %d Command "%s" is unknown, try "ip tunnel help" Must specify device 6rd-prefixinvalid 6rd_prefix 6rd-relay_prefixinvalid 6rd-relay_prefix 6rd-reset"dev" not a valid ifnameInvalid 6RD parameter "%s" ipipip/ipgre/ipsitipv6/ipisatapvtiUnknown tunnel mode "%s" hliminvalid TTL bad TOS value"name" not a valid ifnameip_vti0tunl0sit0inherit/%s/iplocal pdr %spdr pr %spr dev %s ttl %u ttl %s nopmtudisc 6rd-prefix %s6rd-prefixlen 6rd-relay_prefix %s6rd-relay_prefixlenipv6/ipv6prlprl-defaultprl-nodefaultprl-deleteInvalid PRL parameter "%s" One PRL entry at a time 6rdip6ip6vti6ip/ipv6ipv4/ipv6ipip6ip4ip6ip6gregre/ipv6any/ipv6%s/ipv6 encaplimit noneip6_tnl_f_ign_encap_limit encaplimit %u hoplimit %u hoplimit %s tclass inheritip6_tnl_f_use_orig_tclass0x%02x tclass %s flowlabel inheritip6_tnl_f_use_orig_flowlabel0x%05x flowlabel %s (flowinfo %s)flowinfo dscp inheritip6_tnl_f_rcv_dscp_copy allow-localremoteip6_tnl_f_allow_local_remoteencaplimitinvalid ELIMinvalid TTLtcinvalid TClassflinvalid Flowlabelnot inheritnoallow-localremoteip6gre0ip6tnl0ip6_vti0Usage: ip -f inet6 tunnel { add | change | del | show } [ NAME ] [ mode { ip6ip6 | ipip6 | ip6gre | vti6 | any } ] [ remote ADDR local ADDR ] [ dev PHYS_DEV ] [ encaplimit ELIM ] [ hoplimit TTL ] [ tclass TCLASS ] [ flowlabel FLOWLABEL ] [ dscp inherit ] [ [no]allow-localremote ] [ [i|o]seq ] [ [i|o]key KEY ] [ [i|o]csum ]
Where: NAME := STRING ADDR := IPV6_ADDRESS ELIM := { none | 0..255 }(default=%d) TTL := 0..255 (default=%d) TCLASS := { 0x0..0xff | inherit } FLOWLABEL := { 0x0..0xfffff | inherit } KEY := { DOTTED_QUAD | NUMBER } Tunnel interface name not specified Command "%s" is unknown, try "ip -f inet6 tunnel help". create socket failed: %s %s: ioctl %x failed: %s auto %sencap-%s %sespmplsget tunnel "%s" failed: %s add tunnel "%s" failed: %s encap csum6 key %u ikey %u okey %urx_drop_ooseqrx_csumtx_seqtx_csum%s Checksum output packets.Cannot send dump request RX: Packets Bytes Errors CsumErrs OutOfSeq Mcasts%s %-10lld %-12lld %-6lld %-8lld %-8lld %-8lld%sTX: Packets Bytes Errors DeadLoop NoRoute NoBufs%s %-10lld %-12lld %-6lld %-8lld %-8lld %-6llddelete tunnel "%s" failed: %s invalid value for "%s": "%s"; it should be an unsigned integer %s Drop packets out of sequence.%s Checksum in received packet is required.%s Sequence packets on output.no%-39s lladdr managedextern_learn ref %urefcnt used %uconfirmedupdatedINCOMPLETEREACHABLESTALEDELAYPROBEFAILEDPERMANENTnoarpincompletenudnud state is badusenullCannot find device "%s" unusedUsage: ip neigh { add | del | change | replace } { ADDR [ lladdr LLADDR ] [ nud STATE ] proxy ADDR } [ dev DEV ] [ router ] [ use ] [ managed ] [ extern_learn ] [ protocol PROTO ]
ip neigh { show | flush } [ proxy ] [ to PREFIX ] [ dev DEV ] [ nud STATE ] [ vrf NAME ] [ nomaster ] ip neigh get { ADDR | proxy ADDR } dev DEV
STATE := { delay | failed | incomplete | noarp | none | permanent | probe | reachable | stale } Not RTM_NEWNEIGH: %08x %08x %08x
WARNING: Kernel does not support filtering by master device
Device and destination are required arguments. Device and address are required arguments. *** Flush not complete bailing out after %d rounds Command "%s" is unknown, try "ip neigh help". "DEV" is invalidgettimeofday%Y-%m-%d %TNot NEIGHTBL: %08x %08x %08x thresh1 %u thresh1thresh2 %u thresh2thresh3 %u thresh3gc_int %llu gc_interval config key_len %u key_lengthentry_size %u entry_sizeentries %u entries last_flush %s last_flushlast_rand %s last_rand hash_rnd %u hash_rndhash_mask %08llx hash_maskhash_chain_gc %u hash_chain_gcproxy_qlen %u proxy_qlen dev refcnt %u base_reachable %llu base_reachableretrans %llu retransgc_stale %llu gc_staledelay_probe %llu delay_probeapp_probes %u app_probesucast_probes %u ucast_probesmcast_probes %u mcast_probesanycast_delay %llu anycast_delayproxy_delay %llu proxy_delayproxy_queue %u proxy_queuelocktime %llu locktime stats allocs %llu allocsdestroys %llu destroyshash_grows %llu hash_growsres_failed %llu res_failedlookups %llu lookupshits %llu hitsrcv_probes_mcast %llu rcv_probes_mcastrcv_probes_ucast %llu rcv_probes_ucastperiodic_gc_runs %llu periodic_gc_runsforced_gc_runs %llu forced_gc_runstable_fulls %llu table_fulls"thresh1" value is invalid"thresh2" value is invalid"thresh3" value is invalidgc_int"gc_int" value is invalid"retrans" value is invalid"gc_stale" value is invalid"queue" value is invalid"app_probes" value is invalid"locktime" value is invalid"base_reachable" value is invalid"delay_probe" value is invalid"ucast_probes" value is invalid"mcast_probes" value is invalid"anycast_delay" value is invalid"proxy_delay" value is invalid"proxy_queue" value is invalidNot enough information: changeable attributes required. Usage: ip ntable change name NAME [ dev DEV ] [ thresh1 VAL ] [ thresh2 VAL ] [ thresh3 VAL ] [ gc_int MSEC ] [ PARMS ] Usage: ip ntable show [ dev DEV ] [ name NAME ] PARMS := [ base_reachable MSEC ] [ retrans MSEC ] [ gc_stale MSEC ] [ delay_probe MSEC ] [ queue LEN ] [ app_probes VAL ] [ ucast_probes VAL ] [ mcast_probes VAL ] [ anycast_delay MSEC ] [ proxy_delay MSEC ] [ proxy_queue LEN ] [ locktime MSEC ] Command "%s" is unknown, try "ip ntable help". Invalid "vlan" value Invalid "qos" value protocol is invalid request send failedCannot create control socketSIOCSIFHWADDRSIOCSIFHWBROADCAST ip link help [ TYPE ]
delOperator required not a valid altname%s/link_%s.so%s_link_utilInvalid "index" valuetxqueuelenInvalid "txqueuelen" value Invalid "mtu" value xdpgenericxdpdrvxdpoffloadxdpInvalid "netns" value allmulticasttrailersInvalid "vf" value max_tx_ratemin_tx_rateInvalid "rate" value Invalid "max tx rate" value Invalid "min tx rate" value query_rssInvalid "state" value node_guidInvalid GUID format port_guidalias too long dormantInvalid link mode Invalid operstate numtxqueuesInvalid "numtxqueues" value numrxqueuesInvalid "numrxqueues" value addrgenmodelink-netnslink-netns/link-netnsidInvalid "link-netns" value Invalid "link-netnsid" value protodownprotodown_reasoninvalid protodown reason Invalid "gso_max_size" value Invalid "gso_max_segs" value Invalid "gro_max_size" value noroute%sRX: %*s %*s %*s %*s %*s%s%sTX: %*s %*s %*s %*s%s%u: mpls: unknown af(%d) socket(PF_PACKET)SIOCGIFINDEXbindSIOCSIFNAMESIOCSIFXQLENSIOCSIFMTUSIOCGIFFLAGSSIOCSIFFLAGSafstatsCannont send dump requestpropertyInvalid "vlan protocol" value - supported %s, %s Wrong address (%s) length: expected %d bytes TYPE := { amt | bareudp | bond | bond_slave | bridge | bridge_slave | dsa | dummy | erspan | geneve | gre | gretap | gtp | ifb | ip6erspan | ip6gre | ip6gretap | ip6tnl | ipip | ipoib | ipvlan | ipvtap | macsec | macvlan | macvtap | netdevsim | nlmon | rmnet | sit | team | team_slave | vcan | veth | vlan | vrf | vti | vxcan | vxlan | wwan | xfrm | virt_wifi } Usage: ip link add [link DEV | parentdev NAME] [ name ] NAME [ txqueuelen PACKETS ] [ address LLADDR ] [ broadcast LLADDR ] [ mtu MTU ] [index IDX ] [ numtxqueues QUEUE_COUNT ] [ numrxqueues QUEUE_COUNT ] [ netns { PID | NAME } ] type TYPE [ ARGS ]
ip link delete { DEVICE | dev DEVICE | group DEVGROUP } type TYPE [ ARGS ]
ip link set { DEVICE | dev DEVICE | group DEVGROUP } [ { up | down } ] [ type TYPE ARGS ] Usage: ip link set DEVICE [ { up | down } ] [ arp { on | off } ] [ dynamic { on | off } ] [ multicast { on | off } ] [ allmulticast { on | off } ] [ promisc { on | off } ] [ trailers { on | off } ] [ carrier { on | off } ] [ txqueuelen PACKETS ] [ name NEWNAME ] [ address LLADDR ] [ broadcast LLADDR ] [ mtu MTU ] [ netns { PID | NAME } ] [ link-netns NAME | link-netnsid ID ] [ alias NAME ] [ vf NUM [ mac LLADDR ] [ vlan VLANID [ qos VLAN-QOS ] [ proto VLAN-PROTO ] ] [ rate TXRATE ] [ max_tx_rate TXRATE ] [ min_tx_rate TXRATE ] [ spoofchk { on | off} ] [ query_rss { on | off} ] [ state { auto | enable | disable} ] [ trust { on | off} ] [ node_guid EUI64 ] [ port_guid EUI64 ] ] [ { xdp | xdpgeneric | xdpdrv | xdpoffload } { off | object FILE [ { section | program } NAME ] [ verbose ] | pinned FILE } ] [ master DEVICE ][ vrf NAME ] [ nomaster ] [ addrgenmode { eui64 | none | stable_secret | random } ] [ protodown { on | off } ] [ protodown_reason PREASON { on | off } ] [ gso_max_size BYTES ] | [ gso_max_segs PACKETS ] [ gro_max_size BYTES ]
ip link show [ DEVICE | group GROUP ] [up] [master DEV] [vrf NAME] [type TYPE] [nomaster]
ip link xstats type TYPE [ ARGS ]
ip link afstats [ dev DEVICE ] ip link property add dev DEVICE [ altname NAME .. ] ip link property del dev DEVICE [ altname NAME .. ] Not enough of information: "dev" argument is required. Error: argument of "%s" must be "on" or "off", not "%s" Invalid address length %d - must be %d bytes Invalid min_tx_rate %d - must be <= max_tx_rate %d Invalid address generation mode index can be used only when creating devices or when moving device to another netns. Garbage instead of arguments "%s ...". Try "ip link help". group cannot be used when creating devices. both "name" and "dev" cannot be used when creating devices. Not enough information: "type" argument is required Command "%s" is unknown, try "ip link help". /proc/net/igmp%08x%dCannot create socketioctl/proc/net/igmp6%d%s%s%d/proc/net/dev_mcast%d%s%d%d%s %slink %-5s users %uUsage: ip maddr [ add | del ] MULTIADDR dev STRING ip maddr show [ dev STRING ] Error: Invalid address length %d - must be %d bytes Not enough information: "dev" is required. Command "%s" is unknown, try "ip maddr help". [nsid current][nsid %d][MROUTE][ROUTE][NEXTHOP][NEXTHOPBUCKET][LINK][ADDR][ADDRLABEL][NEIGH][PREFIX][RULE][NETCONF][NSID][STATS]all-nsidCannot fopenUnknown message: type=0x%08x(%d) flags=0x%08x(%d) len=0x%08x(%d) Usage: ip monitor [ all | OBJECTS ] [ FILE ] [ label ] [ all-nsid ] [ dev DEVICE ] OBJECTS := address | link | mroute | neigh | netconf | nexthop | nsid | prefix | route | rule | stats FILE := file FILENAME Argument "%s" is unknown, try "ip monitor help". Failed to add nexthop group to list Failed to add stats group to list t��������t��t��t��t��t��t��t��t��t��t��t��$��<��<��t��t��l��l��t��t��������t��t�����������t��,��,��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��T��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��|��|��t��t��t��t��t��t��������t��t��t��t��t��t��������t��t�����t��t��t��t��t��t��t��t��t��t��t������t��t��t��t��t��t��t��t��t��t��L��L��(%s,%s)%-32s Iif: %-10s multipath(ttl %u) State: %s offload %lu packets, %lu bytes, %lu arrived on wrong iif.wrong_if, Age %.2f Table: %sNot a multicast route: %08x %08x %08x Non multicast route received, kernel does support IP multicast? Usage: ip mroute show [ [ to ] PREFIX ] [ from PREFIX ] [ iif DEVICE ] [ table TABLE_ID ] TABLE_ID := [ local | main | default | all | NUMBER ] Command "%s" is unknown, try "ip mroute help". ��.ANot a prefix: %08x %08x %08x wrong ND type %d prefix %s/%uonlink autoconf valid %u preferred %u incorrect protocol family: %d tun_flagsownerone_queuemulti_queuevnet_hdrpersist user %lduser group %ld%s Attached to processes:/proc/[0-9]*/fd/[0-9]*processes/proc/%d/fd/%dreadlink/dev/net/tun/proc/%d/fdinfo/%d%m[^:]: %ms fscanfiff<NULL>(%d)fcloseinvalid user "%s" invalid group "%s" UNKNOWN:%hhupi %s vnet_hdr %s multi_queue numqueues %u numqueuesnumdisabled %u numdisabledpersist %s user %s user %u group %u ioctl(TUNSETIFF)ioctl(TUNSETOWNER)ioctl(TUNSETGROUP)ioctl(TUNSETPERSIST)Usage: ip tuntap { add | del | show | list | lst | help } [ dev PHYS_DEV ] [ mode { tun | tap } ] [ user USER ] [ group GROUP ] [ one_queue ] [ pi ] [ vnet_hdr ] [ multi_queue ] [ name NAME ]
Where: USER := { STRING | NUMBER } GROUP := { STRING | NUMBER } You failed to specify a tunnel mode Command "%s" is unknown, try "ip tuntap help". tunUsage: ip token [ list | set | del | get ] [ TOKEN ] [ dev DEV ] Not enough information: token is required. Seems there's no support for IPv6 token! Command "%s" is unknown, try "ip token help". token output-mark 0x%x/0x%x security context (ERROR truncated)%.*s %slifetime config:%s limit: soft %s(bytes), hard %s(bytes)%s limit: soft %s(packets), hard %s(packets)%slifetime current:%s add %s use %s%sahsrc %s dst %sspi 0x%08x(%u)reqid %u(0x%08x)mode roin_triggerbeetencauth<<Keys hidden>> (%d bits)%.8xsrc %s/%u dst %s/%u sport %u dport %u type %u code %u (dport) 0x%.4x uid %uMARK value is invalid MASK value is invalid packetcrypto mark %#x/%#x espinudp-nonike espinudp espintcp addr %s(ERROR "tmpl" truncated)tmpl level required level use level %u share %s %s-mask %s %s-mask %scoa lastused anti-replay context: anti-replay esn context:%08x crypto offload parameters: mode %sif_id %#xtfcpad %ureplay-window %u noecn%sdecap-dscp%snopmtudisc%swildrecv%sicmp%saf-unspec%salign4%sesn%sextra_flag dont-encap-dscp%soseq-may-wrap%s (0x%s)stats:%ssocket dir action allow action block action %u priority %u ptype localok%sXFRM-PROTO value is invalidSPI value is invalidXFRM-PROTOMODE value is invalidespinudp-nonikeespinudpespintcpENCAP-TYPE value is invalidREQID value is invalidDEV value is invalidvalue after "type" is invalidvalue after "code" is invalidvalue after "key" is invalid UPSPECSELECTORtime-softtime-hardtime-use-softtime-use-hardbyte-softbyte-hardpacket-softpacket-hardLIMIT value is invalidcompaeadauth-truncroute2haoipsec-anyUsage: ip xfrm XFRM-OBJECT { COMMAND | help } where XFRM-OBJECT := state | policy | monitor expire add: soft %llu(sec), hard %llu(sec)%s expire use: soft %llu(sec), hard %llu(sec)%s %llu(bytes), %llu(packets)%sseq 0x%x, oseq 0x%x, bitmap 0x%08x replay_window %u, bitmap-length %u seq-hi 0x%x, seq 0x%x, oseq-hi 0x%0x, oseq 0x%0x replay-window %u replay %u failed %u%svalue after "src" has an unrecognized address familyvalue after "dst" has an unrecognized address familythe same address family is required between values after "src" and "dst""spi" is invalid with XFRM-PROTO value "%s" SPI value is too large with XFRM-PROTO value "%s" value after "sport" is invalidvalue after "dport" is invalid"sport" and "dport" are invalid with PROTO value "%s" "type" and "code" are invalid with PROTO value "%s" "key" is invalid with PROTO value "%s" value after "time-soft" is invalidvalue after "time-hard" is invalidvalue after "time-use-soft" is invalidvalue after "time-use-hard" is invalidvalue after "byte-soft" is invalidvalue after "byte-hard" is invalidvalue after "packet-soft" is invalidvalue after "packet-hard" is invalidp������P�SEQ value is invalidFLAG value is invalidnoecndecap-dscpwildrecvicmpaf-unspecalign4esnnokeysreqidDelete-all round = %d Delete-all terminated Delete-all completed Delete-all nlmsg count = %d Not a state: %08x %08x %08x Updated Expired hard %uvalue after "min" is invalidvalue after "max" is invalid"spi" is invalid "max" is missing "min" is missing State buffer overflow %s: XFRMA_MARK failed replay-windowreplay-seqreplay-seq-hireplay-oseqreplay-oseq-hiextra-flag"EXTRA-FLAG" is invaliddont-encap-dscposeq-may-wrapselcoactxInvalid device nameMissing dev keywordDIR value is invalidMissing DIR keywordoutput-markif_idtfcpadALGO-TYPEALGO-TYPE value is invalid ALGO-NAMEALGO-KEYMATALGO-ICV-LENALGO-ICV-LEN value is invalidALGO-TRUNC-LENALGO-KEYMAT value is invalidupdateallocspideletealldelallSADinfo: Wrong len %d SAD count %uBAD SAD info returned BAD SAD length returned (buckets Max %d%s | %s | %s | %s | %s %s | %sFailed to send delete-all request Buggy XFRM_MSG_DELSA: no XFRMA_SA Buggy XFRM_MSG_DELPOLICY: too short XFRMA_POLICY len Not enough information: ID is required value after "min" is larger than value after "max" value after "replay-window" is invalidvalue after "replay-seq" is invalidvalue after "replay-seq-hi" is invalidvalue after "replay-oseq" is invalidvalue after "replay-oseq-hi" is invalidSPORT value after "encap" is invalidDPORT value after "encap" is invalidvalue after "coa" has an unrecognized address familyvalue after "coa" is too largevalue after "output-mark" is invalidvalue after "if_id" is invalidvalue after "tfcpad" is invalidALGO-TRUNC-LEN value is invalidALGO-KEYMAT value makes buffer overflow Error: esn flag set without replay-window. Error: replay-window (%u) > XFRMA_REPLAY_ESN_MAX (%u). MODE value is invalid with XFRM-PROTO value "%s" ALGO-TYPE value "%s" is invalid with XFRM-PROTO value "%s" ALGO-TYPE value "%s" or "%s" is required with XFRM-PROTO value "%s" ALGO-TYPE values "%s", "%s", and "%s" are invalid with XFRM-PROTO value "%s" ALGO-TYPE values "%s", "%s", "%s", and "%s" are invalid with XFRM-PROTO value "%s" ALGO-TYPE value "%s" is required with XFRM-PROTO value "%s" ALGO is invalid with XFRM-PROTO value "%s" "mode" is required with XFRM-PROTO value "%s" "coa" is required with XFRM-PROTO value "%s" "coa" is invalid with XFRM-PROTO value "%s" Flush state with XFRM-PROTO value "%s" Usage: ip xfrm state { add | update } ID [ ALGO-LIST ] [ mode MODE ] [ mark MARK [ mask MASK ] ] [ reqid REQID ] [ seq SEQ ] [ replay-window SIZE ] [ replay-seq SEQ ] [ replay-oseq SEQ ] [ replay-seq-hi SEQ ] [ replay-oseq-hi SEQ ] [ flag FLAG-LIST ] [ sel SELECTOR ] [ LIMIT-LIST ] [ encap ENCAP ] [ coa ADDR[/PLEN] ] [ ctx CTX ] [ extra-flag EXTRA-FLAG-LIST ] [ offload [ crypto | packet ] dev DEV dir DIR ] [ output-mark OUTPUT-MARK [ mask MASK ] ] [ if_id IF_ID ] [ tfcpad LENGTH ] Usage: ip xfrm state allocspi ID [ mode MODE ] [ mark MARK [ mask MASK ] ] [ reqid REQID ] [ seq SEQ ] [ min SPI max SPI ] Usage: ip xfrm state { delete | get } ID [ mark MARK [ mask MASK ] ] Usage: ip xfrm state deleteall [ ID ] [ mode MODE ] [ reqid REQID ] [ flag FLAG-LIST ] Usage: ip xfrm state list [ nokeys ] [ ID ] [ mode MODE ] [ reqid REQID ] [ flag FLAG-LIST ] Usage: ip xfrm state flush [ proto XFRM-PROTO ] Usage: ip xfrm state count ID := [ src ADDR ] [ dst ADDR ] [ proto XFRM-PROTO ] [ spi SPI ] XFRM-PROTO := ALGO-LIST := [ ALGO-LIST ] ALGO ALGO := { } ALGO-NAME ALGO-KEYMAT | %s ALGO-NAME ALGO-KEYMAT ALGO-TRUNC-LEN | %s ALGO-NAME ALGO-KEYMAT ALGO-ICV-LEN | %s ALGO-NAME MODE := transport | tunnel | beet | ro | in_trigger FLAG-LIST := [ FLAG-LIST ] FLAG FLAG := noecn | decap-dscp | nopmtudisc | wildrecv | icmp | af-unspec | align4 | esn EXTRA-FLAG-LIST := [ EXTRA-FLAG-LIST ] EXTRA-FLAG EXTRA-FLAG := dont-encap-dscp | oseq-may-wrap SELECTOR := [ src ADDR[/PLEN] ] [ dst ADDR[/PLEN] ] [ dev DEV ] [ UPSPEC ] UPSPEC := proto { { tcp | udp | sctp | dccp } [ sport PORT ] [ dport PORT ] | { icmp | ipv6-icmp | mobility-header } [ type NUMBER ] [ code NUMBER ] | gre [ key { DOTTED-QUAD | NUMBER } ] | PROTO } LIMIT-LIST := [ LIMIT-LIST ] limit LIMIT LIMIT := { time-soft | time-hard | time-use-soft | time-use-hard } SECONDS | { byte-soft | byte-hard } SIZE | { packet-soft | packet-hard } COUNT ENCAP := { espinudp | espinudp-nonike | espintcp } SPORT DPORT OADDR DIR := in | out Command "%s" is unknown, try "ip xfrm state help". ]B��GB��5B��sB��sB��sB��sB��sB��sB��sB��sB��sB��sB��sB��sB��sB��sB��\>��sB��]B��xfrm_state_keepmainsubPTYPE value is invalidptypeFlush policy localokhthresh4hthresh6INDEX value is invalidallowACTION value is invalid PRIORITY value is invalidnosockNot a policy: %08x %08x %08x acceptIF_ID value is invalidtmplrequiredLEVEL value is invalid TMPLInvalid offload modeDefault policies: in: %s fwd: %s out: %s SPDinfo: Wrong len %d SPD IN %d OUT %d FWD %d (Sock: IN %d SPD buckets: count %d SPD IPv4 thresholds: local %d remote %d SPD IPv6 thresholds:setdefaultin policy value is invalidfwd policy value is invalidout policy value is invalidunknown directiongetdefaulththresh4 LBITS value is invalidhthresh4 RBITS value is invalidhthresh6 LBITS value is invalidhthresh6 RBITS value is invalidFailed to send delete-all requesttoo short XFRMA_POLICY_TYPE len Buggy XFRM_MSG_DELPOLICY: no XFRMA_POLICY Not enough information: DIR is required. Not enough information: either SELECTOR or INDEX is required. Too many tmpls: buffer overflow BUG: short nlmsg len %u (expect %lu) for XFRM_MSG_GETDEFAULT Usage: ip xfrm policy { add | update } SELECTOR dir DIR [ ctx CTX ] [ mark MARK [ mask MASK ] ] [ index INDEX ] [ ptype PTYPE ] [ action ACTION ] [ priority PRIORITY ] [ flag FLAG-LIST ] [ if_id IF_ID ] [ LIMIT-LIST ] [ TMPL-LIST ] [ offload packet dev DEV] } ] Usage: ip xfrm policy { delete | get } { SELECTOR | index INDEX } dir DIR [ ctx CTX ] [ mark MARK [ mask MASK ] ] [ ptype PTYPE ] [ if_id IF_ID ] Usage: ip xfrm policy { deleteall | list } [ nosock ] [ SELECTOR ] [ dir DIR ] [ index INDEX ] [ ptype PTYPE ] [ action ACTION ] [ priority PRIORITY ] [ flag FLAG-LIST ] Usage: ip xfrm policy flush [ ptype PTYPE ] Usage: ip xfrm policy count Usage: ip xfrm policy set [ hthresh4 LBITS RBITS ] [ hthresh6 LBITS RBITS ] Usage: ip xfrm policy setdefault DIR ACTION [ DIR ACTION ] [ DIR ACTION ] Usage: ip xfrm policy getdefault SELECTOR := [ src ADDR[/PLEN] ] [ dst ADDR[/PLEN] ] [ dev DEV ] [ UPSPEC ] UPSPEC := proto { { tcp | udp | sctp | dccp } [ sport PORT ] [ dport PORT ] | { icmp | ipv6-icmp | mobility-header } [ type NUMBER ] [ code NUMBER ] | gre [ key { DOTTED-QUAD | NUMBER } ] | PROTO } DIR := in | out | fwd PTYPE := main | sub ACTION := allow | block FLAG-LIST := [ FLAG-LIST ] FLAG FLAG := localok | icmp LIMIT-LIST := [ LIMIT-LIST ] limit LIMIT LIMIT := { time-soft | time-hard | time-use-soft | time-use-hard } SECONDS | { byte-soft | byte-hard } SIZE | { packet-soft | packet-hard } COUNT TMPL-LIST := [ TMPL-LIST ] tmpl TMPL TMPL := ID [ mode MODE ] [ reqid REQID ] [ level LEVEL ] ID := [ src ADDR ] [ dst ADDR ] [ proto XFRM-PROTO ] [ spi SPI ] XFRM-PROTO := MODE := transport | tunnel | beet | ro | in_trigger LEVEL := required | use Command "%s" is unknown, try "ip xfrm policy help". xfrm_policy_keepxfrm_policy_get_or_deletexfrm_policy_modifyacquire sel policy seq 0x%08u Flushed policy report reqid 0x%x protocol %s SPI 0x%xFlushed state Async event (0x%x) replay update timer expired policy updated Mapping change :%d -> :%d acquireexpireaeventreportUnknown message: %08d 0x%08x 0x%08x Usage: ip xfrm monitor [ nokeys ] [ all-nsid ] [ all | OBJECTS | help ] OBJECTS := { acquire | expire | SA | aevent | policy | report } Argument "%s" is unknown, try "ip xfrm monitor help". �t���t��0w���t���t��0w��0w��u���t���t���t���t��u���u��xv��0w���u��0w��0w��0w��0w��0w���u��0w���t��Usage: ... dummy dummyUsage: ... ifb ifbUsage: ... nlmon nlmonUsage: ... team Usage: ... team_slave team_slaveteamUsage: ... vcan vcanUsage: ip link <options> type vxcan [peer <options>] To get <options> type 'ip link add help'vxcan %s { %u:%u protocol is invalidreorder_hdrgvrpmvrploose_bindingbridge_bindinginvalid ingress-qos-mapinvalid egress-qos-mapvlan: unknown command "%s"? 802.1qREORDER_HDRGVRPMVRPLOOSE_BINDINGBRIDGE_BINDINGingress_qosegress_qosUsage: ... vlan id VLANID [ protocol VLANPROTO ] [ reorder_hdr { on | off } ] [ gvrp { on | off } ] [ mvrp { on | off } ] [ loose_binding { on | off } ] [ bridge_binding { on | off } ] [ ingress-qos-map QOS-MAP ] [ egress-qos-map QOS-MAP ]
VLANID := 0-4095 VLANPROTO: [ 802.1Q | 802.1ad ] QOS-MAP := [ QOS-MAP ] QOS-MAPPING QOS-MAPPING := FROM:TO Usage: ip link <options> type veth [peer <options>] To get <options> type 'ip link add help'vethexternal ttl %u ttl %s tos %#llx nopmtudisc ignore-df ignore_dfikey %s okey %s iseq oseq icsum ocsum fwmark %#llx erspan_index %u erspan_indexerspan_ver %u erspan_veringresserspan_dir %s erspan_diregresserspan_hwid %#llx erspan_hwidnokeynoikeynookeynoseqnoiseqnooseqnocsumnoicsumnoocsumnoencapInvalid encap type.encap-sportInvalid source port.encap-dportInvalid destination port.noencap-csumnoencap-udp6-csumnoencap-remcsumnoignore-dfinvalid fwmark invalid erspan index invalid erspan version erspan version must be 0/1/2 Invalid erspan direction.invalid erspan hwid Usage: ... %-9s [ remote ADDR ] [ local ADDR ] [ [no][i|o]seq ] [ [i|o]key KEY | no[i|o]key ] [ [no][i|o]csum ] [ ttl TTL ] [ tos TOS ] [ [no]pmtudisc ] [ [no]ignore-df ] [ dev PHYS_DEV ] [ fwmark MARK ] [ external ] [ noencap ] [ encap { fou | gue | none } ] [ encap-sport PORT ] [ encap-dport PORT ] [ [no]encap-csum ] [ [no]encap-csum6 ] [ [no]encap-remcsum ] [ erspan_ver version ] [ erspan IDX ] [ erspan_dir { ingress | egress } ] [ erspan_hwid hwid ]
Where: ADDR := { IP_ADDRESS | any } TOS := { NUMBER | inherit } TTL := { 1..255 | inherit } KEY := { DOTTED_QUAD | NUMBER } MARK := { 0x0..0xffffffff } Failed to get existing tunnel info. erspan index must be > 0 and <= 20-bit A broadcast tunnel requires a source address. LISTEN-ONLYTRIPLE-SAMPLINGONE-SHOTBERR-REPORTINGFDFD-NON-ISOPRESUME-ACKCC-LEN8-DLCTDC-AUTOTDC-MANUAL..%d %-10urestartsbus_errorarbitration_losterror_warningerror_passivebus_off [%8u, %8udata_bitrate_const%hu, ctrlmodectrlmode_supportedctrlmode_staticstate %s berr_counter(berr-counter tx %u rx %u) restart-ms %u restart_ms bitrate %u%.3f sample-point %ssample_point tq %u prop-seg %uprop_seg phase-seg1 %uphase_seg1 phase-seg2 %uphase_seg2 sjw %u brp %u %s: tseg1 tseg2 sjw brp brp_inc %ubrp_incdata_bittiming dbitrate %u dsample-point %s dtq %u dprop-seg %u dphase-seg1 %u dphase-seg2 %u dsjw %u dbrp %utdc tdcv %u tdco %u tdcf %udata_bittiming_const dtseg1 dtseg2 dsjw dbrp dbrp_inc %u tdcv tdco tdcfdata_bittiming_bitrate termination %hu [ terminationtermination_const clock %u clockinvalid "bitrate" value invalid "sample-point" value invalid "tq" value invalid "prop-seg" value invalid "phase-seg1" value invalid "phase-seg2" value invalid "sjw" value dbitrateinvalid "dbitrate" value dsample-pointdtqinvalid "dtq" value dprop-seginvalid "dprop-seg" value dphase-seg1invalid "dphase-seg1" value dphase-seg2invalid "dphase-seg2" value invalid "dsjw" value invalid "tdcv" value invalid "tdco" value invalid "tdcf" value loopbacklisten-onlytriple-samplingone-shotberr-reportingfdfd-non-isopresume-ackcc-len8-dlctdc-modemanualrestartrestart-msinvalid "restart-ms" value invalid "termination" value can: unknown option "%s" ERROR-ACTIVEERROR-WARNINGERROR-PASSIVEBUS-OFFSTOPPEDSLEEPINGUsage: ip link set DEVICE type can [ bitrate BITRATE [ sample-point SAMPLE-POINT] ] | [ tq TQ prop-seg PROP_SEG phase-seg1 PHASE-SEG1 phase-seg2 PHASE-SEG2 [ sjw SJW ] ]
[ loopback { on | off } ] [ listen-only { on | off } ] [ triple-sampling { on | off } ] [ one-shot { on | off } ] [ berr-reporting { on | off } ] [ fd { on | off } ] [ fd-non-iso { on | off } ] [ presume-ack { on | off } ] [ cc-len8-dlc { on | off } ] [ tdc-mode { auto | manual | off } ]
[ restart-ms TIME-MS ] [ restart ]
[ termination { 0..65535 } ]
Where: BITRATE := { NUMBER in bps } SAMPLE-POINT := { 0.000..0.999 } TQ := { NUMBER in ns } PROP-SEG := { NUMBER in tq } PHASE-SEG1 := { NUMBER in tq } PHASE-SEG2 := { NUMBER in tq } SJW := { NUMBER in tq } TDCV := { NUMBER in tc } TDCO := { NUMBER in tc } TDCF := { NUMBER in tc } RESTART-MS := { 0 | NUMBER in ms } re-started bus-errors arbit-lost error-warn error-pass bus-offinvalid "dsample-point" value Error: argument of "tdc-mode" must be "auto", "manual" or "off", not "%s" zD/id:%u%s prog/xdp%s attachedxdpmultixdp[%u]Usage: ... %s mode MODE [flag MODE_FLAG] MODE_OPTS [bcqueuelen BC_QUEUE_LEN] [bclim BCLIM]
MODE: private | vepa | bridge | passthru | source MODE_FLAG: null | nopromisc | nodst MODE_OPTS: for mode "source": macaddr { { add | del } <macaddr> | set [ <macaddr> [ <macaddr> ... ] ] | flush } BC_QUEUE_LEN: Length of the rx queue for broadcast/multicast: [0-4294967295] BCLIM: Threshold for broadcast queueing: 32-bit integer %.2x:%.2x:%.2x:%.2x:%.2x:%.2x Error: argument of "mode" must be "private", "vepa", "bridge", "passthru" or "source", not "%s" Error: argument of "flag" must be "nopromisc", "nodst" or "null", not "%s" Error: argument of "bcqueuelen" must be a positive integer [0-4294967295], not "%s" Error: illegal value for "bclim": "%s" nopromisc flag only valid in passthru modevepaprivatebridgepassthrusourcenopromisc nopromiscnodst nodstusedbcqueuelen %lu usedbcqueuelenbclim %d bclimremotes (%d) macaddr_countmacaddr_data%.2x:%.2x:%.2x:%.2x:%.2x:%.2xmacaddrunknown option "%s"?macvtapmacvlan%02x%02x%02x%02xSession %u in tunnel %u Peer session %u,peer_session_idpeer_tunnel_id interface name: %s offset %u, peer offset %u peer_offset cookie %s peer cookie %speer_cookie reorder timeout: %ureorder_timeout%s sequence numbering: sendsend_seq recvrecv_seqUDPIPTunnel %u, encap %s From %s Peer tunnel %upeer_tunnel UDP source / dest ports: %hulocal_port/%hupeer_portchecksum UDP checksum: %s checksum_txchecksum_rx UDP checksum: %s%s%s%s invalid remote address invalid local address invalid ID ptidpsidudp_sportinvalid port udp_dportudp_csuminvalid option for udp_csum udp6_csum_rxudp6_csum_txIgnoring option "offset" cookie must be a hex string l2spec_typebothUnknown seq value "%s" Unknown command: %s tunnel or sessionUsage: ip l2tp add tunnel remote ADDR local ADDR tunnel_id ID peer_tunnel_id ID [ encap { ip | udp } ] [ udp_sport PORT ] [ udp_dport PORT ] [ udp_csum { on | off } ] [ udp6_csum_tx { on | off } ] [ udp6_csum_rx { on | off } ] Usage: ip l2tp add session [ name NAME ] tunnel_id ID session_id ID peer_session_id ID [ cookie HEXSTR ] [ peer_cookie HEXSTR ] [ seq { none | send | recv | both } ] [ l2spec_type L2SPEC ] ip l2tp del tunnel tunnel_id ID ip l2tp del session tunnel_id ID session_id ID ip l2tp show tunnel [ tunnel_id ID ] ip l2tp show session [ tunnel_id ID ] [ session_id ID ]
Where: NAME := STRING ADDR := { IP_ADDRESS | any } PORT := { 0..65535 } ID := { 1..4294967295 } HEXSTR := { 8 or 16 hex digits (4 / 8 bytes) } L2SPEC := { none | default } Unknown tunnel encapsulation "%s" invalid option for udp6_csum_rx invalid option for udp6_csum_tx Ignoring option "peer_offset" cookie must be either 8 or 16 hex digits Unknown layer2specific header type "%s" Command "%s" is unknown, try "ip l2tp help". Usage: ... %-4s [ remote ADDR ] [ local ADDR ] [ [i|o]key KEY ] [ dev PHYS_DEV ] [ fwmark MARK ]
Where: ADDR := { IP_ADDRESS } KEY := { DOTTED_QUAD | NUMBER } MARK := { 0x0..0xffffffff } Usage: ... %-4s [ remote ADDR ] [ local ADDR ] [ [i|o]key KEY ] [ dev PHYS_DEV ] [ fwmark MARK ]
Where: IF-ID := { 0x1..0xffffffff } xfrmi: both 'external' and if_id/link cannot be specified IF_IDif_id value is invalidif_id %#llx Usage: ... vxlan id VNI [ { group | remote } IP_ADDRESS ] [ local ADDR ] [ ttl TTL ] [ tos TOS ] [ df DF ] [ flowlabel LABEL ] [ dev PHYS_DEV ] [ dstport PORT ] [ srcport MIN MAX ] [ [no]learning ] [ [no]proxy ] [ [no]rsc ] [ [no]l2miss ] [ [no]l3miss ] [ ageing SECONDS ] [ maxaddress NUMBER ] [ [no]udpcsum ] [ [no]udp6zerocsumtx ] [ [no]udp6zerocsumrx ] [ [no]remcsumtx ] [ [no]remcsumrx ] [ [no]external ] [ gbp ] [ gpe ] [ [no]vnifilter ]
Where: VNI := 0-16777215 ADDR := { IP_ADDRESS | any } TOS := { NUMBER | inherit } TTL := { 1..255 | auto | inherit } DF := { unset | set | inherit } LABEL := 0-1048575 DF must be 'unset', 'set' or 'inherit'vxlan: vnifilter is valid only when 'external' is set vxlan: both 'external' and vni cannot be specified vxlan: missing virtual network identifier vxlan: 'group' requires 'dev' to be specified vxlan: destination port not specified Will use Linux kernel default (non-standard value) Use 'dstport 4789' to get the IANA assigned value Use 'dstport 0' to get default and quiet this message remote %s group6remote6local %s local6port_rangesrcport %u %u dstport %u nolearning proxy rsc l2miss l3miss unsetdf %s flowlabel %#llx ageing none ageingageing %u maxaddr %u noudpcsum udp_zero_csum6_txudp6zerocsumtx udp_zero_csum6_rxudp6zerocsumrx remcsumtx remcsum_txremcsumrx remcsum_rxgbp gbpgpe gpevniinvalid idvxlan: both group and remote cannot be specified invalid group addressinvalid remote addressinvalid local addressTTL must be <= 255invalid flowlabelageing timermaxaddressunlimitedmax addressessrcportmin portmax portdstportdst portnolearningnoproxynorscnol2missnol3missnoudpcsumnoudp6zerocsumtxnoudp6zerocsumrxnoremcsumtxnoremcsumrxnoexternalnovnifiltervxlan: unknown command "%s"? vxlanFailed to send flush request age %.03fsec%u/%d tw_ts %s agotw_ts_stamp rtt %luus rttvar %luus fo_mss %ufopen_miss fo_syn_drops %ufopen_syn_drops/%.03fusec agofopen_syn_drop_ts fo_cookie %sfo_cookie source %sNothing to flush. Failed to send dump requestremove����������������������Usage: ip tcp_metrics/tcpmetrics { COMMAND | help } ip tcp_metrics { show | flush } SELECTOR ip tcp_metrics delete [ address ] ADDRESS SELECTOR := [ [ address ] PREFIX ] Error: a specific IP address is expected rather than "%s" Command "%s" is unknown, try "ip tcp_metrics help". Usage: ... ipoib [ pkey PKEY ] [ mode {datagram | connected} ] [ umcast {0|1} ]
PKEY := 0x8001-0xffff Error: argument of "mode" must be "datagram"or "connected" pkeypkey is invaliddatagramumcastumcast is invalidipoib: unknown option "%s"? %#.4xpkey %#.4x %.4xumcast %.4x ipoibrp_filter %s rp_filterrp_filter %u mc_forwarding %s mc_forwardingproxy_neigh %s proxy_neighignore_routes_with_linkdowninput %s inputCan not send requestRTNETLINK answersstrictlooseNot a netconf message: %08x %08x %08x ignore_routes_with_linkdown %s Usage: ip netconf show [ dev STRING ] Command "%s" is unknown, try "ip netconf help". Usage: ... %-6s [ remote ADDR ] [ local ADDR ] [ encaplimit ELIM ] [ hoplimit HLIM ] [ tclass TCLASS ] [ flowlabel FLOWLABEL ] [ dscp inherit ] [ [no]allow-localremote ] [ dev PHYS_DEV ] [ fwmark MARK ] [ external ] [ noencap ] [ encap { fou | gue | none } ] [ encap-sport PORT ] [ encap-dport PORT ] [ [no]encap-csum ] [ [no]encap-csum6 ] [ [no]encap-remcsum ] [ mode { ip6ip6 | ipip6 | any } ]
Where: VLAN_PROTOCOL := { 802.1Q | 802.1ad } invalid mcast_query_use_ifaddrinvalid mcast_last_member_countinvalid mcast_startup_query_countinvalid mcast_last_member_intervalinvalid mcast_membership_intervalinvalid mcast_querier_intervalinvalid mcast_query_response_intervalinvalid mcast_startup_query_intervalbridge: unknown command "%s"? mcast_last_member_interval %llu mcast_membership_interval %llu mcast_query_response_interval %llu mcast_startup_query_interval %llu state is invalidpriority is invalidcost is invalidhairpinguardroot_blockfastleavemcast_floodbcast_floodmcast_to_unicastproxy_arpproxy_arp_wifimcast_fast_leaveneigh_suppressvlan_tunnelisolatedlockedmabnobackup_portstate (%d) priority %d cost %d hairpin %s guard %s root_block %s fastleave %s learning %s port_id %#llx port_no %#llx designated_port %u designated_portdesignated_cost %u designated_costdesignated_bridge %s hold_timermessage_age_timerforward_delay_timertopology_change_ack %u topology_change_ackconfig_pending %u config_pendingproxy_arp %s proxy_arp_wifi %s multicast_routermcast_fast_leave %s mcast_flood %s bcast_flood %s mcast_to_unicast %s neigh_suppress %s 0x%x,group_fwd_mask_str %s group_fwd_mask_strvlan_tunnel %s isolated %s locked %s mab %s backup_port %s bridge_slavelldplisteningblockingUsage: ... bridge_slave [ fdb_flush ] [ state STATE ] [ priority PRIO ] [ cost COST ] [ guard {on | off} ] [ hairpin {on | off} ] [ fastleave {on | off} ] [ root_block {on | off} ] [ learning {on | off} ] [ flood {on | off} ] [ proxy_arp {on | off} ] [ proxy_arp_wifi {on | off} ] [ mcast_router MULTICAST_ROUTER ] [ mcast_fast_leave {on | off} ] [ mcast_flood {on | off} ] [ bcast_flood {on | off} ] [ mcast_to_unicast {on | off} ] [ group_fwd_mask MASK ] [ neigh_suppress {on | off} ] [ vlan_tunnel {on | off} ] [ isolated {on | off} ] [ locked {on | off} ] [ mab {on | off} ] [ backup_port DEVICE ] [ nobackup_port ] bridge_slave: unknown option "%s"? conduit %s conduitdsa: unknown command "%s"? dsaUsage: ... dsa [ conduit DEVICE ] gue ipproto %u -6 local %s peer %s peer_port %uCannot send show requestfou: missing port invalid portinvalid ipprotoinvalid peer portfou: invalid device name fou: unknown device name fou: unknown command "%s"? fou: must set ipproto or gue Usage: ip fou add port PORT { ipproto PROTO | gue } [ local IFADDR ] [ peer IFADDR ] [ peer_port PORT ] [ dev IFNAME ] ip fou del port PORT [ local IFADDR ] [ peer IFADDR ] [ peer_port PORT ] [ dev IFNAME ] ip fou show
Where: PROTO { ipproto-name | 1..255 } PORT { 1..65535 } IFADDR { addr } "ip fou show" does not take any arguments. fou: cannot set ipproto and gue fou: both peer and peer port must be set fou: parsing local address failed fou: parsing peer address failed Command "%s" is unknown, try "ip fou help". Usage: ... %s [ mode MODE ] [ FLAGS ]
MODE: l3 | l3s | l2 FLAGS: bridge | private | vepa (first values are the defaults if nothing is specified). Error: argument of "mode" must be either "l2", "l3" or "l3s" l3l2l3s mode %s private vepa bridge %s: unknown option "%s"? ipvtapipvlanUsage: ... geneve id VNI remote ADDR [ ttl TTL ] [ tos TOS ] [ df DF ] [ flowlabel LABEL ] [ dstport PORT ] [ [no]external ] [ [no]udpcsum ] [ [no]udp6zerocsumtx ] [ [no]udp6zerocsumrx ] [ innerprotoinherit ]
Where: VNI := 0-16777215 ADDR := IP_ADDRESS TOS := { NUMBER | inherit } TTL := { 1..255 | auto | inherit } DF := { unset | set | inherit } LABEL := 0-1048575 geneve: unknown command "%s"? geneve: both 'external' and vni cannot be specified geneve: missing virtual network identifier geneve: remote link partner not specified innerprotoinherit inner_proto_inheritinnerprotoinheritgenevetable %u Usage: ... vrf table TABLEID vrf: unknown option "%s"? vrf_slaveBUG: RTTable "main" not found. BUG: Invalid response to link query. BUG: VRF %s is missing table id seg6rplioam6geneve_opts %s :%s,:%s vxlan_optserspan_opts<unknown>segs %d [ hmac %llX hmac"ttl" value is invalid Unknown "geneve_opts" type "tc" value is invalid inline"mode" value is invalid pspfreqInvalid frequency (too long)Invalid frequency (malformed)Out of bound "k" frequencyOut of bound "n" frequencytundstpreallocInvalid trace typeInvalid namespace IDInvalid trace sizeTrace size is too bigInvalid mode"action" value is invalid invalid table id vrftableinvalid vrf table id nh4nh6flavorslblennflensrhendpointMissing action type invalid "flavors" attribute adj-transportneutral-mapno-actionneutral-map-autoiidluidvirt-v4virt-uni-v6virt-multi-v6nonlocal-addruse-formatoutput<invalid> encap %s id %llu tos %d key locator csum-mode %s csum_mode ident-type %s ident_type hook-type %s hook_typetc %u headroomaction %s vrftable %s nh4 %s nh6 %s iif %s oif %s flavors freq %ufreqkfreqntundst %s trace prealloc type %#08x ns %u if_id %lu link_dev %s link_dev%s %s Bad locator: %s csum-mode"csum-mode" value is invalid ident-typehook-type"hook-type" value is invalid headroom is invalid "if_id" value is invalid TYPE := EndEnd.XEnd.TEnd.DX2End.DX6End.DX4End.DT6End.DT4End.B6End.B6.EncapsEnd.BMEnd.SEnd.ASEnd.AMEnd.BPFEnd.DT46uspusdnext-csidl2encapl2encap.red����������� ���0���@���P���`���p�������������<��d��T��T�������������������A��8��q��e��Y��}��}��}��}��}��}��}��}��}��}��}��}��}��}��}��}��}��}��}��}��}��}��}��}��}��}��M��|�|���$���d�D�����T�Usage: ip route ... encap xfrm if_id IF_ID [ link_dev LINK ] Error: an inet address is expected rather than "%s". "geneve_opts" value is invalid "vxlan_opts" value is invalid "erspan_opts" value is invalid Failed to parse eBPF program: %s "segs" provided before "mode" Frequency with k > n is forbiddenInline mode does not need tundstInvalid IPv6 address for tundstTrace size must be a 4-octet multiple"locator-block length" value is invalid "locator-node function length" value is invalid missing "segs" attribute for srh Usage: ip route ... encap TYPE [ OPTIONS ] [...] Error: unexpected end of line after "encap" "ident-type" value is invalid Usage: ip route ... encap bpf [ in BPF ] [ out BPF ] [ xmit BPF ] [...] BPF := obj FILE [ section NAME ] [ verbose ] "encap type" value is invalid key %s expected an { 0..3 }invalid attribute length %zu expected pnexpected pn != 0xpnexpected saltexpected ssciexpected key idexpected keyon/offGCM-AES-128GCM-AES-256GCM-AES-XPN-128GCM-AES-XPN-256(unknown)replay_protectinc_scireplayend_stationsend_scisci %016llx cipher %s cipher_suiteicv_lenicvlen %hhu encoding_saencodingsa %hhu validationoffload %s encryptscbwindow %d expected addressexpected portexpected sciexpected port != 0expected lladdrexpected sci ciphergcm-aes-128gcm-aes-256gcm-aes-xpn-128gcm-aes-xpn-256icvlenexpected ICV lengthexpected replay window sizeencodingsacannot create SA without key cannot change key on SA %sstats: %s %*llu%*cincomplete dump message %u: cipher suite: %s, using ICV length %u icv_lengthTXSC: %016llx on SA %d sa_list PN %llu,SSCI %08x PN %u, state %s,rx_scRXSC: %016llx, state %s offload: %s InOctetsValidatedInOctetsDecryptedInPktsUncheckedInPktsDelayedInPktsOKInPktsInvalidInPktsLateInPktsNotValidInPktsNotUsingSAInPktsUnusedSAOutPktsProtectedOutPktsEncryptedOutPktsUntaggedInPktsUntaggedOutPktsTooLongInPktsNoTagInPktsBadTagInPktsUnknownSCIInPktsNoSCIInPktsOverrunOutOctetsProtectedOutOctetsEncryptedphycheckUsage: ip macsec add DEV tx sa { 0..3 } [ OPTS ] key ID KEY ip macsec set DEV tx sa { 0..3 } [ OPTS ] ip macsec del DEV tx sa { 0..3 } ip macsec add DEV rx SCI [ on | off ] ip macsec set DEV rx SCI [ on | off ] ip macsec del DEV rx SCI ip macsec add DEV rx SCI sa { 0..3 } [ OPTS ] key ID KEY ip macsec set DEV rx SCI sa { 0..3 } [ OPTS ] ip macsec del DEV rx SCI sa { 0..3 } ip macsec show ip macsec show DEV ip macsec offload DEV [ off | phy | mac ] where OPTS := [ pn <u32> | xpn <u64> ] [ salt SALT ] [ ssci <u32> ] [ on | off ] ID := 128-bit hex string KEY := 128-bit or 256-bit hex string SCI := { sci <u64> | port { 1..2^16-1 } address <lladdr> } SALT := 96-bit hex string macsec: unknown command "%s"? expected sci, port, or addressUsage: ... macsec [ [ address <lladdr> ] port { 1..2^16-1 } | sci <u64> ] [ cipher { default | gcm-aes-128 | gcm-aes-256 | gcm-aes-xpn-128 | gcm-aes-xpn-256 } ] [ icvlen { 8..16 } ] [ encrypt { on | off } ] [ send_sci { on | off } ] [ end_station { on | off } ] [ scb { on | off } ] [ protect { on | off } ] [ replay { on | off} window { 0..2^32-1 } ] [ validate { strict | check | disabled } ] [ encodingsa { 0..3 } ] [ offload { mac | phy | off } ] expected: default, gcm-aes-128, gcm-aes-256, gcm-aes-xpn-128 or gcm-aes-xpn-256ICV length must be in the range {8..16}invalid combination of send_sci/end_station/scb replay window set, but replay protection not enabled. did you mean 'replay on window %u'? replay protection enabled, but no window set. did you mean 'replay on window VALUE'? must specify a packet number != 0 Command "%s" is unknown, try "ip macsec help". ������������ ���� Usage: ip ila add loc_match LOCATOR_MATCH loc LOCATOR [ dev DEV ] OPTIONS ip ila del loc_match LOCATOR_MATCH [ loc LOCATOR ] [ dev DEV ] ip ila list OPTIONS := [ csum-mode { adj-transport | neutral-map | neutral-map-auto | no-action } ] [ ident-type { luid | use-format } ] "ip ila show" does not take any arguments. Command "%s" is unknown, try "ip ila help". loc_matchBad locator to match: %s Bad csum-mode: %s Bad ident-type: %s No such interface: %s ila: missing locator ila: missing locator0match %x%s%-20slocator_match%-16s�����������������������������������������������������������������������������������������������p��Usage: ip vrf show [NAME] ... ip vrf exec [NAME] cmd ... ip vrf identify [PID] ip vrf pids [NAME] BUG: device with ifindex %d has nil ifname Failed to get name of network namespace: %s Failed to get base cgroup path: %s Invalid path to cgroup2 mount Failed to setup vrf cgroup2 directory Failed to open cgroup path: '%s' Failed to load BPF prog: '%s' %sKernel compiled with CGROUP_BPF enabled? Failed to attach prog to cgroup: '%s' Failed to open cgroups.procs file: %s. Failed to lookup vrf association: %s setexecfilecon for "%s" failed Command "%s" is unknown, try "ip vrf help". %5u%s %u NameTable %5s -----------------------No VRF has been configured%s/vrf/%s%s/cgroup.procs%5s %s Invalid VRF name /proc/%d/cgroup:://vrf%s%s/%svrf/%sGPLFailed to join cgroup /vrf/Extra arguments specified Invalid pid Invalid arguments No VRF name specified ifconfig_txstats: missing argument invalid typeunknown argumentUsage: ... xstats type TYPE [ ARGS ] xstats: link type %s doesn't support xstats sha1sha256hmac %u algo %s algosecret "%s" tunsrc addr %s tunsrcSEG6Error parsing reply hmac KEYID value is invalidhmac ALGO value is invalidHMAC secret length %d > 63, truncated Cannot open generic netlink socket Usage: ip sr { COMMAND | help } ip sr hmac show ip sr hmac set KEYID ALGO ip sr tunsrc show ip sr tunsrc set ADDRESS where ALGO := { sha1 | sha256 } Enter secret for HMAC key ID (blank to delete): Usage: ... netdevsim netdevsimmux_id %u mux_idmux_id is invalidrmnet: unknown command "%s"? rmnetUsage: ... rmnet mux_id MUXID
MUXID := 1-254 Usage: ip nexthop { list | flush } [ protocol ID ] SELECTOR ip nexthop { add | replace } id ID NH [ protocol ID ] ip nexthop { get | del } id ID ip nexthop bucket list BUCKET_SELECTOR ip nexthop bucket get id ID index INDEX SELECTOR := [ id ID ] [ dev DEV ] [ vrf NAME ] [ master DEV ] [ groups ] [ fdb ] BUCKET_SELECTOR := SELECTOR | [ nhid ID ] NH := { blackhole | [ via ADDRESS ] [ dev DEV ] [ onlink ] [ encap ENCAPTYPE ENCAPHDR ] | group GROUP [ fdb ] [ type TYPE [ TYPE_ARGS ] ] } GROUP := [ <id[,weight]>/<id[,weight]>/... ] TYPE := { mpath | resilient } TYPE_ARGS := [ RESILIENT_ARGS ] RESILIENT_ARGS := [ buckets BUCKETS ] [ idle_timer IDLE ] [ unbalanced_timer UNBALANCED ] ENCAPTYPE := [ mpls ] ENCAPHDR := [ MPLSLABEL ] <nexthop id %u invalid gateway length %lu> <nexthop id %u invalid nexthop group>Not a nexthop bucket: %08x %08x %08x invalid unbalanced timer valueNot a nexthop: %08x %08x %08x Dump terminated. Failed to flush nexthops Command "%s" is unknown, try "ip nexthop help". invalid id valueVRF does not exist <unknown type>resilientgroup ,%uresilient_argsbuckets %u bucketsidle_timer %g idle_timerunbalanced_timer %g unbalanced_timerunbalanced_time %g unbalanced_timeblackhole fdbbucketidle_time %g idle_timeaddress family mismatch "group" value is invalid mpath"type" value is invalid invalid buckets valueinvalid idle timer valueError parsing nexthop: %s groupsinvalid protocol valueNothing to flushFlushed %d nexthops invalid bucket index valuesignalinvalid interface name device does not exist ADDRESSport can't be used with idrawflags %s rawflags %s=%s[UNKNOWN %u] [%16s] token=%08x remid=%u locid=%usaddr4daddr4saddr6daddr6 sport=%u dport=%u backup=%d error=%d flags=%x timeout=%u ifindex=%d reset_reason=%u reset_flags=0x%xsubflowsinvalid subflows add_addr_acceptedinvalid add_addr_accepted unknown limitadd_addr_accepted %d subflows %d mptcp_pmlimitsmptcp_pm_eventsANNOUNCEDREMOVEDSF_ESTABLISHEDSF_CLOSEDSF_PRIOLISTENER_CREATEDLISTENER_CLOSEDsubflownobackupnofullmeshflags mustn't have both signal and fullmeshinvalid flags, backup and fullmesh onlyinvalid for non-zero id address address is needed for deleting id 0 address flags must have signal when using portUsage: ip mptcp endpoint add ADDRESS [ dev NAME ] [ id ID ] [ port NR ] [ FLAG-LIST ] ip mptcp endpoint delete id ID [ ADDRESS ] ip mptcp endpoint change [ id ID ] [ ADDRESS ] [ port NR ] CHANGE-OPT ip mptcp endpoint show [ id ID ] ip mptcp endpoint flush ip mptcp limits set [ subflows NR ] [ add_addr_accepted NR ] ip mptcp limits show ip mptcp monitor FLAG-LIST := [ FLAG-LIST ] FLAG FLAG := [ signal | subflow | backup | fullmesh ] CHANGE-OPT := [ backup | nobackup | fullmesh | nofullmesh ] can't subscribe to mptcp eventsCommand "%s" is unknown, try "ip mptcp help". ethertype %s ethertypesrcportmin %u srcportminnomultiproto nomultiprotobareudpUsage: ... bareudp dstport PORT ethertype PROTO [ srcportmin PORT ] [ [no]multiproto ]
Where: PORT := UDP_PORT PROTO := ETHERTYPE
Note: ETHERTYPE can be given as number or as protocol name ("ipv4", "ipv6", "mpls_uc", etc.). bareudp: unknown command "%s"? linkid %u linkidwwan: unknown command "%s"? wwanUsage: ... wwan linkid LINKID
Where: LINKID := 0-4294967295 IOAM6schema %uschema [namespace %u], data: %02xnamespace %u [schema %u], data %#010x, wide %#018lxwideInvalid dataInvalid wide dataInvalid argumentUnexpected argumentUnknownInvalid schema IDSchema DATA too biglg��h��lh���h���g���g���h��4g��Usage: ip ioam { COMMAND | help } ip ioam namespace show ip ioam namespace add ID [ data DATA32 ] [ wide DATA64 ] ip ioam namespace del ID ip ioam schema show ip ioam schema add ID DATA ip ioam schema del ID ip ioam namespace set ID schema { ID | none } gateway_port %u gateway_portrelay_port %u relay_portdiscovery %s discoverymax_tunnels %u max_tunnelsrelayamt: unknown command "%s"? amtUsage: ... amt [ discovery IP_ADDRESS ] [ mode MODE ] [ local ADDR ] [ dev PHYS_DEV ] [ relay_port PORT ] [ gateway_port PORT ] [ max_tunnels NUMBER ]
Where: ROLE := { sgsn | ggsn } HSIZE := 1-131071 RESTART_COUNT := 0-255 gtp: role of the gtp device was not specified invalid role, use sgsn or ggsnUsage: ... virt_wifi virt_wifiipstats.cifla_max != 0GROUP := { %s } %s SUBGROUP := { | [ suite %s ]mpls_statsfalseThe request for %s %ssubgroupWhat is "%s"? used %sl3_stats %s RX: %*s %*s %*s %*s %*s%s TX: %*s %*s %*s %*s%stop-levelxstats_slavehw_stats_infocpu_hitgroup < ARRAY_SIZE(ipstats_stat_ifla_max)Usage: ip stats help ip stats show [ dev DEV ] [ group GROUP [ subgroup SUBGROUP [ suite SUITE ] ... ] ... ] ... ip stats set dev DEV l3_stats { on | off } Error: %s %s requested inside leaf %s %s desc->kind == IPSTATS_STAT_DESC_KIND_GROUPError: no %s named %s found inside %s did not match any known stats. Error parsing netlink answer: %s Error: %s %s requested without selecting a %s first Invalid value for %s: expected 0 or 1, got %d. A statistics suite to toggle was already given. Not enough information: stat type to toggle is required. Command "%s" is unknown, try "ip stats help". ipstats_select_pushipstats_stat_desc_findipstats_stat_show_attrs_alloc_tb,/sys/class/net/%s/%sfopen %s: %s strtol %s: %sFailed to parse %s msecmsecsHZPROC_NET_PSCHEDPROC_ROOT%s/net/psched%*08x%*08x%08x%08x???inet6any valid\%03o%Y-%m-%dT%H:%M:%S[%s.%06ld] Timestamp: %s %ld usec link_index%s@%sMissing continuation line Out of memory \ Unterminated quoted string Timestamp: %s %lu us usecs%.3gs%.3gms%uusnsecnsecs%.3gus%lldnsCommand failed %s:%d "%s", not "%s" [%d]could not build pathname for property property "%s" in file %s is currently unknown value "%s" in file %s is not a number Error: an IP address is expected rather than "%s" Command line is not complete. Try option "help" Error: argument "%s" is required Error: argument "%s" is wrong: %s Error: duplicate "%s": "%s" is the second value. Error: either "%s" is duplicate, or "%s" is a garbage. Error: %s address is expected rather than "%s". Error: "%s" may be inet prefix, but it is not allowed in this context. Error: %s prefix is expected rather than "%s". Too many arguments to command Cannot open file "%s" for reading: %s Error: argument of "%s" must be one of ����������������������������������������������������������������ة���������������������������������������������� �e��A/proc/net/psched 0x%x %s 0x%x %s #%d %s %d %s #/etc/iproute2/rt_protos/etc/iproute2/rt_protos.d.conf/etc/iproute2/rt_protos.d/%s/etc/iproute2/rt_tables/etc/iproute2/rt_tables.d/etc/iproute2/rt_tables.d/%s/etc/iproute2/rt_scopes/etc/iproute2/rt_realms/etc/iproute2/rt_dsfield/etc/iproute2/group/etc/iproute2/nl_protosrtnlusersocktcpdiagnflogselinuxiscsiauditfiblookupconnectornftip6fwdec-rtueventgenlscsi-transecryptfsrdmaglobalsitenowherekernelbootgatedmrtzebrabirddnroutedxorpntkdhcpkeepalivedbabelbgpisisospfripeigrpDatabase %s is corrupted at %s /etc/iproute2/protodown_reasons.d/etc/iproute2/protodown_reasons.d/%sif%unetromeetherax25pronetchaosieee802arcnetatalkdlciatmmetricomieee1394infinibandcslipcslip6rsrvdadaptrosehwx25lapbddcmprawhdlctunnel6fradskipfddibifip/ddppimreghippiasheconetirdafcppfcalfcplfcfb0fcfb1fcfb2fcfb3fcfb4fcfb5fcfb6fcfb7fcfb8fcfb9fcfb10fcfb11fcfb12ieee802.11ieee802.11/prismieee802.11/radiotapieee802.15.4ieee802.15.4/monitorphonetphonet_pipecaifgre66lowpanvoidloopbpqieeepupieeepupatdecdna_dldna_rcdna_rtlatcustscararpaarpipxppp_discppp_sesatmmpoaatmfate802_3snapwan_pppppp_mplocaltalkppptalktr_802_2mobitexcontroltipcprofinetaoeethercat802.1Q802.1admpls_ucmpls_mctebLLDP:%02x"%s" is invalid lladdr. ipproto-%dunshare failed: %s /syssysfsmount of /sys failed: %s /etc/netns/etc/%ssetting the network namespace "%s" failed: %s "mount --make-rslave /" failed: %s Failed to open directory %s: %s json_writer.cself->depth > 0\t\n\r\f\b\\\"self->depth == 0true%g%lu%lxjsonw_endjsonw_destroyjson object%s %%u%s %%s%.0f%s%sbitCOLORFGBG-colornever[0m[31m[32m[33m[34m[35m[36m[37m[1;31m[1;32m[1;33m[1;34m[1;35m[1;36m[1;37m %s/%s/globalsbpf_legacy.c/etc/iproute2/bpf_pinningNo memory left for db entry! %i %s %i %s #____btf_map_%s%s%s/symlink %s failed: %s errno != EEXISTlstat %s failed: %s /proc/mounts%*s %4096s %99s %*s %*d %*d /sys/fs/bpfTC_BPF_MNTmode=0700%s/../bytecodebcbytecode-filebcfobject-fileobject-pinnedWhat mode is "%s"? What type is "%s"? sectionprogramTC_BPF_UDSexportverbose%hu%c%hu %hhu %hhu %u,Error at instruction %d! progtag %s tagjitedjited load_time %llu load_timecreated_by_uid %lu created_by_uidbtf_id %lu btf_idbytecode '%u,insns%hu jtjf%u'tracefstracefs not mounted? %s/trace_pipeRunning! Hang up with ^C!
*fsobj%s:[%s]%*i/%iNo procfs support?! map_type: %ukey_size: %uvalue_size: %umax_entries: %umap_flags: %iowner_prog_type: %iowner_jited: %iMap '%s' self-check failed! Map update failed: %s Cannot open socket: %s Cannot connect to %s: %s Cannot send fds to %s: %s Cannot bind to socket: %s Cannot recv fds from %s: %s Error opening object %s: %s Error doing fstat: %s Stat of elf file failed: %s .symtab.strtab%s/%s/%s%s/../%s/%s/sys/kernel/tracing/sys/kernel/debug/tracing/traceclsclassifierlwt_inlwt_outlwt_xmitlwt_seg6localtype < ARRAY_SIZE(__bpf_prog_meta) && __bpf_prog_meta[type].subdirDatabase %s, id %u is reserved - ignoring! Database %s is corrupted at: %s %u maps not supported in current map section! Number BPF map symbols are not multiple of struct bpf_elf_map! Different struct bpf_elf_map in use! struct bpf_elf_map not supported, coming from future version? struct bpf_elf_map too small, not supported! %zu bytes struct bpf_elf_map fixup performed due to size mismatch! mount --make-private %s failed: %s mount -t bpf bpf %s failed: %s type < ARRAY_SIZE(__bpf_prog_meta) && __bpf_prog_meta[type].sectionReal program length exceeds encoded length parameter! Parsed program length is less than encoded length parameter! Couldn't retrieve pinned program '%s': %s Couldn't infer map key from section name! Please provide 'key' argument! Couldn't retrieve pinned map '%s': %s Program array map owner types differ: %u (obj) != %u (pin) Map specification differs from pinned file! - Type: %u (obj) != %u (pin) - Size key: %u (obj) != %u (pin) - Size value: %u (obj) != %u (pin) - Max elems: %u (obj) != %u (pin) - Flags: %#x (obj) != %#x (pin) Continuing without mounted eBPF fs. Too old kernel? /proc/sys/net/core/bpf_jit_enableError from sendfile (%zd vs %zu bytes): %s Error from read (%zd vs %zu bytes): %s ELF format error, ELF file not for eBPF? ELF format error, wrong endianness info? We are little endian, eBPF object is big endian! Too many BPF maps in ELF section! Error parsing section %d! Perhaps check with readelf -a? Error fixing up map structure, incompatible struct bpf_elf_map used? Missing kernel AF_ALG support for PIN_OBJECT_NS! bpf_slave_via_bind_mntbpf_prog_to_subdirbpf_prog_to_default_section /sys/kernel/trac/proc/self/mapslibbpf.so.Couldn't find runtime libbpf version - falling back to compile-time value! forkwaitpidexec of "%s" failed: %s %*s %4095s %127s %*s %*d %*d strdup failed copying pathmkdir failed for %s: %s Failed to find cgroup2 mount /var/run/cgroup2Failed to mount cgroup2: %s Invalid cgroup2 path Failed to open cgroup2 mount Failed to get cgroup2 ID: %s Invalid size of cgroup2 ID Invalid cgroup2 ID Failed to open cgroup2 by ID /proc/self/fd/%d/proc/%s/statusName:/proc/%d/commFailed to open mounts file: %s Failed to allocate memory for cgroup2 path Failed to setup cgroup2 directory Failed to mount cgroup2. Are CGROUPS enabled in your kernel? Failed to read value of symbolic link %s %i/%icreate map %s failed map %s reuse fd failed unable to find map id %u for tail call has unrecognized, non-zero optionsERROR: opening BPF object file failed object file doesn't contain prog %s object file doesn't contain sec %s Cannot update inner_idx into outer_map map '%s': couldn't set pin path. Cannot update map key for tail call! Cannot initialize ELF context! Error fetching ELF ancillary data! Error: too many labels. Error talking to the kernel Missing family id TLV Missing mcast groups TLV Not a controller message, nlmsg_len=%d nlmsg_type=0x%x wrong controller message len %d Unknown controller command %d ErrorWarningInvalid extack attribute EOF on netlink Cannot talk to rtnetlinksender address length == %d Truncated message !!!malformed message: len=%d ERROR truncated RTNETLINK answers: %s Unexpected reply!!! Message truncated !!!Remnant of size %d DONE truncated Cannot open netlink socketSO_SNDBUFSO_RCVBUFCannot bind netlink socketCannot getsocknameWrong address length %d Wrong address family %d NETLINK_LISTEN_ALL_NSIDSender address length == %d rtnl_from_file: fread!!!Deficit %d, rta_len=%d U8U16U32U64FLAGNESTEDNESTED_ARRAYNUL_STRINGBINARYS8S16S32S64BITFIELD32 policy[%u]:attr[%u]: type=%s policy:%u maxattr:%u range:[%lld,%lld] range:[%llu,%llu] min len:%u max len:%uextack attribute %d failed validation netlink receive error %s (%d) malloc error: not enough buffer Invalid offset for NLMSGERR_ATTR_OFFS Error: Buffer too small for object. Dump was interrupted and may be inconsistent. rtnl-from_file: truncated message !!!malformed message: len=%d @%lu addattr_l ERROR: message exceeded bound of %d addraw_l ERROR: message exceeded bound of %d rta_addattr32: Error! max allowed bound %d exceeded rta_addattr_l: Error! max allowed bound %d exceeded �����@���Ќ����������������������p���`���P���@���0��� ������ ;d���4����\Ծ��� ��L��$����t4���D���������D��tT�������D�������$��$���H���d4���T�������D�� ��ld�������T��0 �T d�l ��� �0!$�T!��!�����"���,#t���X#����#����#T���#t)��$�+��h$�+��|$4,���$�.��%�0��8%�3���%�4���%�5���%�7��D&�7��X&48��t&�?���&tA���&�A��'$B��D'TE���'�E���'�F���'DG��($H��D(J��h(�J���(�K���(�W��)�y��h)D|���)�|���)D}���)�}��$*����*4����*����*d���+����L+ԧ��h+$����+4����+�����+����,,���h,����,����,��-t��4-���H-���\-��x-����-����-d��(.���\.4���.����.���/�� /d��</$���/t���/4�0��(0��T0D��0���0��1t�T1��x1t��1D�2��T2��2����3����43t���l3����34����3d����3��84���T4����4����4d ��(5���T5����5t���5����5��6T��,6�#��|6�$���6�%���6�'��7�(��H7�)���7*���7+���7d-��48�.��h8�/���8�/���8�/���8�/���8t0��9t3���944���9�6��:D7��<:�7��X:�7��t:48���:dB���:$D��,;�I��|;tM���;tT��<�T��0<�V���<tX���<DY��=4c��<=�m���=�n���=o���=q��8>r��\>�r��x>ds���>�s���>dt��?�t�� ?Tu��<?Dx���?�y���?���0@Ԣ���@��@T���XA�����AD����AD���DBt���`B�����Bd����B�(C�����Cd���Ct���C��8D4���DD���D���4E$��PET��dE����E4���E����ED��,F��XF��FD��Fd��F�G��4G��tG�G���G����H����@H����HD����H����H�I���(I4���@I����\I����IT����It����I����J�DJt���\JD���J����J$���J���\K����KD���K����K����KT��Lt��HLd���L���\Md���Md#��N�'��hNt(���N$)���Nt)��O�1��XO�4���Ot5���O�5��P8��dP�=���P�>���P4B�� QDB��4QTB��HQDH���QTJ���QTM��0R�i���Rdp���Rq��S�q��8Sds���S�t���S�w��$TD~��dT����Tt����T��UD���,U����XUd����U��U4���$V��tVĥ���V$����Vt���,W���XW����W�����W�����Wİ��X��,X���@X$���TXD���lXT����X�����Xij��Y$���@Y����lYĴ���YԺ���Y����Z����ZԾ��dZd����Z����Z��4[D��H[t��`[����[d���[����[��\�� \��p\��\���\�]d�L]�]����]����,^���@^����^���_ ��,_� ���_t���_����_���`���d`T���`$���`�#���`�$��,a%��@aD*���a,���a4,���at1�� b43��Lbd3��`b�5���b6���b$6���bTA��cU��\cdU��xc�^���c�^���ctg��HdTh���dth���d�j���d�l��$e$p��XeDp��les���e4s���et���eDt��f�y��Xfć���f����fԌ��g4���Tgd���hg$����g��h�(h���\h�����h����h���,i���hi���|id���i����iD��j4��8j���dj���j���j���j��k�$k4�Xk��|kd��k$�,lD�@l�����l4����l���mT��Xm����m����m����m���4n���Ln��`n����n���n4��ot��0o�$���od%���o&���o'��p4'�� pD(��Xp�*���p+���p�0��$qt;��tq�;���q�;���q�;���q=���qd?��r�@��Lr�A��`r�E���r�F���r$H��sTH��0sJ��|s�L���sM��tdM��,t4O��xt�U���t4\��ud]��pu_���uDb��v�c��@v4f���v�f���vdn��w�y��hw����w���x����Dx$���`xė���xd����x����y�(y��ty����y4���zT���zİ��dzt����z�����z$����zԷ��,{D���|{4���{���<|$��X|d��t|���|����|D��}���x}���}���}D��~T��4~��p~����~���4��`t�������(�4�D�������Ā�����$���|���������4����0�d�T���p����t���������d���@����t��������d��$���`����|�T��̄d���t��T����h�$������Ѕ���4"��l��"�����%���d&���t)��H��)��d��+����d,�����/����2�����3��Ȉ4��܈d7��,��7��@��7��T��8�����;��ĉ�<����T>��$��C�����E�����E����dJ����J�� �tK��|�4L����TL�����O�����O����O��(��O��<��O��P�P��d�P��x�4P����TQ��Ќ�Q���$S��h�$U����4V��؍�V����W���4W��4��W��p�Y�����[���4\��T�t^����c���Dc����c��,��e��h�df����l��4�4l��H�4m��p��p�����q���$r����r��4��t����$u�����u��Ȓv��ܒ�v���y��L��y�����y�����y����dz��ԓ�z����{��<�d|��p��|����}����t}��ܔ4~���d~��,����h�����������ؕT�������$���0�d���L�����h�����$�����d���������ؖ������$�T���@�����T��������ԗ����ԉ��,��D�����X�Ċ��l�t�����ċ����$����������T���T�t���h������$���������8�d���������������h������������D���8�t���T�D�����t�������МT����ĝ��h�t�����4�����Ԡ���������<�t���������ܞĦ�������@�ԧ��T�4�����������Ԩ����$���ȟT���������ĩ��4�ԩ��H����\�4���p�d���������d��������@���������ܡ���,�$���x�t���̢����4���X����D�������<�T������Ĥ��������@��x�D���ĥ�����D���<�$���|�t���Ȧd�������l������4����d����d�����H���������ب����������0�T��D�4��x������4�������̩������������������8�T��d�D������0������4�������ܬ�����4��(�d��D����p������d����T���d�����������4�4��P�t��|������������������̮$���D���d����������0����D����X����l�$����T�������ܯ�������,��T�D�|�t�����̰�����4�D�T�d���������$���4�ȱd�ܱt��$�T�4�h�t�������$����(�4������t�H�������T�h���ȵ��(�D���������(��\�4�p�d���T�ȷT����l����D���������4�0���h���|��������Թ4���`�d���|�T���̺��$����t�$����D���$��4����������4��$�$��l�� ���������$�����`���������t��0�����������4��ؿ&��H��&��d�4'�����'�����'����d*���,��\��2����$6�����6��<��9�����:��0�T;��d�t;��|��;�����<�����=����>��T�@�����A�����C���DF��h��G����dH�����H���dI��<��I��x��K�����Q�� ��R��d�DS��x��S����DT���$U����4V�����V���TX��P��Z����D[�����[����4\����\��l��]�����^�� ��_��\�Td����e�����i�� ��i��D�$j��\�Tj��x�Dl����Tl����m�����m����n��D�o��`��o����Dp�����p����Tq�����q���Dr��(��r��T��s��p��s����tt����4u�����u���v�� �4w��L�4x��h�y����dy�����y����Dz�����z����z�� �4{��<��{��`�t������������<�����P���h������D��������������d�������P�$���l�D�����������Ԅ����D�����������0�D���H�t���`�����|�Ć����������ć����d����Ԉ�� �����p�4�����������zRx��/D$4(���@FJw�?:*3$"\@���0t����-AAU�����EADH������B�E�E �K(�D0�x (A BBBFj(A BBB���!���'H^L$ȡ��F�E�B �B(�A0�A8�F`j 8A0A(B BBBEtȫ��(�ī���A�A�D`| AAA�8���IlU�p���UDm G8�����}F�B�D �D(�D0L (A ABBJ $����lE�` Kn JHD���?AADDdh���RB�L�L �H(�H0�I�< 0A(A BBBI(�����A�K�L�� AAH�t���EE�(������A�C�F � MAHH ����F�B�B �B(�A0�A8�G�c 8A0A(B BBBFl����ME�GX�Խ�� B�A�A �l WDEk ABJP FNLo PDELCLH������F�L�D �D(�D0a (C ABBIo(C ABB 0����A�F b AAT����PtVLl�I B�M�E �B(�A0�A8�I� 8A0A(B BBBF$zRx�� ������,�� 4����WF�P�D �A(�F0m(C ABB 0���E�D`� AA<T����F�D�C �Gp�xF�_xDpl AABG`�X��� F�B�B �E(�D0�D8�Gp) 8A0A(B BBBG�x\�F�C�IpOxQ�N�J�IpVxL�U�H�Ipbxi�L�H�E�H�E�B�E�B�E�D�Np�x`�E�H�E�H�E�B�E�B�E�D�Np�xW�E�H�E�H�E�H�E�H�Pp�xO�N�G�IpFxD�F�L�H�H�E�H�E�H�E�H�E�H�Pp0�����B�A�D �G�h AABA(,���jA�H�G�R AAA(X�� E�C P������ J����)M�TG�$�����E�} FR FcL�����B�J�E �B(�A0�A8�I�� 8A0A(B BBBALT��_F�B�B �E(�D0�F8�J�{ 8A0A(B BBBAhd��|p��3x�����M�C�N @ M�F�OPF�A�Y ��T J�A�I� J�F�ED M�A�ED M�A�E( � ��E�A�D@0 AADL8 ����B�M�B �B(�A0�A8�O�� 8A0A(B BBBE(� d���DZ Bf JU Kf0� ���F�A�A �D�� AABHX� ���I�K�F yD�A�X ��� AADD M�A�ND M�A�ND X��6X ���EDm AHt ����B�M�B �B(�A0�A8�J� � 8A0A(B BBBK0� ,��qB�D�A �Dp� AABC� x��-AAU0���|E�C�G r AAEaHFLD���$B�B�E �B(�F0�A8�G�w 8A0A(B BBBF����1(����E�A�J�] AAA4�����E�H�A �^ FSKbKK40���B�A�A �q ABHKK D����G�� XA G0h�!���F�A�A �J�f AABD �@"���A�F b AFL��"���B�B�B �B(�A0�C8�G�� 8A0A(B BBBJT �.��;"B�B�B �B(�A0�A8�G� L�@L�E| 8A0A(B BBBA h tP��_E�� L�4� �R��sF�D�A �W GNIbHD4� �R��}F�D�D �L FSMbKK$� @S��8E�K�J OFDl$XS���F�B�B �B(�A0�A8�J�] 8A0A(B BBBA��^�L�A�q�^�L�B��xm��HUL��m��� B�S�E �B(�A0�A8�Q�� 8A0A(B BBBK�x��G8Lx��2F�B�A �A(�D@� (A ABBHLP|��-AAUhd|��EE�L��|�� B�G�E �E(�A0�A8�I�� 8A0A(B BBBC �X���lE�` Kn J0�����I�D�G [AAG��H ��8,����� F�B�A �A(�G�� (A ABBI0h4����F�A�A �G�� AABFL�����B�E�B �B(�A0�A8�F� 8A0A(B BBBB(�����gE�A�D0| AAH��oyg48���3Hd���"\����-AAU(x����fA�F�G�X AAHH�ؤ�� C�B�D �A(�I0�(A ABBE����G0����4������E�G� I� w� A� ^� A� ` AA0(4���LA�A�D r CADDFAd\P���sB�B�B �B(�A0�A8�G� L�@L�Bp�BB�Ch�BC�B 8A0A(B BBBD$�h���IE�I�S cCA�����E�L����]vf ܨ��\Dg AL< ����B�B�B �B(�A0�A8�G� I� O 8A0A(B BBBE�����EA�m A`�Ī���B�B�B �B(�A0�A8�G� L�@I�@z�@X�AW�@A�@� 8A0A(B BBBG ���aTM G((t���E�F�J� � AAALTH����F�B�B �B(�A0�A8�G�t 8A0A(B BBBEH�����AB�I�B �B(�A0�A8�D@� 8C0A(B BBBI(�����A�F�I�� AAE4�����R�B�A �A(�D0�(A ABB T���SI�y FCE�dxT����F�B�B �B(�A0�A8�G� L�@L�C�CN�Cn�CA�Cx 8A0A(B BBBD0������F�I�A �J�� AABA<(����A�A�G� I� Y� K� ^� H� v AADLT�����F�B�B �B(�A0�C8�J� 8A0A(B BBBD`���K�L IH HH HH HH HH HH HH HH HH HH HH HH(����E�P�G0W AAK44x���F�I�A �J0i AABIHl���E�A�D Z AAJi AAEe AAIKAA�T���`��-AAUL�t��~B�F�B �B(�A0�A8�G�Z 8A0A(B BBBG8���-AAULT���� B�O�B �B(�A0�A8�D�% 8A0A(B BBBF(����A�H�F`� AAET�����F�F�B �A(�A0�L�y 0A(A BBBC��F�\�A�((4��?A�F�G�� AAELTH���F�B�B �B(�D0�D8�F�b 8A0A(B BBBJ(�����E�A�D Z AAJ����](����8E�A�Ipz AAE��5AA]L, �X B�B�B �B(�A0�A8�G�} 8A0A(B BBBH(|0��A�K�I�� AAH ����A�T�� AG4���&F�A�C �G�� AABC@��B�B�E �D(�D0�L`l 0A(A BBBG<H���B�D�K �D@cHKPpHA@[ AABE��k0�p��F�I�A �JPl AABF`�<�DF�B�A �A(�G�8�M�K�G�`�^�N�a�A�Z (A ABBA04(���-F�A�D �FP� AABH0h$����F�A�A �LPv AABB��������(���E�D�O0v AAH�h����V�B�B �B(�A0�A8�D@M 8A0A(B BBBG� 8H�0D�(G� I�B�B�I�8A�0A�(B� B�B�B�0����F�A�A �J�� AABJL�l���rF�E�E �D(�J0�C (A BBBHy (C GBBI(�����E�H AR Ac<���EDm AX4���-AAU0tH���gE�C�G b AAE\HFH�����+ F�B�B �B(�A0�A8�J�g 8A0A(B BBBG4�h���A�D�Q V AABK CAAL,����B�M�E �B(�A0�A8�G� 8A0A(B BBBJL|p��rB�J�B �B(�A0�A8�G� 8A0A(B BBBGL�����B�Q�B �E(�A0�A8�G�f 8A0A(B BBBE P��+x0 l��M�C�N @ M�F�OPF�A�Y ��� J�A�ID J�F�LD H�A�ED M�A�E<� ���B�B�B �A(�J0� (C BBBK � ����A�H@E AA(!,��� E�A�J�� AAFL<!�%��a B�Q�B �B(�A0�A8�I�� 8A0A(B BBBGD�!0��'E�J�G p HAID HAKD EAF�!�0��3L�!$1���B�B�B �B(�A0�A8�G� 8A0A(B BBBC 8"�2���A�G�� AA\"�3���G�S F8x"D4���B�L�L �D(�G0{ (A ABBA(�"�4��qA�M�D M AAG(�"�4��B�D�D �o ABD#P5��! #l5���EADL<#6���B�G�B �B(�A0�A8�I�� 8A0A(B BBBG@�#�8��QF�A�D �G�_ AABKL�F�o�A�\�#�9��\&F�B�B �B(�A0�A8�J�N 8A0A(B BBBH��M�F�A�L0$�_���B�E�E �J(�D0�A8�G� � 8A0A(B BBBH8�$Lb��F�J�A �D(�G�� (A ABBH��$0c��UF�B�B �B(�D0�D8�G`q 8A0A(B BBBJGhCpZhPpPxL�B�E�B�E�B�E�S`bhLpUxE�B�E�B�E�S`HX%�e��FF�B�B �B(�A0�A8�D�D 8A0A(B BBBHL�%�g���F�B�B �B(�A0�A8�G�� 8A0A(B BBBAL�%Hw���B�N�B �E(�A0�A8�G�� 8A0A(B BBBDD&�x��-AAU0`&y��<B�F�B �E(�A0�A8�Dp@�&{���B�B�B �A(�A0�D@� 0A(A BBBCL�&�{���B�I�B �B(�A0�A8�G�J 8A0A(B BBBD\('�|���B�I�B �B(�A0�A8�G�y�n�R�B�� 8A0A(B BBBD<�'$~���B�B�A �C(�G�A (A ABBA0�'���� M�C�N dH�A�U ��8�'p����H�D�D �A ABDO ABFH8(Ă��"F�B�A �A(�G0v (D ABBH[8Z@AHDPI0L�(���� F�B�E �B(�A0�A8�MP