��jA�H�5P��H��1�H��H�H���j�L� ���jA�H�5�P���H��E1�E1�H�t�j1�1�jH��H�5�P��H��E1�E1�H����j1�1�jH��H�5�P�s�H��E1�H��H���jA��j�H�5�P�A�H��E1�1�H�Q��j1�H��jE1�H�5tP��H��E1�H��H���jE1�1�j1�H�5VP���H��E1�E1�H����j1�1�jH��H�5=P���H��E1�E1�H���j1�1�jH��H�5$P��H��E1�E1�H�,��j1�1�jH��H�5P�t�H��E1�E1�H����j1�H��j1�H�5�P�K�H��E1�E1�H���j1�H��j1�H�5�P�"�H��E1�E1�H�1��j1�1�jH��H�5�P��H��E1�E1�H����j1�1�jH��H�5�P���H��E1�E1�H�_��j1�1�jH��H�5~P��H��H��H����jA��L� ���j�H�5f�P�q�H��E1�E1�H����j1�H��j1�H�5+P�H�H��E1�E1�H�w��j1�H��j1�H�5P��H��E1�E1�H���j1�1�jH��H�5�P��H��E1�E1�H���j1�1�jH��H�5�P���H��E1�E1�H��j1�1�jH��H�5�P��H��H��H�f��jA��L� ���j�H�53-P�n�H��E1�E1�H�m��j1�1�jH��H�5vP�E�H��1�H��H�E���j�L� '��jA�H�5JP��H��H��H���jE1�H�55E1�j1�1�P���H��E1�E1�H��j1�1�jH��H�5P��H��E1�E1�H���j1�1�jH��H�5�P��H��E1�E1�H���j1�1�jH��H�5�P�n�H��E1�E1�H�=�j1�H��j1�H�5�P�E�H��E1�E1�H���j1�H��j1�H�5�P��H��E1�E1�H���j1�1�jH��H�5zP���H��E1�E1�H�b�j1�1�jH��H�5]P���H��E1�E1�H��j1�1�jH��H�5@P��H��E1�E1�H���j1�1�jH��H�5#P�x�H��H��E1�H���jE1�1�j1�H�5P�O�H��E1�E1�H�ί��j1�1�jH��H�5�P�&�H��E1�E1�H�ծ��j1�1�jH��H�5�EP��H��E1�E1�H����j1�1�jH��H�5�P���H��E1�E1�H����j1�1�jH��H�5P��H��E1�1�H�;���j1�H��jE1�H�5aP��H��H��H�����jE1�H�5KE1�j1�1�P�Y�H��E1�E1�H�ȫ��j1�1�jH��H�5"P�0�H��E1�E1�H����j1�1�jH��H�5P��H��E1�E1�H�V���j1�1�jH��H�5�P���H��E1�E1�H�����j1�1�jH��H�5�P��H��H��H�����jA��L� ���j�H�5�P��H��H��H�Q��jE1�H�5zE1�j1�1�P�V�H��H��E1�H�u���jE1�1�j�H�5NP�*�H��H��1�H�����j�L� |���jA�H�5^3P��H�� []A\���H��H���ModSecurity: SecServerSignature not allowed in VirtualHostModSecurity: Invalid value for SecCollectionTimeout: %sModSecurity: Invalid value for SecDebugLogLevel: %sModSecurity: Invalid regular expression: %sUpdating target by message with no messageUpdating target by tag with no tagModSecurity: Use SecRemoteRule with Key and URIModSecurity: Invalid URI: '%s'. Expected HTTPS.ModSecurity: SecRemoteRules cannot be used more than once.ModSecurity: Fatal error (memory allocation or unexpected internal error)!ModSecurity: SecDefaultAction must specify a disruptive action.ModSecurity: SecDefaultAction must specify a phase.ModSecurity: SecDefaultAction must not contain any metadata actions (id, rev, msg, tag, severity, ver, accuracy, maturity, logdata).ModSecurity: WARNING Using "severity" or "logdata" in SecDefaultAction is deprecated (%s:%d).ModSecurity: WARNING Using transformations in SecDefaultAction is deprecated (%s:%d).ModSecurity: SecDefaultAction must not contain a chain action.ModSecurity: SecDefaultAction must not contain a skip action.ModSecurity: SecDefaultAction must not contain a skipAfter action.ModSecurity: Cannot configure a secondary audit log without a primary defined: %sModSecurity: Failed to open the secondary audit log pipe: %sModSecurity: Failed to open the secondary audit log file: %sModSecurity: SecChrootDir not allowed in VirtualHostModSecurity: Failed to get the current working directoryModSecurity: Failed to chdir to %s, errno=%d (%s)ModSecurity: Invalid value for SecResponseBodyLimit: %sModSecurity: Response size limit can not exceed the hard limit: %liModSecurity: Invalid value for SecArgumentsLimit: %sModSecurity: Invalid value for SecRequestBodyJsonDepthLimit: %sModSecurity: Invalid value for SecRequestBodyNoFilesLimit: %sModSecurity: Invalid value for SecRequestBodyLimit: %sModSecurity: Invalid value for SecRequestBodyInMemoryLimit: %sModSecurity: Invalid value for SecRulePerfTime: %sModSecurity: SecPcreMatchLimitRecursion not allowed in VirtualHostModSecurity: Invalid setting for SecPcreMatchLimitRecursion: %sModSecurity: SecPcreMatchLimit not allowed in VirtualHostModSecurity: Invalid setting for SecPcreMatchLimit: %sModSecurity: Invalid setting for SecUnicodeCodePage: %sModSecurity: Invalid cookie format: %sModSecurity: Invalid cookie v0 separator: %sModSecurity: Invalid argument separator: %sModSecurity: Invalid value for SecRemoteRulesFailAction, expected: Abort or Warn.ModSecurity: Invalid value for SecHashEngine: %sModSecurity: Invalid setting for SecTmpSaveUploadedFiles: %sModSecurity: Invalid setting for SecUploadKeepFiles: %sModSecurity: Invalid value for SecUploadFileMode: %sModSecurity: Invalid value for SecXmlExternalEntity: %sModSecurity: Invalid value for SecConnEngine: %sModSecurity: Invalid value for SecStatusEngine: %sModSecurity: Invalid value for SecRuleEngine: %sModSecurity: Invalid value for SecRequestBodyLimitAction: %sModSecurity: Invalid value for SecResponseBodyLimitAction: %sModSecurity: Invalid value for SecResponseBodyAccess: %sModSecurity: Invalid value for SecInterceptOnError: %sModSecurity: Invalid value for SecRequestBodyAccess: %sModSecurity: Unrecognised parameter value for SecAuditLogFormat: %sModSecurity: Unrecognised parameter value for SecAuditLogType: %sModSecurity: Unrecognised parameter value for SecAuditEngine: %sModSecurity: SecDataDir not allowed in VirtualHost.Updating target by ID with no IDUpdating target by ID with no ruleset in this contextModSecurity: Attempt to update action for rule "%s" failed: Rule does not have an actionset.ModSecurity: Rule IDs cannot be updated via SecRuleUpdateActionById.ModSecurity: Rule phases cannot be updated via SecRuleUpdateActionById.ModSecurity: Invalid value for ID for update action: %sModSecurity: Rules must have at least id actionModSecurity: No action id present within the ruleModSecurity: Found another rule with the same idInternal Error: Failed to add placeholder to the ruleset.Internal Error: Failed to add rule to the ruleset.ModSecurity: Disruptive actions can only be specified by chain starter rules.ModSecurity: SkipAfter actions can only be specified by chain starter rules.ModSecurity: Execution phases can only be specified by chain starter rules.ModSecurity: Metadata actions (id, rev, msg, tag, severity, ver, accuracy, maturity, logdata) can only be specified by chain starter rules.ModSecurity: The skip action can only be used by chain starter rules. ModSecurity: Disruptive actions cannot be specified in the logging phase.ModSecurity: SecGuardianLog not allowed in VirtualHostModSecurity: Error in condition clauseModSecurity: Missing variable nameModSecurity: Failed to open the guardian log pipe: %sModSecurity: Failed to open the guardian log file: %sModSecurity: Failed to open debug log file: %sModSecurity: Failed to open the audit log pipe: %sModSecurity: Failed to open the audit log file: %sModSecurity: Invalid setting for SecUnicodeMapFile: %sModSecurity: Invalid value for SecCacheTransformations: %sModSecurity: Unable to process options for SecCacheTransformationsModSecurity: Unable to parse options for SecCacheTransformations: %sModSecurity: SecCacheTransformations invalid incremental value: %sModSecurity: SecCacheTransformations minlen out of range: %sModSecurity: SecCacheTransformations minlen must be positive: %sModSecurity: SecCacheTransformations maxlen out of range: %sModSecurity: SecCacheTransformations maxlen must be positive: %sModSecurity: SecCacheTransformations maxlen must not be less than minlen: %lu < %luModSecurity: SecCacheTransformations maxitems out of range: %sModSecurity: SecCacheTransformations maxitems must be positive: %sModSecurity: Invalid value for SecAuditLogFileMode: %sModSecurity: Invalid value for SecAuditLogDirMode: %sInvalid parts specification for SecAuditLogParts: %sInternal Error: Failed to add marker to the ruleset.ModSecurity: Space character between operator and parameter not found with ConnReadStateLimit: %sModSecurity: Invalid operator for SecConnReadStateLimit: %s, expected operators: @ipMatch, @ipMatchF or @ipMatchFromFile with or without !ModSecurity: failed to load IPs from: %sModSecurity: Invalid value for SecConnWriteStateLimit: %sSecWriteStateLimit is depricated, use SecConnWriteStateLimit instead.ModSecurity: Invalid value for SecConnReadStateLimit: %sSecReadStateLimit is depricated, use SecConnReadStateLimit instead.character that will be used as separator when parsing application/x-www-form-urlencoded content.character that will be used as separator when parsing cookie v0 content.On, Off or RelevantOnly to determine the level of audit loggingfilename of the primary audit log filefilename of the secondary audit log filelist of audit log parts that go into the log.regular expression that will be used to determine if the response status is relevant for audit loggingwhether to use the old audit log format (Serial) or new (Concurrent)whether to emit audit log data in native format or JSONpath to the audit log storage area; absolute, or relative to the root of the serveroctal permissions mode for concurrent audit log directoriesoctal permissions mode for concurrent audit log fileswhether or not to cache transformations. Defaults to true.path of the directory to which server will be chrootedcomponent signature to add to ModSecurity signature.version of the Cookie specification to use for parsing. Possible values are 0 and 1.path to the persistent data storage areadebug log level, which controls the verbosity of logging. Use values from 0 (no logging) to 9 (a *lot* of logging).set default collections timeout. default it 3600When set to On, removes the compression headers from the backend requests.database for geographical lookups module.The filename of the filter debugging log fileThreshold to log slow rules in usecs.maximum number of threads in READ_BUSY state per ip addressmaximum number of threads in WRITE_BUSY state per ip addressmaximum request body size that will be placed in memory (except for POST urlencoded requests).maximum request body size ModSecurity will accept.maximum request body size ModSecurity will accept, but excluding the size of uploaded files.maximum request body JSON parsing depth ModSecurity will accept.maximum number of ARGS that ModSecurity will accept.character encoding used in request.what happens when the response body limit is reachedwhat happens when the request body limit is reachedadds given MIME types to the list of types that will be buffered on outputclears the list of MIME types that will be buffered on outputrule target, operator and optional action listkey and URI to the remote rulesrule script and optional actionlistrule tag pattern and updated target listrule message pattern and updated target listthe new signature of the serverpath to the temporary storage arealimit the number of uploaded files processedoctal permissions mode for uploaded filesHashHrefHashFormActionHashLocationHashIframeSrcHashFrameSrccryptohttpsUnkwon contextapache2_config.ctagwarnabortoffrelevantonlydefaultdetectiononlyProcessPartialRejectNativeSerialConcurrentOnRelevantOnlyRandKeyOnlySessionIDRemoteIPnone@unconditionalMatchREMOTE_ADDRenv=incrementalminlenmaxlenmaxitemst:none,pass,marker:@noMatchtext/plaintext/htmlABCFHZcrypt!@ipMatchFromFile!@ipMatchF!@ipMatch%s %sSecActionan action listSecArgumentSeparatorSecCookiev0SeparatorSecAuditEngineSecAuditLogSecAuditLog2SecAuditLogPartsSecAuditLogRelevantStatusSecAuditLogTypeSecAuditLogFormatSecAuditLogStorageDirSecAuditLogDirModeSecAuditLogFileModeSecCacheTransformationsSecChrootDirSecComponentSignatureSecContentInjectionSecStreamOutBodyInspectionSecStreamInBodyInspectionSecCookieFormatSecDataDirSecDebugLogpath to the debug log fileSecDebugLogLevelSecCollectionTimeoutSecDefaultActiondefault action listSecDisableBackendCompressionSecGsbLookupDBdatabase google safe browsingSecUnicodeCodePageUnicode CodePageSecUnicodeMapFileUnicode Map fileSecGeoLookupDBSecGuardianLogSecMarkermarker for a skipAfter targetSecPcreMatchLimitPCRE match limitSecPcreMatchLimitRecursionPCRE match limit recursionSecRequestBodyAccessSecInterceptOnErrorSecRulePerfTimeSecConnReadStateLimitSecReadStateLimitSecConnWriteStateLimitSecWriteStateLimitSecRequestBodyInMemoryLimitSecRequestBodyLimitSecRequestBodyNoFilesLimitSecRequestBodyJsonDepthLimitSecArgumentsLimitSecRequestEncodingSecResponseBodyAccessSecResponseBodyLimitbyte limit for response bodySecResponseBodyLimitActionSecRequestBodyLimitActionSecResponseBodyMimeTypeSecResponseBodyMimeTypesClearSecRuleSecRuleEngineSecStatusEngineSecConnEngineSecRemoteRulesSecRemoteRulesFailActionAbort or WarnSecXmlExternalEntitySecRuleInheritanceSecRuleScriptSecRuleRemoveByIdrule ID for removalSecRuleRemoveByTagrule tag for removalSecRuleRemoveByMsgrule message for removalSecHashMethodPmHash method and patternSecHashMethodRxHash method and regexSecRuleUpdateActionByIdupdated action listSecRuleUpdateTargetByIdupdated target listSecRuleUpdateTargetByTagSecRuleUpdateTargetByMsgSecServerSignatureSecTmpDirSecUploadDirpath to the file upload areaSecUploadFileLimitSecUploadFileModeSecUploadKeepFilesSecTmpSaveUploadedFilesSecWebAppIdSecSensorIdsensor idSecHttpBlKeyhttpBl access keySecHashEngineSecHashKeySet Hash keySecHashParamSet Hash parameterOutput filter: Invalid response length: %luOutput filter: Response body data memory allocation failed. Asked for: %luOutput filter: Failed to flatten brigade (%d): %sOutput filter: Stream Response body data memory allocation failed. Asked for: %luinject_hashed_response_body: Unable to inject hash into response body. Returning response without changes.Content Injection (b): Added content to top: %sOutput filter: Error while forwarding response data (%d): No dataOutput filter: Error while forwarding response data (%d): %sModSecurity: Internal error in input filter: msr is null.Internal error: REQUEST_BODY phase incomplete for input filter in phase %dInput filter: Input forwarding already complete, skipping (f %pp, r %pp).Input filter: Forwarding input: mode=%d, block=%d, nbytes=%ld (f %pp, r %pp).Input filter: Forwarded %lu bytes.Input stream filter: Forwarded %lu bytes.Input filter: Input forwarding complete.Input filter: This request does not have a body.Input filter: Request body access not enabled.Input filter: Reading request body.Error reading request body: %sError reading request body: HTTP Error 413 - Request entity too large. (Most likely.)Error reading request body: Client went away.Failed reading input / bucket (%d): %sInput filter: Bucket type %s contains %lu bytes.Request body is larger than the configured limit (%ld).Request body no files data length is larger than the configured limit (%ld).Input filter: Completed receiving request body (length %lu).ModSecurity: Internal Error: msr is null in output filter.Output filter: Receiving output (f %pp, r %pp).Output filter: Failed to create brigade.Output filter: Response body buffering is not enabled.Output filter: MIME type structures corrupted (internal error).Output filter: Failed to allocate memory for content type.Output filter: Not buffering response body for unconfigured MIME type "%s".Output filter: Invalid Content-Length: %sOutput filter: Skipping response since Content-Length is zero.Output filter: Content-Length (%s) over the limit (%ld).Content Injection: Not enabled.Content Injection: Removing headers (C-L, L-M, Etag, Expires).Content Injection: Nothing to inject.Content Injection (nb): Added content to top: %sOutput filter: Internal error: output filtering complete yet filter was invoked.Output filter: Failed to read bucket (rc %d): %sOutput filter: Bucket type %s contains %lu bytes.Output filter: Response body too large (over limit of %ld, total not specified).Output filter: Processing partial response body (limit %ld)Content-Injection (nb): Added content to bottom: %sOutput filter: Completed receiving response body (buffered %s - %lu bytes).Output filter: Sending input brigade directly.Output filter: Completed receiving response body (non-buffering).Content Injection: Data reinjected bytes [%lu]Content-Injection (b): Added content to bottom: %sOutput filter: Output forwarding complete.Hash completed in %ld usec.apache2_io.cInput filter: Sent EOS.partialfullnullAccept-EncodingContent-LengthLast-ModifiedETagExpiresUNIQUE_ID [unique_id "%s"] [hostname "%s"]apache2_util.cPATH_TRANSLATED302REDIRECT_STATUSExec: %s[file "%s"] [line %d] [level %d] [status %d] %s%s%s%s%sHTTP/1.0HTTP/1.1downgrade-1.0force-response-1.0[%s] [%s/sid#%pp][rid#%pp][%s][%d] %s [client %s] ModSecurity: %s%s [uri "%s"]%sExec: Unable to create environment.Exec: Unable to create procattr.Exec: Execution failed: %s (%s)Exec: Failed to get script output pipe.Exec: First line from script output: "%s"Exec: Execution failed while reading output: %s (%s)
hs->pos > 0hs->len >= hs->poshs->state != NULLlibinjection/libinjection_html5.c���������������libinjection_h5_nexth5_state_datah5_state_self_closing_start_tag0123456789ABCDEFabcdef01haystackneedlenlen > 10123456789.,3.9.2CURRENT_USERCURRENT_DATECURRENT_TIMECURRENT_TIMESTAMPLOCALTIMENOT INNOT LIKELOCALTIMESTAMPpos >= 3::sp_passwordsoss&ss&nn&11&v1&s!!!<!=!>%=&&&=*=+=-=/=0&(1)O0&(1)U0&(1O(0&(1OF0&(1OS0&(1OV0&(F()0&(F(10&(F(F0&(F(N0&(F(S0&(F(V0&(N)O0&(N)U0&(NO(0&(NOF0&(NOS0&(NOV0&(S)O0&(S)U0&(SO(0&(SO10&(SOF0&(SON0&(SOS0&(SOV0&(V)O0&(V)U0&(VO(0&(VOF0&(VOS0&1O(10&1O(F0&1O(N0&1O(S0&1O(V0&1OF(0&1OS(0&1OS10&1OSF0&1OSU0&1OSV0&1OV(0&1OVF0&1OVO0&1OVS0&1OVU0&1UE(0&1UE10&1UEF0&1UEK0&1UEN0&1UES0&1UEV0&F()O0&F()U0&F(1)0&F(1O0&F(F(0&F(N)0&F(NO0&F(S)0&F(SO0&F(V)0&F(VO0&NO(10&NO(F0&NO(N0&NO(S0&NO(V0&NOF(0&NOS(0&NOS10&NOSF0&NOSU0&NOSV0&NOV(0&NOVF0&NOVO0&NOVS0&NOVU0&NUE(0&NUE10&NUEF0&NUEK0&NUEN0&NUES0&NUEV0&SO(10&SO(F0&SO(N0&SO(S0&SO(V0&SO1(0&SO1F0&SO1N0&SO1S0&SO1U0&SO1V0&SOF(0&SON(0&SON10&SONF0&SONU0&SOS(0&SOS10&SOSF0&SOSU0&SOSV0&SOV(0&SOVF0&SOVO0&SOVS0&SOVU0&SUE(0&SUE10&SUEF0&SUEK0&SUEN0&SUES0&SUEV0&VO(10&VO(F0&VO(N0&VO(S0&VO(V0&VOF(0&VOS(0&VOS10&VOSF0&VOSU0&VOSV0&VUE(0&VUE10&VUEF0&VUEK0&VUEN0&VUES0&VUEV0)&(EK0)&(EN0)UE(10)UE(F0)UE(N0)UE(S0)UE(V0)UE1K0)UE1O0)UEF(0)UEK(0)UEK10)UEKF0)UEKN0)UEKS0)UEKV0)UENK0)UENO0)UESK0)UESO0)UEVK0)UEVO01&(1&01&(1)01&(1,01&(1O01&(E(01&(E101&(EF01&(EK01&(EN01&(EO01&(ES01&(EV01&(F(01&(N&01&(N)01&(N,01&(NO01&(S&01&(S)01&(S,01&(SO01&(V&01&(V)01&(V,01&(VO01&101&1&(01&1&101&1&F01&1&N01&1&S01&1&V01&1)&01&1)C01&1)O01&1)U01&1;01&1;C01&1;E01&1;T01&1B(01&1B101&1BF01&1BN01&1BS01&1BV01&1C01&1EK01&1EN01&1F(01&1K(01&1K101&1KF01&1KN01&1KS01&1KV01&1O(01&1OF01&1OS01&1OV01&1TN01&1U01&1U(01&1U;01&1UC01&1UE01&E(101&E(F01&E(N01&E(O01&E(S01&E(V01&E101&E1;01&E1C01&E1K01&E1O01&EF(01&EK(01&EK101&EKF01&EKN01&EKS01&EKU01&EKV01&EN01&EN;01&ENC01&ENK01&ENO01&ES01&ES;01&ESC01&ESK01&ESO01&EUE01&EV01&EV;01&EVC01&EVK01&EVO01&F()01&F(101&F(E01&F(F01&F(N01&F(S01&F(V01&K&(01&K&101&K&F01&K&N01&K&S01&K&V01&K(101&K(F01&K(N01&K(S01&K(V01&K1O01&KC01&KF(01&KNK01&KO(01&KO101&KOF01&KOK01&KON01&KOS01&KOV01&KSO01&KVO01&N&(01&N&101&N&F01&N&N01&N&S01&N&V01&N)&01&N)C01&N)O01&N)U01&N;01&N;C01&N;E01&N;T01&NB(01&NB101&NBF01&NBN01&NBS01&NBV01&NC01&NEN01&NF(01&NK(01&NK101&NKF01&NKN01&NKS01&NKV01&NO(01&NOF01&NOS01&NOV01&NTN01&NU01&NU(01&NU;01&NUC01&NUE01&S01&S&(01&S&101&S&F01&S&N01&S&S01&S&V01&S)&01&S)C01&S)O01&S)U01&S101&S1;01&S1C01&S;01&S;C01&S;E01&S;T01&SB(01&SB101&SBF01&SBN01&SBS01&SBV01&SC01&SEK01&SEN01&SF(01&SK(01&SK101&SKF01&SKN01&SKS01&SKV01&SO(01&SO101&SOF01&SON01&SOS01&SOV01&STN01&SU01&SU(01&SU;01&SUC01&SUE01&SV01&SV;01&SVC01&SVO01&V01&V&(01&V&101&V&F01&V&N01&V&S01&V&V01&V)&01&V)C01&V)O01&V)U01&V;01&V;C01&V;E01&V;T01&VB(01&VB101&VBF01&VBN01&VBS01&VBV01&VC01&VEK01&VEN01&VF(01&VK(01&VK101&VKF01&VKN01&VKS01&VKV01&VO(01&VOF01&VOS01&VS01&VS;01&VSC01&VSO01&VTN01&VU01&VU(01&VU;01&VUC01&VUE01(EF(01(EKF01(EKN01(ENK01(U(E01)&(101)&(E01)&(F01)&(N01)&(S01)&(V01)&101)&1&01)&1)01)&1;01)&1B01)&1C01)&1F01)&1O01)&1U01)&F(01)&N01)&N&01)&N)01)&N;01)&NB01)&NC01)&NF01)&NO01)&NU01)&S01)&S&01)&S)01)&S;01)&SB01)&SC01)&SF01)&SO01)&SU01)&V01)&V&01)&V)01)&V;01)&VB01)&VC01)&VF01)&VO01)&VU01),(101),(F01),(N01),(S01),(V01);E(01);E101);EF01);EK01);EN01);EO01);ES01);EV01);T(01);T101);TF01);TK01);TN01);TO01);TS01);TV01)B(101)B(F01)B(N01)B(S01)B(V01)B101)B1&01)B1;01)B1C01)B1K01)B1N01)B1O01)B1U01)BF(01)BN01)BN&01)BN;01)BNC01)BNK01)BNO01)BNU01)BS01)BS&01)BS;01)BSC01)BSK01)BSO01)BSU01)BV01)BV&01)BV;01)BVC01)BVK01)BVO01)BVU01)C01)E(101)E(F01)E(N01)E(S01)E(V01)E1C01)E1O01)EF(01)EK(01)EK101)EKF01)EKN01)EKS01)EKV01)ENC01)ENO01)ESC01)ESO01)EVC01)EVO01)F(F01)K(101)K(F01)K(N01)K(S01)K(V01)K1&01)K1;01)K1B01)K1E01)K1O01)K1U01)KB(01)KB101)KBF01)KBN01)KBS01)KBV01)KF(01)KN&01)KN;01)KNB01)KNC01)KNE01)KNK01)KNU01)KS&01)KS;01)KSB01)KSE01)KSO01)KSU01)KUE01)KV&01)KV;01)KVB01)KVE01)KVO01)KVU01)O(101)O(E01)O(F01)O(N01)O(S01)O(V01)O101)O1&01)O1)01)O1;01)O1B01)O1C01)O1K01)O1U01)OF(01)ON&01)ON)01)ON;01)ONB01)ONC01)ONK01)ONU01)OS01)OS&01)OS)01)OS;01)OSB01)OSC01)OSK01)OSU01)OV01)OV&01)OV)01)OV;01)OVB01)OVC01)OVK01)OVO01)OVU01)U(E01)UE(01)UE101)UEF01)UEK01)UEN01)UES01)UEV01,(1)01,(1O01,(E(01,(E101,(EF01,(EK01,(EN01,(ES01,(EV01,(F(01,(N)01,(NO01,(S)01,(SO01,(V)01,(VO01,F()01,F(101,F(F01,F(N01,F(S01,F(V01;E(101;E(E01;E(F01;E(N01;E(S01;E(V01;E1,01;E1;01;E1C01;E1K01;E1O01;E1T01;EF(01;EK(01;EK101;EKF01;EKN01;EKO01;EKS01;EKV01;EN,01;EN;01;ENC01;ENE01;ENK01;ENO01;ENT01;ES,01;ES;01;ESC01;ESK01;ESO01;EST01;EV,01;EV;01;EVC01;EVK01;EVO01;EVT01;N:T01;T(101;T(C01;T(E01;T(F01;T(N01;T(S01;T(V01;T1(01;T1,01;T1;01;T1C01;T1F01;T1K01;T1O01;T1T01;T;01;T;C01;TF(01;TK(01;TK101;TKF01;TKK01;TKN01;TKO01;TKS01;TKV01;TN(01;TN,01;TN101;TN;01;TNC01;TNF01;TNK01;TNN01;TNO01;TNS01;TNT01;TNV01;TO(01;TS(01;TS,01;TS;01;TSC01;TSF01;TSK01;TSO01;TST01;TTN01;TV(01;TV,01;TV;01;TVC01;TVF01;TVK01;TVO01;TVT01A(F(01A(N)01A(NO01A(S)01A(SO01A(V)01A(VO01AF()01AF(101AF(F01AF(N01AF(S01AF(V01ASO(01ASO101ASOF01ASON01ASOS01ASOV01ASUE01ATO(01ATO101ATOF01ATON01ATOS01ATOV01ATUE01AVO(01AVOF01AVOS01AVUE01B(1)01B(1O01B(F(01B(NO01B(S)01B(SO01B(V)01B(VO01B101B1&(01B1&101B1&F01B1&N01B1&S01B1&V01B1,(01B1,F01B1;01B1;C01B1B(01B1B101B1BF01B1BN01B1BS01B1BV01B1C01B1K(01B1K101B1KF01B1KN01B1KS01B1KV01B1O(01B1OF01B1OS01B1OV01B1U(01B1UE01BE(101BE(F01BE(N01BE(S01BE(V01BEK(01BF()01BF(101BF(F01BF(N01BF(S01BF(V01BN01BN&(01BN&101BN&F01BN&N01BN&S01BN&V01BN,(01BN,F01BN;01BN;C01BNB(01BNB101BNBF01BNBN01BNBS01BNBV01BNC01BNK(01BNK101BNKF01BNKN01BNKS01BNKV01BNO(01BNOF01BNOS01BNOV01BNU(01BNUE01BS01BS&(01BS&101BS&F01BS&N01BS&S01BS&V01BS,(01BS,F01BS;01BS;C01BSB(01BSB101BSBF01BSBN01BSBS01BSBV01BSC01BSK(01BSK101BSKF01BSKN01BSKS01BSKV01BSO(01BSO101BSOF01BSON01BSOS01BSOV01BSU(01BSUE01BV01BV&(01BV&101BV&F01BV&N01BV&S01BV&V01BV,(01BV,F01BV;01BV;C01BVB(01BVB101BVBF01BVBN01BVBS01BVBV01BVC01BVK(01BVK101BVKF01BVKN01BVKS01BVKV01BVO(01BVOF01BVOS01BVU(01BVUE01C01E(1)01E(1O01E(F(01E(N)01E(NO01E(S)01E(SO01E(V)01E(VO01E1;T01E1C01E1O(01E1OF01E1OS01E1OV01E1T(01E1T101E1TF01E1TN01E1TS01E1TV01E1UE01EF()01EF(101EF(F01EF(N01EF(S01EF(V01EK(101EK(E01EK(F01EK(N01EK(S01EK(V01EK1;01EK1C01EK1O01EK1T01EK1U01EKF(01EKN;01EKNC01EKNE01EKNT01EKNU01EKOK01EKS;01EKSC01EKSO01EKST01EKSU01EKU(01EKU101EKUE01EKUF01EKUS01EKUV01EKV;01EKVC01EKVO01EKVT01EKVU01EN;T01ENC01ENEN01ENO(01ENOF01ENOS01ENOV01ENT(01ENT101ENTF01ENTN01ENTS01ENTV01ENUE01EOKN01ES;T01ESC01ESO(01ESO101ESOF01ESON01ESOS01ESOV01EST(01EST101ESTF01ESTN01ESTS01ESTV01ESUE01EU(101EU(F01EU(N01EU(S01EU(V01EU1,01EU1C01EU1O01EUEF01EUEK01EUF(01EUS,01EUSC01EUSO01EUV,01EUVC01EUVO01EV;T01EVC01EVO(01EVOF01EVOS01EVT(01EVT101EVTF01EVTN01EVTS01EVTV01EVUE01F()101F()F01F()K01F()N01F()O01F()S01F()U01F()V01F(1)01F(1N01F(1O01F(E(01F(E101F(EF01F(EK01F(EN01F(ES01F(EV01F(F(01F(N)01F(N,01F(NO01F(S)01F(SO01F(V)01F(VO01K(1O01K(F(01K(N)01K(NO01K(S)01K(SO01K(V)01K(VO01K)&(01K)&101K)&F01K)&N01K)&S01K)&V01K);E01K);T01K)B(01K)B101K)BF01K)BN01K)BS01K)BV01K)E(01K)E101K)EF01K)EK01K)EN01K)ES01K)EV01K)F(01K)O(01K)OF01K)UE01K101K1&(01K1&101K1&F01K1&N01K1&S01K1&V01K1;01K1;C01K1;E01K1;T01K1B(01K1B101K1BF01K1BN01K1BS01K1BV01K1C01K1E(01K1E101K1EF01K1EK01K1EN01K1ES01K1EV01K1O(01K1OF01K1OS01K1OV01K1U(01K1UE01KF()01KF(101KF(F01KF(N01KF(S01KF(V01KN01KN&(01KN&101KN&F01KN&N01KN&S01KN&V01KN;01KN;C01KN;E01KN;T01KNB(01KNB101KNBF01KNBN01KNBS01KNBV01KNC01KNE(01KNE101KNEF01KNEN01KNES01KNEV01KNU(01KNUE01KS01KS&(01KS&101KS&F01KS&N01KS&S01KS&V01KS;01KS;C01KS;E01KS;T01KSB(01KSB101KSBF01KSBN01KSBS01KSBV01KSC01KSE(01KSE101KSEF01KSEK01KSEN01KSES01KSEV01KSO(01KSO101KSOF01KSON01KSOS01KSOV01KSU(01KSUE01KUE(01KUE101KUEF01KUEK01KUEN01KUES01KUEV01KV01KV&(01KV&101KV&F01KV&N01KV&S01KV&V01KV;01KV;C01KV;E01KV;T01KVB(01KVB101KVBF01KVBN01KVBS01KVBV01KVC01KVE(01KVE101KVEF01KVEK01KVEN01KVES01KVEV01KVO(01KVOF01KVOS01KVU(01KVUE01N&F(01N(1O01N(F(01N(S)01N(SO01N(V)01N(VO01N)UE01N,F(01NE(101NE(F01NE(N01NE(S01NE(V01NE1C01NE1O01NEF(01NENC01NENO01NESC01NESO01NEVC01NEVO01NU(E01NUE01NUE(01NUE101NUE;01NUEC01NUEF01NUEK01NUEN01NUES01NUEV01O(1&01O(1)01O(1,01O(1O01O(E(01O(E101O(EE01O(EF01O(EK01O(EN01O(EO01O(ES01O(EV01O(F(01O(N&01O(N)01O(N,01O(NO01O(S&01O(S)01O(S,01O(SO01O(V&01O(V)01O(V,01O(VO01OF()01OF(101OF(E01OF(F01OF(N01OF(S01OF(V01OK&(01OK&101OK&F01OK&N01OK&S01OK&V01OK(101OK(F01OK(N01OK(S01OK(V01OK1C01OK1O01OKF(01OKNC01OKO(01OKO101OKOF01OKON01OKOS01OKOV01OKSC01OKSO01OKVC01OKVO01ONSU01OS&(01OS&101OS&E01OS&F01OS&K01OS&N01OS&S01OS&U01OS&V01OS(E01OS(U01OS)&01OS),01OS);01OS)B01OS)C01OS)E01OS)F01OS)K01OS)O01OS)U01OS,(01OS,F01OS1(01OS1F01OS1N01OS1S01OS1U01OS1V01OS;01OS;C01OS;E01OS;N01OS;T01OSA(01OSAF01OSAS01OSAT01OSAV01OSB(01OSB101OSBE01OSBF01OSBN01OSBS01OSBV01OSC01OSE(01OSE101OSEF01OSEK01OSEN01OSEO01OSES01OSEU01OSEV01OSF(01OSK(01OSK)01OSK101OSKB01OSKF01OSKN01OSKS01OSKU01OSKV01OST(01OST101OSTE01OSTF01OSTN01OSTS01OSTT01OSTV01OSU01OSU(01OSU101OSU;01OSUC01OSUE01OSUF01OSUK01OSUO01OSUS01OSUT01OSUV01OSV(01OSVF01OSVO01OSVS01OSVU01OU(E01OUEK01OUEN01OV01OV&(01OV&101OV&E01OV&F01OV&K01OV&N01OV&S01OV&U01OV&V01OV(E01OV(U01OV)&01OV),01OV);01OV)B01OV)C01OV)E01OV)F01OV)K01OV)O01OV)U01OV,(01OV,F01OV;01OV;C01OV;E01OV;N01OV;T01OVA(01OVAF01OVAS01OVAT01OVAV01OVB(01OVB101OVBE01OVBF01OVBN01OVBS01OVBV01OVC01OVE(01OVE101OVEF01OVEK01OVEN01OVEO01OVES01OVEU01OVEV01OVF(01OVK(01OVK)01OVK101OVKB01OVKF01OVKN01OVKS01OVKU01OVKV01OVO(01OVOF01OVOK01OVOS01OVOU01OVS(01OVS101OVSF01OVSO01OVSU01OVSV01OVT(01OVT101OVTE01OVTF01OVTN01OVTS01OVTT01OVTV01OVU01OVU(01OVU101OVU;01OVUC01OVUE01OVUF01OVUK01OVUO01OVUS01OVUT01OVUV01SF()01SF(101SF(F01SF(N01SF(S01SF(V01SUE01SUE;01SUEC01SUEK01SV01SV;01SV;C01SVC01SVO(01SVOF01SVOS01T(1)01T(1O01T(F(01T(N)01T(NO01T(S)01T(SO01T(V)01T(VO01T1(F01T1O(01T1OF01T1OS01T1OV01TE(101TE(F01TE(N01TE(S01TE(V01TE1N01TE1O01TEF(01TEK(01TEK101TEKF01TEKN01TEKS01TEKV01TENN01TENO01TESN01TESO01TEVN01TEVO01TF()01TF(101TF(F01TF(N01TF(S01TF(V01TN(101TN(F01TN(S01TN(V01TN1C01TN1O01TN;E01TN;N01TN;T01TNE(01TNE101TNEF01TNEN01TNES01TNEV01TNF(01TNKN01TNN:01TNNC01TNNO01TNO(01TNOF01TNOS01TNOV01TNSC01TNSO01TNT(01TNT101TNTF01TNTN01TNTS01TNTV01TNVC01TNVO01TS(F01TSO(01TSO101TSOF01TSON01TSOS01TSOV01TTNE01TTNK01TTNN01TTNT01TV(101TV(F01TVO(01TVOF01TVOS01U01U(1)01U(1O01U(E(01U(E101U(EF01U(EK01U(EN01U(ES01U(EV01U(F(01U(N)01U(NO01U(S)01U(SO01U(V)01U(VO01U1,(01U1,F01U1C01U1O(01U1OF01U1OS01U1OV01U;01U;C01UC01UE01UE(101UE(E01UE(F01UE(N01UE(O01UE(S01UE(V01UE101UE1&01UE1(01UE1)01UE1,01UE1;01UE1B01UE1C01UE1F01UE1K01UE1N01UE1O01UE1S01UE1U01UE1V01UE;01UE;C01UEC01UEF01UEF(01UEF,01UEF;01UEFC01UEK01UEK(01UEK101UEK;01UEKC01UEKF01UEKN01UEKO01UEKS01UEKV01UEN01UEN&01UEN(01UEN)01UEN,01UEN101UEN;01UENB01UENC01UENF01UENK01UENN01UENO01UENS01UENU01UEOK01UEON01UES01UES&01UES(01UES)01UES,01UES101UES;01UESB01UESC01UESF01UESK01UESO01UESU01UESV01UEV01UEV&01UEV(01UEV)01UEV,01UEV;01UEVB01UEVC01UEVF01UEVK01UEVN01UEVO01UEVS01UEVU01UF()01UF(101UF(F01UF(N01UF(S01UF(V01UK(E01UO(E01UON(01UON101UONF01UONS01US,(01US,F01USC01USO(01USO101USOF01USON01USOS01USOV01UTN(01UTN101UTNF01UTNN01UTNS01UTNV01UV,(01UV,F01UVC01UVO(01UVOF01UVOS01VF()01VF(101VF(F01VF(N01VF(S01VF(V01VO(101VO(F01VO(N01VO(S01VO(V01VOF(01VOS(01VOS101VOSF01VOSU01VOSV01VS01VS;01VS;C01VSC01VSO(01VSO101VSOF01VSON01VSOS01VSOV01VUE01VUE;01VUEC01VUEK0;T(EF0;T(EK0;TKNC0E(1&(0E(1&10E(1&F0E(1&N0E(1&S0E(1&V0E(1)&0E(1),0E(1)10E(1);0E(1)B0E(1)C0E(1)F0E(1)K0E(1)N0E(1)O0E(1)S0E(1)U0E(1)V0E(1,F0E(1F(0E(1N)0E(1O(0E(1OF0E(1OS0E(1OV0E(1S)0E(1V)0E(1VO0E(E(10E(E(E0E(E(F0E(E(N0E(E(S0E(E(V0E(E1&0E(E1)0E(E1O0E(EF(0E(EK(0E(EK10E(EKF0E(EKN0E(EKS0E(EKV0E(EN&0E(EN)0E(ENO0E(ES&0E(ES)0E(ESO0E(EV&0E(EV)0E(EVO0E(F()0E(F(10E(F(E0E(F(F0E(F(N0E(F(S0E(F(V0E(N&(0E(N&10E(N&F0E(N&N0E(N&S0E(N&V0E(N(10E(N(F0E(N(S0E(N(V0E(N)&0E(N),0E(N)10E(N);0E(N)B0E(N)C0E(N)F0E(N)K0E(N)N0E(N)O0E(N)S0E(N)U0E(N)V0E(N,F0E(N1)0E(N1O0E(NF(0E(NO(0E(NOF0E(NOS0E(NOV0E(S&(0E(S&10E(S&F0E(S&N0E(S&S0E(S&V0E(S)&0E(S),0E(S)10E(S);0E(S)B0E(S)C0E(S)F0E(S)K0E(S)N0E(S)O0E(S)S0E(S)U0E(S)V0E(S,F0E(S1)0E(SF(0E(SO(0E(SO10E(SOF0E(SON0E(SOS0E(SOV0E(SV)0E(SVO0E(V&(0E(V&10E(V&F0E(V&N0E(V&S0E(V&V0E(V)&0E(V),0E(V)10E(V);0E(V)B0E(V)C0E(V)F0E(V)K0E(V)N0E(V)O0E(V)S0E(V)U0E(V)V0E(V,F0E(VF(0E(VO(0E(VOF0E(VOS0E(VS)0E(VSO0E1&(10E1&(E0E1&(F0E1&(N0E1&(S0E1&(V0E1&1)0E1&1O0E1&F(0E1&N)0E1&NO0E1&S)0E1&SO0E1&V)0E1&VO0E1)0E1)&(0E1)&10E1)&F0E1)&N0E1)&S0E1)&V0E1);0E1);(0E1);C0E1);E0E1);T0E1)C0E1)KN0E1)O(0E1)O10E1)OF0E1)ON0E1)OS0E1)OV0E1)UE0E1,(10E1,(F0E1,(N0E1,(S0E1,(V0E1,F(0E1;(E0E1B(10E1B(F0E1B(N0E1B(S0E1B(V0E1B1)0E1B1O0E1BF(0E1BN)0E1BNO0E1BS)0E1BSO0E1BV)0E1BVO0E1F()0E1F(10E1F(F0E1F(N0E1F(S0E1F(V0E1K(10E1K(E0E1K(F0E1K(N0E1K(S0E1K(V0E1K1)0E1K1K0E1K1O0E1KF(0E1KN0E1KN)0E1KN;0E1KNC0E1KNK0E1KNU0E1KS)0E1KSK0E1KSO0E1KV)0E1KVK0E1KVO0E1N)U0E1N;0E1N;C0E1NC0E1NKN0E1O(10E1O(E0E1O(F0E1O(N0E1O(S0E1O(V0E1OF(0E1OS&0E1OS(0E1OS)0E1OS,0E1OS10E1OS;0E1OSB0E1OSF0E1OSK0E1OSU0E1OSV0E1OV&0E1OV(0E1OV)0E1OV,0E1OV;0E1OVB0E1OVF0E1OVK0E1OVO0E1OVS0E1OVU0E1S;0E1S;C0E1SC0E1U(E0E1UE(0E1UE10E1UEF0E1UEK0E1UEN0E1UES0E1UEV0E1V0E1V;0E1V;C0E1VC0E1VO(0E1VOF0E1VOS0EE(F(0EEK(F0EF()&0EF(),0EF()10EF();0EF()B0EF()F0EF()K0EF()N0EF()O0EF()S0EF()U0EF()V0EF(1&0EF(1)0EF(1,0EF(1O0EF(E(0EF(E10EF(EF0EF(EK0EF(EN0EF(ES0EF(EV0EF(F(0EF(N&0EF(N)0EF(N,0EF(NO0EF(O)0EF(S&0EF(S)0EF(S,0EF(SO0EF(V&0EF(V)0EF(V,0EF(VO0EK(1&0EK(1(0EK(1)0EK(1,0EK(1F0EK(1N0EK(1O0EK(1S0EK(1V0EK(E(0EK(E10EK(EF0EK(EK0EK(EN0EK(ES0EK(EV0EK(F(0EK(N&0EK(N(0EK(N)0EK(N,0EK(N10EK(NF0EK(NO0EK(S&0EK(S(0EK(S)0EK(S,0EK(S10EK(SF0EK(SO0EK(SV0EK(V&0EK(V(0EK(V)0EK(V,0EK(VF0EK(VO0EK(VS0EK1&(0EK1&10EK1&F0EK1&N0EK1&S0EK1&V0EK1)0EK1)&0EK1);0EK1)C0EK1)K0EK1)O0EK1)U0EK1,(0EK1,F0EK1;(0EK1B(0EK1B10EK1BF0EK1BN0EK1BS0EK1BV0EK1F(0EK1K(0EK1K10EK1KF0EK1KN0EK1KS0EK1KV0EK1N0EK1N)0EK1N;0EK1NC0EK1NK0EK1O(0EK1OF0EK1OS0EK1OV0EK1S0EK1S;0EK1SC0EK1SF0EK1SK0EK1U(0EK1UE0EK1V0EK1V;0EK1VC0EK1VF0EK1VK0EK1VO0EKE(F0EKEK(0EKF()0EKF(10EKF(E0EKF(F0EKF(N0EKF(O0EKF(S0EKF(V0EKN&(0EKN&10EKN&F0EKN&N0EKN&S0EKN&V0EKN(10EKN(F0EKN(S0EKN(V0EKN)0EKN)&0EKN);0EKN)C0EKN)K0EKN)O0EKN)U0EKN,(0EKN,F0EKN10EKN1;0EKN1C0EKN1K0EKN1O0EKN;(0EKNB(0EKNB10EKNBF0EKNBN0EKNBS0EKNBV0EKNF(0EKNK(0EKNK10EKNKF0EKNKN0EKNKS0EKNKV0EKNU(0EKNUE0EKO(10EKO(F0EKO(N0EKO(S0EKO(V0EKOK(0EKOKN0EKS&(0EKS&10EKS&F0EKS&N0EKS&S0EKS&V0EKS)0EKS)&0EKS);0EKS)C0EKS)K0EKS)O0EKS)U0EKS,(0EKS,F0EKS10EKS1;0EKS1C0EKS1F0EKS1K0EKS;(0EKSB(0EKSB10EKSBF0EKSBN0EKSBS0EKSBV0EKSF(0EKSK(0EKSK10EKSKF0EKSKN0EKSKS0EKSKV0EKSO(0EKSO10EKSOF0EKSON0EKSOS0EKSOV0EKSU(0EKSUE0EKSV0EKSV;0EKSVC0EKSVF0EKSVK0EKSVO0EKV&(0EKV&10EKV&F0EKV&N0EKV&S0EKV&V0EKV)0EKV)&0EKV);0EKV)C0EKV)K0EKV)O0EKV)U0EKV,(0EKV,F0EKV;(0EKVB(0EKVB10EKVBF0EKVBN0EKVBS0EKVBV0EKVF(0EKVK(0EKVK10EKVKF0EKVKN0EKVKS0EKVKV0EKVO(0EKVOF0EKVOS0EKVS0EKVS;0EKVSC0EKVSF0EKVSK0EKVSO0EKVU(0EKVUE0EN&(10EN&(E0EN&(F0EN&(N0EN&(S0EN&(V0EN&1)0EN&1O0EN&F(0EN&N)0EN&NO0EN&S)0EN&SO0EN&V)0EN&VO0EN(1O0EN(F(0EN(S)0EN(SO0EN(V)0EN(VO0EN)0EN)&(0EN)&10EN)&F0EN)&N0EN)&S0EN)&V0EN);0EN);(0EN);C0EN);E0EN);T0EN)C0EN)KN0EN)O(0EN)O10EN)OF0EN)ON0EN)OS0EN)OV0EN)UE0EN,(10EN,(F0EN,(N0EN,(S0EN,(V0EN,F(0EN1;0EN1;C0EN1O(0EN1OF0EN1OS0EN1OV0EN;(E0ENB(10ENB(F0ENB(N0ENB(S0ENB(V0ENB1)0ENB1O0ENBF(0ENBN)0ENBNO0ENBS)0ENBSO0ENBV)0ENBVO0ENF()0ENF(10ENF(F0ENF(N0ENF(S0ENF(V0ENK(10ENK(E0ENK(F0ENK(N0ENK(S0ENK(V0ENK1)0ENK1K0ENK1O0ENKF(0ENKN)0ENKN,0ENKN;0ENKNB0ENKNC0ENKNK0ENKNU0ENKS)0ENKSK0ENKSO0ENKV)0ENKVK0ENKVO0ENO(10ENO(E0ENO(F0ENO(N0ENO(S0ENO(V0ENOF(0ENOS&0ENOS(0ENOS)0ENOS,0ENOS10ENOS;0ENOSB0ENOSF0ENOSK0ENOSU0ENOSV0ENOV&0ENOV(0ENOV)0ENOV,0ENOV;0ENOVB0ENOVF0ENOVK0ENOVO0ENOVS0ENOVU0ENU(E0ENUE(0ENUE10ENUEF0ENUEK0ENUEN0ENUES0ENUEV0EOK(E0EOKNK0ES&(10ES&(E0ES&(F0ES&(N0ES&(S0ES&(V0ES&1)0ES&1O0ES&F(0ES&N)0ES&NO0ES&S)0ES&SO0ES&V)0ES&VO0ES)0ES)&(0ES)&10ES)&F0ES)&N0ES)&S0ES)&V0ES);0ES);(0ES);C0ES);E0ES);T0ES)C0ES)KN0ES)O(0ES)O10ES)OF0ES)ON0ES)OS0ES)OV0ES)UE0ES,(10ES,(F0ES,(N0ES,(S0ES,(V0ES,F(0ES10ES1;0ES1;C0ES1C0ES;(E0ESB(10ESB(F0ESB(N0ESB(S0ESB(V0ESB1)0ESB1O0ESBF(0ESBN)0ESBNO0ESBS)0ESBSO0ESBV)0ESBVO0ESF()0ESF(10ESF(F0ESF(N0ESF(S0ESF(V0ESK(10ESK(E0ESK(F0ESK(N0ESK(S0ESK(V0ESK1)0ESK1K0ESK1O0ESKF(0ESKN0ESKN)0ESKN;0ESKNC0ESKNK0ESKNU0ESKS)0ESKSK0ESKSO0ESKV)0ESKVK0ESKVO0ESO(10ESO(E0ESO(F0ESO(N0ESO(S0ESO(V0ESO1&0ESO1(0ESO1)0ESO1,0ESO1;0ESO1B0ESO1F0ESO1K0ESO1N0ESO1S0ESO1U0ESO1V0ESOF(0ESON&0ESON(0ESON)0ESON,0ESON10ESON;0ESONB0ESONF0ESONK0ESONU0ESOS&0ESOS(0ESOS)0ESOS,0ESOS10ESOS;0ESOSB0ESOSF0ESOSK0ESOSU0ESOSV0ESOV&0ESOV(0ESOV)0ESOV,0ESOV;0ESOVB0ESOVF0ESOVK0ESOVO0ESOVS0ESOVU0ESU(E0ESUE(0ESUE10ESUEF0ESUEK0ESUEN0ESUES0ESUEV0ESV0ESV;0ESV;C0ESVC0ESVO(0ESVOF0ESVOS0EV&(10EV&(E0EV&(F0EV&(N0EV&(S0EV&(V0EV&1)0EV&1O0EV&F(0EV&N)0EV&NO0EV&S)0EV&SO0EV&V)0EV&VO0EV)0EV)&(0EV)&10EV)&F0EV)&N0EV)&S0EV)&V0EV);0EV);(0EV);C0EV);E0EV);T0EV)C0EV)KN0EV)O(0EV)O10EV)OF0EV)ON0EV)OS0EV)OV0EV)UE0EV,(10EV,(F0EV,(N0EV,(S0EV,(V0EV,F(0EV;(E0EVB(10EVB(F0EVB(N0EVB(S0EVB(V0EVB1)0EVB1O0EVBF(0EVBN)0EVBNO0EVBS)0EVBSO0EVBV)0EVBVO0EVF()0EVF(10EVF(F0EVF(N0EVF(S0EVF(V0EVK(10EVK(E0EVK(F0EVK(N0EVK(S0EVK(V0EVK1)0EVK1K0EVK1O0EVKF(0EVKN0EVKN)0EVKN;0EVKNC0EVKNK0EVKNU0EVKS)0EVKSK0EVKSO0EVKV)0EVKVK0EVKVO0EVN0EVN)U0EVN;0EVN;C0EVNC0EVNKN0EVNO(0EVNOF0EVNOS0EVNOV0EVO(10EVO(E0EVO(F0EVO(N0EVO(S0EVO(V0EVOF(0EVOS&0EVOS(0EVOS)0EVOS,0EVOS10EVOS;0EVOSB0EVOSF0EVOSK0EVOSU0EVOSV0EVS0EVS;0EVS;C0EVSC0EVSO(0EVSO10EVSOF0EVSON0EVSOS0EVSOV0EVU(E0EVUE(0EVUE10EVUEF0EVUEK0EVUEN0EVUES0EVUEV0F()&(0F()&10F()&E0F()&F0F()&K0F()&N0F()&S0F()&V0F(),(0F(),10F(),F0F(),N0F(),S0F(),V0F()1(0F()1F0F()1N0F()1O0F()1S0F()1U0F()1V0F();E0F();N0F();T0F()A(0F()AF0F()AS0F()AT0F()AV0F()B(0F()B10F()BE0F()BF0F()BN0F()BS0F()BV0F()C0F()E(0F()E10F()EF0F()EK0F()EN0F()EO0F()ES0F()EU0F()EV0F()F(0F()K(0F()K)0F()K10F()KF0F()KN0F()KS0F()KU0F()KV0F()N&0F()N(0F()N)0F()N,0F()N10F()NE0F()NF0F()NO0F()NU0F()O(0F()O10F()OF0F()OK0F()ON0F()OS0F()OU0F()OV0F()S(0F()S10F()SF0F()SO0F()SU0F()SV0F()T(0F()T10F()TE0F()TF0F()TN0F()TS0F()TT0F()TV0F()U0F()U(0F()U10F()U;0F()UC0F()UE0F()UF0F()UK0F()UO0F()US0F()UT0F()UV0F()V(0F()VF0F()VO0F()VS0F()VU0F(1&(0F(1&10F(1&F0F(1&N0F(1&S0F(1&V0F(1)0F(1)&0F(1),0F(1)10F(1);0F(1)A0F(1)B0F(1)C0F(1)E0F(1)F0F(1)K0F(1)N0F(1)O0F(1)S0F(1)T0F(1)U0F(1)V0F(1,(0F(1,F0F(1O(0F(1OF0F(1OS0F(1OV0F(E(10F(E(E0F(E(F0F(E(N0F(E(S0F(E(V0F(E1&0F(E1)0F(E1K0F(E1O0F(EF(0F(EK(0F(EK10F(EKF0F(EKN0F(EKO0F(EKS0F(EKV0F(EN&0F(EN)0F(ENK0F(ENO0F(EOK0F(ES&0F(ES)0F(ESK0F(ESO0F(EV&0F(EV)0F(EVK0F(EVO0F(F()0F(F(10F(F(E0F(F(F0F(F(N0F(F(S0F(F(V0F(K()0F(K,(0F(K,F0F(N&(0F(N&10F(N&F0F(N&N0F(N&S0F(N&V0F(N)0F(N)&0F(N),0F(N)10F(N);0F(N)A0F(N)B0F(N)C0F(N)E0F(N)F0F(N)K0F(N)N0F(N)O0F(N)S0F(N)T0F(N)U0F(N)V0F(N,(0F(N,F0F(NO(0F(NOF0F(NOS0F(NOV0F(S&(0F(S&10F(S&F0F(S&N0F(S&S0F(S&V0F(S)0F(S)&0F(S),0F(S)10F(S);0F(S)A0F(S)B0F(S)C0F(S)E0F(S)F0F(S)K0F(S)N0F(S)O0F(S)S0F(S)T0F(S)U0F(S)V0F(S,(0F(S,F0F(SO(0F(SO10F(SOF0F(SON0F(SOS0F(SOV0F(T,(0F(T,F0F(V&(0F(V&10F(V&F0F(V&N0F(V&S0F(V&V0F(V)0F(V)&0F(V),0F(V)10F(V);0F(V)A0F(V)B0F(V)C0F(V)E0F(V)F0F(V)K0F(V)N0F(V)O0F(V)S0F(V)T0F(V)U0F(V)V0F(V,(0F(V,F0F(VO(0F(VOF0F(VOS0K(1),0K(1)A0K(1)K0K(1)O0K(1O(0K(1OF0K(1OS0K(1OV0K(F()0K(F(10K(F(F0K(F(N0K(F(S0K(F(V0K(N),0K(N)A0K(N)K0K(N)O0K(NO(0K(NOF0K(NOS0K(NOV0K(S),0K(S)A0K(S)K0K(S)O0K(SO(0K(SO10K(SOF0K(SON0K(SOS0K(SOV0K(V),0K(V)A0K(V)K0K(V)O0K(VO(0K(VOF0K(VOS0K1,(10K1,(F0K1,(N0K1,(S0K1,(V0K1,F(0K1A(F0K1A(N0K1A(S0K1A(V0K1AF(0K1ASO0K1AVO0K1K(10K1K(F0K1K(N0K1K(S0K1K(V0K1K1O0K1K1U0K1KF(0K1KNU0K1KSO0K1KSU0K1KVO0K1KVU0K1O(10K1O(F0K1O(N0K1O(S0K1O(V0K1OF(0K1OS(0K1OS,0K1OS10K1OSA0K1OSF0K1OSK0K1OSV0K1OV(0K1OV,0K1OVA0K1OVF0K1OVK0K1OVO0K1OVS0KF(),0KF()A0KF()K0KF()O0KF(1)0KF(1O0KF(F(0KF(N)0KF(NO0KF(S)0KF(SO0KF(V)0KF(VO0KN,(10KN,(F0KN,(N0KN,(S0KN,(V0KN,F(0KNA(F0KNA(N0KNA(S0KNA(V0KNAF(0KNASO0KNAVO0KNK(10KNK(F0KNK(N0KNK(S0KNK(V0KNK1O0KNK1U0KNKF(0KNKNU0KNKSO0KNKSU0KNKVO0KNKVU0KS,(10KS,(F0KS,(N0KS,(S0KS,(V0KS,F(0KSA(F0KSA(N0KSA(S0KSA(V0KSAF(0KSASO0KSAVO0KSK(10KSK(F0KSK(N0KSK(S0KSK(V0KSK1O0KSK1U0KSKF(0KSKNU0KSKSO0KSKSU0KSKVO0KSKVU0KSO(10KSO(F0KSO(N0KSO(S0KSO(V0KSO1(0KSO1,0KSO1A0KSO1F0KSO1K0KSO1N0KSO1S0KSO1V0KSOF(0KSON(0KSON,0KSON10KSONA0KSONF0KSONK0KSOS(0KSOS,0KSOS10KSOSA0KSOSF0KSOSK0KSOSV0KSOV(0KSOV,0KSOVA0KSOVF0KSOVK0KSOVO0KSOVS0KV,(10KV,(F0KV,(N0KV,(S0KV,(V0KV,F(0KVA(F0KVA(N0KVA(S0KVA(V0KVAF(0KVASO0KVAVO0KVK(10KVK(F0KVK(N0KVK(S0KVK(V0KVK1O0KVK1U0KVKF(0KVKNU0KVKSO0KVKSU0KVKVO0KVKVU0KVO(10KVO(F0KVO(N0KVO(S0KVO(V0KVOF(0KVOS(0KVOS,0KVOS10KVOSA0KVOSF0KVOSK0KVOSV0N&(1&0N&(1)0N&(1,0N&(1O0N&(E(0N&(E10N&(EF0N&(EK0N&(EN0N&(EO0N&(ES0N&(EV0N&(F(0N&(N&0N&(N)0N&(N,0N&(NO0N&(S&0N&(S)0N&(S,0N&(SO0N&(V&0N&(V)0N&(V,0N&(VO0N&10N&1&(0N&1&10N&1&F0N&1&N0N&1&S0N&1&V0N&1)&0N&1)C0N&1)O0N&1)U0N&1;0N&1;C0N&1;E0N&1;T0N&1B(0N&1B10N&1BF0N&1BN0N&1BS0N&1BV0N&1C0N&1EK0N&1EN0N&1F(0N&1K(0N&1K10N&1KF0N&1KN0N&1KS0N&1KV0N&1O(0N&1OF0N&1OS0N&1OV0N&1TN0N&1U0N&1U(0N&1U;0N&1UC0N&1UE0N&E(10N&E(F0N&E(N0N&E(O0N&E(S0N&E(V0N&E10N&E1;0N&E1C0N&E1K0N&E1O0N&EF(0N&EK(0N&EK10N&EKF0N&EKN0N&EKS0N&EKV0N&EN;0N&ENC0N&ENK0N&ENO0N&ES0N&ES;0N&ESC0N&ESK0N&ESO0N&EV0N&EV;0N&EVC0N&EVK0N&EVO0N&F()0N&F(10N&F(E0N&F(F0N&F(N0N&F(S0N&F(V0N&K&(0N&K&10N&K&F0N&K&N0N&K&S0N&K&V0N&K(10N&K(F0N&K(N0N&K(S0N&K(V0N&K1O0N&KC0N&KF(0N&KNK0N&KO(0N&KO10N&KOF0N&KOK0N&KON0N&KOS0N&KOV0N&KSO0N&KVO0N&N&(0N&N&10N&N&F0N&N&S0N&N&V0N&N)&0N&N)C0N&N)O0N&N)U0N&N;C0N&N;E0N&N;T0N&NB(0N&NB10N&NBF0N&NBS0N&NBV0N&NF(0N&NK(0N&NK10N&NKF0N&NKS0N&NKV0N&NO(0N&NOF0N&NOS0N&NOV0N&NU0N&NU(0N&NU;0N&NUC0N&NUE0N&S&(0N&S&10N&S&F0N&S&N0N&S&S0N&S&V0N&S)&0N&S)C0N&S)O0N&S)U0N&S10N&S1;0N&S1C0N&S;0N&S;C0N&S;E0N&S;T0N&SB(0N&SB10N&SBF0N&SBN0N&SBS0N&SBV0N&SC0N&SEK0N&SEN0N&SF(0N&SK(0N&SK10N&SKF0N&SKN0N&SKS0N&SKV0N&SO(0N&SO10N&SOF0N&SON0N&SOS0N&SOV0N&STN0N&SU0N&SU(0N&SU;0N&SUC0N&SUE0N&SV0N&SV;0N&SVC0N&SVO0N&V0N&V&(0N&V&10N&V&F0N&V&N0N&V&S0N&V&V0N&V)&0N&V)C0N&V)O0N&V)U0N&V;0N&V;C0N&V;E0N&V;T0N&VB(0N&VB10N&VBF0N&VBN0N&VBS0N&VBV0N&VC0N&VEK0N&VEN0N&VF(0N&VK(0N&VK10N&VKF0N&VKN0N&VKS0N&VKV0N&VO(0N&VOF0N&VOS0N&VS0N&VS;0N&VSC0N&VSO0N&VTN0N&VU0N&VU(0N&VU;0N&VUC0N&VUE0N)&(10N)&(E0N)&(F0N)&(N0N)&(S0N)&(V0N)&10N)&1&0N)&1)0N)&1;0N)&1B0N)&1C0N)&1F0N)&1O0N)&1U0N)&F(0N)&N0N)&N&0N)&N)0N)&N;0N)&NB0N)&NC0N)&NF0N)&NO0N)&NU0N)&S0N)&S&0N)&S)0N)&S;0N)&SB0N)&SC0N)&SF0N)&SO0N)&SU0N)&V0N)&V&0N)&V)0N)&V;0N)&VB0N)&VC0N)&VF0N)&VO0N)&VU0N),(10N),(F0N),(N0N),(S0N),(V0N);E(0N);E10N);EF0N);EK0N);EN0N);EO0N);ES0N);EV0N);T(0N);T10N);TF0N);TK0N);TN0N);TO0N);TS0N);TV0N)B(10N)B(F0N)B(N0N)B(S0N)B(V0N)B10N)B1&0N)B1;0N)B1C0N)B1K0N)B1N0N)B1O0N)B1U0N)BF(0N)BN0N)BN&0N)BN;0N)BNC0N)BNK0N)BNO0N)BNU0N)BS0N)BS&0N)BS;0N)BSC0N)BSK0N)BSO0N)BSU0N)BV0N)BV&0N)BV;0N)BVC0N)BVK0N)BVO0N)BVU0N)E(10N)E(F0N)E(N0N)E(S0N)E(V0N)E1C0N)E1O0N)EF(0N)EK(0N)EK10N)EKF0N)EKN0N)EKS0N)EKV0N)ENC0N)ENO0N)ESC0N)ESO0N)EVC0N)EVO0N)F(F0N)K(10N)K(F0N)K(N0N)K(S0N)K(V0N)K1&0N)K1;0N)K1B0N)K1E0N)K1O0N)K1U0N)KB(0N)KB10N)KBF0N)KBN0N)KBS0N)KBV0N)KF(0N)KN&0N)KN;0N)KNB0N)KNC0N)KNE0N)KNK0N)KNU0N)KS&0N)KS;0N)KSB0N)KSE0N)KSO0N)KSU0N)KUE0N)KV&0N)KV;0N)KVB0N)KVE0N)KVO0N)KVU0N)O(10N)O(E0N)O(F0N)O(N0N)O(S0N)O(V0N)O1&0N)O1)0N)O1;0N)O1B0N)O1C0N)O1K0N)O1U0N)OF(0N)ON&0N)ON)0N)ON;0N)ONB0N)ONC0N)ONK0N)ONU0N)OS0N)OS&0N)OS)0N)OS;0N)OSB0N)OSC0N)OSK0N)OSU0N)OV0N)OV&0N)OV)0N)OV;0N)OVB0N)OVC0N)OVK0N)OVO0N)OVU0N)U(E0N)UE(0N)UE10N)UEF0N)UEK0N)UEN0N)UES0N)UEV0N,(1)0N,(1O0N,(E(0N,(E10N,(EF0N,(EK0N,(EN0N,(ES0N,(EV0N,(F(0N,(NO0N,(S)0N,(SO0N,(V)0N,(VO0N,F()0N,F(10N,F(F0N,F(N0N,F(S0N,F(V0N1O(10N1O(F0N1O(N0N1O(S0N1O(V0N1OF(0N1OS(0N1OS10N1OSF0N1OSU0N1OSV0N1OV(0N1OVF0N1OVO0N1OVS0N1OVU0N1S;0N1S;C0N1SC0N1UE0N1UE;0N1UEC0N1UEK0N1V;0N1V;C0N1VC0N1VO(0N1VOF0N1VOS0N;E(10N;E(E0N;E(F0N;E(N0N;E(S0N;E(V0N;E1,0N;E1;0N;E1C0N;E1K0N;E1O0N;E1T0N;EF(0N;EK(0N;EK10N;EKF0N;EKN0N;EKO0N;EKS0N;EKV0N;EN,0N;EN;0N;ENC0N;ENE0N;ENK0N;ENO0N;ENT0N;ES,0N;ES;0N;ESC0N;ESK0N;ESO0N;EST0N;EV,0N;EV;0N;EVC0N;EVK0N;EVO0N;EVT0N;N:T0N;T(10N;T(C0N;T(E0N;T(F0N;T(N0N;T(S0N;T(V0N;T1(0N;T1,0N;T1;0N;T1C0N;T1F0N;T1K0N;T1O0N;T1T0N;T;0N;T;C0N;TF(0N;TK(0N;TK10N;TKF0N;TKK0N;TKO0N;TKS0N;TKV0N;TN(0N;TN,0N;TN10N;TN;0N;TNC0N;TNE0N;TNF0N;TNK0N;TNN0N;TNO0N;TNS0N;TNT0N;TNV0N;TO(0N;TS(0N;TS,0N;TS;0N;TSC0N;TSF0N;TSK0N;TSO0N;TST0N;TTN0N;TV(0N;TV,0N;TV;0N;TVC0N;TVF0N;TVK0N;TVO0N;TVT0NA(F(0NA(N)0NA(NO0NA(S)0NA(SO0NA(V)0NA(VO0NAF()0NAF(10NAF(F0NAF(N0NAF(S0NAF(V0NASO(0NASO10NASOF0NASON0NASOS0NASOV0NASUE0NATO(0NATO10NATOF0NATON0NATOS0NATOV0NATUE0NAVO(0NAVOF0NAVOS0NAVUE0NB(1&0NB(1)0NB(1O0NB(F(0NB(N&0NB(NO0NB(S&0NB(S)0NB(SO0NB(V&0NB(V)0NB(VO0NB10NB1&(0NB1&10NB1&F0NB1&N0NB1&S0NB1&V0NB1,(0NB1,F0NB1;0NB1;C0NB1B(0NB1B10NB1BF0NB1BN0NB1BS0NB1BV0NB1C0NB1K(0NB1K10NB1KF0NB1KN0NB1KS0NB1KV0NB1O(0NB1OF0NB1OS0NB1OV0NB1U(0NB1UE0NBE(10NBE(F0NBE(N0NBE(S0NBE(V0NBEK(0NBF()0NBF(10NBF(F0NBF(N0NBF(S0NBF(V0NBN&(0NBN&10NBN&F0NBN&N0NBN&S0NBN&V0NBN,(0NBN,F0NBN;0NBN;C0NBNB(0NBNB10NBNBF0NBNBN0NBNBS0NBNBV0NBNC0NBNK(0NBNK10NBNKF0NBNKN0NBNKS0NBNKV0NBNO(0NBNOF0NBNOS0NBNOV0NBNU(0NBNUE0NBS0NBS&(0NBS&10NBS&F0NBS&N0NBS&S0NBS&V0NBS,(0NBS,F0NBS;0NBS;C0NBSB(0NBSB10NBSBF0NBSBN0NBSBS0NBSBV0NBSC0NBSK(0NBSK10NBSKF0NBSKN0NBSKS0NBSKV0NBSO(0NBSO10NBSOF0NBSON0NBSOS0NBSOV0NBSU(0NBSUE0NBV0NBV&(0NBV&10NBV&F0NBV&N0NBV&S0NBV&V0NBV,(0NBV,F0NBV;0NBV;C0NBVB(0NBVB10NBVBF0NBVBN0NBVBS0NBVBV0NBVC0NBVK(0NBVK10NBVKF0NBVKN0NBVKS0NBVKV0NBVO(0NBVOF0NBVOS0NBVU(0NBVUE0NC0NE(1)0NE(1O0NE(F(0NE(N)0NE(NO0NE(S)0NE(SO0NE(V)0NE(VO0NE1;T0NE1C0NE1O(0NE1OF0NE1OS0NE1OV0NE1T(0NE1T10NE1TF0NE1TN0NE1TS0NE1TV0NE1UE0NEF()0NEF(10NEF(F0NEF(N0NEF(S0NEF(V0NEN;T0NENO(0NENOF0NENOS0NENOV0NENT(0NENT10NENTF0NENTN0NENTS0NENTV0NENUE0NEOKN0NES;T0NESC0NESO(0NESO10NESOF0NESON0NESOS0NESOV0NEST(0NEST10NESTF0NESTN0NESTS0NESTV0NESUE0NEU(10NEU(F0NEU(N0NEU(S0NEU(V0NEU1,0NEU1C0NEU1O0NEUEF0NEUEK0NEUF(0NEUS,0NEUSC0NEUSO0NEUV,0NEUVC0NEUVO0NEV;T0NEVC0NEVO(0NEVOF0NEVOS0NEVT(0NEVT10NEVTF0NEVTN0NEVTS0NEVTV0NEVUE0NF()10NF()F0NF()K0NF()N0NF()O0NF()S0NF()U0NF()V0NF(1)0NF(1O0NF(E(0NF(E10NF(EF0NF(EK0NF(EN0NF(ES0NF(EV0NF(F(0NF(N,0NF(NO0NF(S)0NF(SO0NF(V)0NF(VO0NK(1)0NK(1O0NK(F(0NK(NO0NK(S)0NK(SO0NK(V)0NK(VO0NK)&(0NK)&10NK)&F0NK)&N0NK)&S0NK)&V0NK);E0NK);T0NK)B(0NK)B10NK)BF0NK)BN0NK)BS0NK)BV0NK)E(0NK)E10NK)EF0NK)EK0NK)EN0NK)ES0NK)EV0NK)F(0NK)O(0NK)OF0NK)UE0NK10NK1&(0NK1&10NK1&F0NK1&N0NK1&S0NK1&V0NK1;C0NK1;E0NK1;T0NK1B(0NK1B10NK1BF0NK1BN0NK1BS0NK1BV0NK1C0NK1E(0NK1E10NK1EF0NK1EK0NK1EN0NK1ES0NK1EV0NK1O(0NK1OF0NK1OS0NK1OV0NK1U(0NK1UE0NKF()0NKF(10NKF(F0NKF(N0NKF(S0NKF(V0NKN0NKN&(0NKN&10NKN&F0NKN&S0NKN&V0NKN;C0NKN;E0NKN;T0NKNB(0NKNB10NKNBF0NKNBN0NKNBS0NKNBV0NKNE(0NKNE10NKNEF0NKNES0NKNEV0NKNU(0NKNUE0NKS0NKS&(0NKS&10NKS&F0NKS&N0NKS&S0NKS&V0NKS;0NKS;C0NKS;E0NKS;T0NKSB(0NKSB10NKSBF0NKSBN0NKSBS0NKSBV0NKSC0NKSE(0NKSE10NKSEF0NKSEK0NKSEN0NKSES0NKSEV0NKSO(0NKSO10NKSOF0NKSON0NKSOS0NKSOV0NKSU(0NKSUE0NKUE(0NKUE10NKUEF0NKUEK0NKUEN0NKUES0NKUEV0NKV0NKV&(0NKV&10NKV&F0NKV&N0NKV&S0NKV&V0NKV;0NKV;C0NKV;E0NKV;T0NKVB(0NKVB10NKVBF0NKVBN0NKVBS0NKVBV0NKVC0NKVE(0NKVE10NKVEF0NKVEK0NKVEN0NKVES0NKVEV0NKVO(0NKVOF0NKVOS0NKVU(0NKVUE0NO(1&0NO(1)0NO(1,0NO(1O0NO(E(0NO(E10NO(EE0NO(EF0NO(EK0NO(EN0NO(EO0NO(ES0NO(EV0NO(F(0NO(N&0NO(N)0NO(N,0NO(NO0NO(S&0NO(S)0NO(S,0NO(SO0NO(V&0NO(V)0NO(V,0NO(VO0NOF()0NOF(10NOF(E0NOF(F0NOF(N0NOF(S0NOF(V0NOK&(0NOK(10NOK(F0NOK(N0NOK(S0NOK(V0NOK1C0NOK1O0NOKF(0NOKNC0NOKO(0NOKO10NOKOF0NOKON0NOKOS0NOKOV0NOKSC0NOKSO0NOKVC0NOKVO0NONSU0NOS&(0NOS&10NOS&E0NOS&F0NOS&K0NOS&N0NOS&S0NOS&U0NOS&V0NOS(E0NOS(U0NOS)&0NOS),0NOS);0NOS)B0NOS)C0NOS)E0NOS)F0NOS)K0NOS)O0NOS)U0NOS,(0NOS,F0NOS1(0NOS1F0NOS1N0NOS1S0NOS1U0NOS1V0NOS;0NOS;C0NOS;E0NOS;T0NOSA(0NOSAF0NOSAS0NOSAT0NOSAV0NOSB(0NOSB10NOSBE0NOSBF0NOSBN0NOSBS0NOSBV0NOSC0NOSE(0NOSE10NOSEF0NOSEK0NOSEN0NOSEO0NOSES0NOSEU0NOSEV0NOSF(0NOSK(0NOSK)0NOSK10NOSKB0NOSKF0NOSKN0NOSKS0NOSKU0NOSKV0NOST(0NOST10NOSTE0NOSTF0NOSTN0NOSTS0NOSTT0NOSTV0NOSU0NOSU(0NOSU10NOSU;0NOSUC0NOSUE0NOSUF0NOSUK0NOSUO0NOSUS0NOSUT0NOSUV0NOSV(0NOSVF0NOSVO0NOSVS0NOSVU0NOU(E0NOUEK0NOUEN0NOV&(0NOV&10NOV&E0NOV&F0NOV&K0NOV&N0NOV&S0NOV&U0NOV&V0NOV(E0NOV(U0NOV)&0NOV),0NOV);0NOV)B0NOV)C0NOV)E0NOV)F0NOV)K0NOV)O0NOV)U0NOV,(0NOV,F0NOV;0NOV;C0NOV;E0NOV;N0NOV;T0NOVA(0NOVAF0NOVAS0NOVAT0NOVAV0NOVB(0NOVB10NOVBE0NOVBF0NOVBN0NOVBS0NOVBV0NOVC0NOVE(0NOVE10NOVEF0NOVEK0NOVEN0NOVEO0NOVES0NOVEU0NOVEV0NOVF(0NOVK(0NOVK)0NOVK10NOVKB0NOVKF0NOVKN0NOVKS0NOVKU0NOVKV0NOVO(0NOVOF0NOVOK0NOVOS0NOVOU0NOVS(0NOVS10NOVSF0NOVSO0NOVSU0NOVSV0NOVT(0NOVT10NOVTE0NOVTF0NOVTN0NOVTS0NOVTT0NOVTV0NOVU0NOVU(0NOVU10NOVU;0NOVUC0NOVUE0NOVUF0NOVUK0NOVUO0NOVUS0NOVUT0NOVUV0NSO1U0NSONU0NSOSU0NSOVU0NSUE0NSUE;0NSUEC0NSUEK0NT(1)0NT(1O0NT(F(0NT(N)0NT(NO0NT(S)0NT(SO0NT(V)0NT(VO0NT1(F0NT1O(0NT1OF0NT1OS0NT1OV0NTE(10NTE(F0NTE(N0NTE(S0NTE(V0NTE1N0NTE1O0NTEF(0NTEK(0NTEK10NTEKF0NTEKN0NTEKS0NTEKV0NTENN0NTENO0NTESN0NTESO0NTEVN0NTEVO0NTF()0NTF(10NTF(F0NTF(N0NTF(S0NTF(V0NTN(10NTN(F0NTN(S0NTN(V0NTN1C0NTN1O0NTN;E0NTN;N0NTN;T0NTNE(0NTNE10NTNEF0NTNEN0NTNES0NTNEV0NTNF(0NTNKN0NTNN:0NTNNC0NTNNO0NTNO(0NTNOF0NTNOS0NTNOV0NTNSC0NTNSO0NTNT(0NTNT10NTNTF0NTNTN0NTNTS0NTNTV0NTNVC0NTNVO0NTS(F0NTSO(0NTSO10NTSOF0NTSON0NTSOS0NTSOV0NTTNE0NTTNK0NTTNN0NTTNT0NTV(10NTV(F0NTVO(0NTVOF0NTVOS0NU(1)0NU(1O0NU(E(0NU(E10NU(EF0NU(EK0NU(EN0NU(ES0NU(EV0NU(F(0NU(N)0NU(NO0NU(S)0NU(SO0NU(V)0NU(VO0NU1,(0NU1,F0NU1C0NU1O(0NU1OF0NU1OS0NU1OV0NU;0NU;C0NUC0NUE0NUE(10NUE(E0NUE(F0NUE(N0NUE(O0NUE(S0NUE(V0NUE10NUE1&0NUE1(0NUE1)0NUE1,0NUE1;0NUE1B0NUE1C0NUE1F0NUE1K0NUE1N0NUE1O0NUE1S0NUE1U0NUE1V0NUE;0NUE;C0NUEC0NUEF0NUEF(0NUEF,0NUEF;0NUEFC0NUEK0NUEK(0NUEK10NUEK;0NUEKC0NUEKF0NUEKN0NUEKO0NUEKS0NUEKV0NUEN0NUEN&0NUEN(0NUEN)0NUEN,0NUEN10NUEN;0NUENB0NUENC0NUENF0NUENK0NUENO0NUENS0NUENU0NUEOK0NUEON0NUES0NUES&0NUES(0NUES)0NUES,0NUES10NUES;0NUESB0NUESC0NUESF0NUESK0NUESO0NUESU0NUESV0NUEV0NUEV&0NUEV(0NUEV)0NUEV,0NUEV;0NUEVB0NUEVC0NUEVF0NUEVK0NUEVN0NUEVO0NUEVS0NUEVU0NUF()0NUF(10NUF(F0NUF(N0NUF(S0NUF(V0NUK(E0NUO(E0NUON(0NUON10NUONF0NUONS0NUS,(0NUS,F0NUSC0NUSO(0NUSO10NUSOF0NUSON0NUSOS0NUSOV0NUTN(0NUTN10NUTNF0NUTNN0NUTNS0NUTNV0NUV,(0NUV,F0NUVC0NUVO(0NUVOF0NUVOS0S&(1&0S&(1)0S&(1,0S&(1O0S&(E(0S&(E10S&(EF0S&(EK0S&(EN0S&(EO0S&(ES0S&(EV0S&(F(0S&(N&0S&(N)0S&(N,0S&(NO0S&(S&0S&(S)0S&(S,0S&(SO0S&(V&0S&(V)0S&(V,0S&(VO0S&10S&1&(0S&1&10S&1&F0S&1&N0S&1&S0S&1&V0S&1)&0S&1)C0S&1)O0S&1)U0S&1;0S&1;C0S&1;E0S&1;T0S&1B(0S&1B10S&1BF0S&1BN0S&1BS0S&1BV0S&1C0S&1EK0S&1EN0S&1F(0S&1K(0S&1K10S&1KF0S&1KN0S&1KS0S&1KV0S&1O(0S&1OF0S&1OS0S&1OV0S&1TN0S&1U0S&1U(0S&1U;0S&1UC0S&1UE0S&E(10S&E(F0S&E(N0S&E(O0S&E(S0S&E(V0S&E10S&E1;0S&E1C0S&E1K0S&E1O0S&EF(0S&EK(0S&EK10S&EKF0S&EKN0S&EKS0S&EKV0S&EN0S&EN;0S&ENC0S&ENK0S&ENO0S&ES0S&ES;0S&ESC0S&ESK0S&ESO0S&EV0S&EV;0S&EVC0S&EVK0S&EVO0S&F()0S&F(10S&F(E0S&F(F0S&F(N0S&F(S0S&F(V0S&K&(0S&K&10S&K&F0S&K&N0S&K&S0S&K&V0S&K(10S&K(F0S&K(N0S&K(S0S&K(V0S&K1O0S&KC0S&KF(0S&KNK0S&KO(0S&KO10S&KOF0S&KOK0S&KON0S&KOS0S&KOV0S&KSO0S&KVO0S&N0S&N&(0S&N&10S&N&F0S&N&N0S&N&S0S&N&V0S&N)&0S&N)C0S&N)O0S&N)U0S&N;0S&N;C0S&N;E0S&N;T0S&NB(0S&NB10S&NBF0S&NBN0S&NBS0S&NBV0S&NC0S&NEN0S&NF(0S&NK(0S&NK10S&NKF0S&NKN0S&NKS0S&NKV0S&NO(0S&NOF0S&NOS0S&NOV0S&NTN0S&NU0S&NU(0S&NU;0S&NUC0S&NUE0S&S0S&S&(0S&S&10S&S&F0S&S&N0S&S&S0S&S&V0S&S)&0S&S)C0S&S)O0S&S)U0S&S10S&S1;0S&S1C0S&S;0S&S;C0S&S;E0S&S;T0S&SB(0S&SB10S&SBF0S&SBN0S&SBS0S&SBV0S&SC0S&SEK0S&SEN0S&SF(0S&SK(0S&SK10S&SKF0S&SKN0S&SKS0S&SKV0S&SO(0S&SO10S&SOF0S&SON0S&SOS0S&SOV0S&STN0S&SU0S&SU(0S&SU;0S&SUC0S&SUE0S&SV0S&SV;0S&SVC0S&SVO0S&V0S&V&(0S&V&10S&V&F0S&V&N0S&V&S0S&V&V0S&V)&0S&V)C0S&V)O0S&V)U0S&V;0S&V;C0S&V;E0S&V;T0S&VB(0S&VB10S&VBF0S&VBN0S&VBS0S&VBV0S&VC0S&VEK0S&VEN0S&VF(0S&VK(0S&VK10S&VKF0S&VKN0S&VKS0S&VKV0S&VO(0S&VOF0S&VOS0S&VS0S&VS;0S&VSC0S&VSO0S&VTN0S&VU0S&VU(0S&VU;0S&VUC0S&VUE0S(EF(0S(EKF0S(EKN0S(ENK0S(U(E0S)&(10S)&(E0S)&(F0S)&(N0S)&(S0S)&(V0S)&10S)&1&0S)&1)0S)&1;0S)&1B0S)&1C0S)&1F0S)&1O0S)&1U0S)&F(0S)&N0S)&N&0S)&N)0S)&N;0S)&NB0S)&NC0S)&NF0S)&NO0S)&NU0S)&S0S)&S&0S)&S)0S)&S;0S)&SB0S)&SC0S)&SF0S)&SO0S)&SU0S)&V0S)&V&0S)&V)0S)&V;0S)&VB0S)&VC0S)&VF0S)&VO0S)&VU0S),(10S),(F0S),(N0S),(S0S),(V0S);E(0S);E10S);EF0S);EK0S);EN0S);EO0S);ES0S);EV0S);T(0S);T10S);TF0S);TK0S);TN0S);TO0S);TS0S);TV0S)B(10S)B(F0S)B(N0S)B(S0S)B(V0S)B10S)B1&0S)B1;0S)B1C0S)B1K0S)B1N0S)B1O0S)B1U0S)BF(0S)BN0S)BN&0S)BN;0S)BNC0S)BNK0S)BNO0S)BNU0S)BS0S)BS&0S)BS;0S)BSC0S)BSK0S)BSO0S)BSU0S)BV0S)BV&0S)BV;0S)BVC0S)BVK0S)BVO0S)BVU0S)C0S)E(10S)E(F0S)E(N0S)E(S0S)E(V0S)E1C0S)E1O0S)EF(0S)EK(0S)EK10S)EKF0S)EKN0S)EKS0S)EKV0S)ENC0S)ENO0S)ESC0S)ESO0S)EVC0S)EVO0S)F(F0S)K(10S)K(F0S)K(N0S)K(S0S)K(V0S)K1&0S)K1;0S)K1B0S)K1E0S)K1O0S)K1U0S)KB(0S)KB10S)KBF0S)KBN0S)KBS0S)KBV0S)KF(0S)KN&0S)KN;0S)KNB0S)KNC0S)KNE0S)KNK0S)KNU0S)KS&0S)KS;0S)KSB0S)KSE0S)KSO0S)KSU0S)KUE0S)KV&0S)KV;0S)KVB0S)KVE0S)KVO0S)KVU0S)O(10S)O(E0S)O(F0S)O(N0S)O(S0S)O(V0S)O10S)O1&0S)O1)0S)O1;0S)O1B0S)O1C0S)O1K0S)O1U0S)OF(0S)ON&0S)ON)0S)ON;0S)ONB0S)ONC0S)ONK0S)ONU0S)OS0S)OS&0S)OS)0S)OS;0S)OSB0S)OSC0S)OSK0S)OSU0S)OV0S)OV&0S)OV)0S)OV;0S)OVB0S)OVC0S)OVK0S)OVO0S)OVU0S)U(E0S)UE(0S)UE10S)UEF0S)UEK0S)UEN0S)UES0S)UEV0S,(1)0S,(1O0S,(E(0S,(E10S,(EF0S,(EK0S,(EN0S,(ES0S,(EV0S,(F(0S,(N)0S,(NO0S,(S)0S,(SO0S,(V)0S,(VO0S,F()0S,F(10S,F(F0S,F(N0S,F(S0S,F(V0S1F()0S1F(10S1F(F0S1F(N0S1F(S0S1F(V0S1NC0S1S;0S1S;C0S1SC0S1UE0S1UE;0S1UEC0S1UEK0S1V0S1V;0S1V;C0S1VC0S1VO(0S1VOF0S1VOS0S;E(10S;E(E0S;E(F0S;E(N0S;E(S0S;E(V0S;E1,0S;E1;0S;E1C0S;E1K0S;E1O0S;E1T0S;EF(0S;EK(0S;EK10S;EKF0S;EKN0S;EKO0S;EKS0S;EKV0S;EN,0S;EN;0S;ENC0S;ENE0S;ENK0S;ENO0S;ENT0S;ES,0S;ES;0S;ESC0S;ESK0S;ESO0S;EST0S;EV,0S;EV;0S;EVC0S;EVK0S;EVO0S;EVT0S;N:T0S;T(10S;T(C0S;T(E0S;T(F0S;T(N0S;T(S0S;T(V0S;T1(0S;T1,0S;T1;0S;T1C0S;T1F0S;T1K0S;T1O0S;T1T0S;T;0S;T;C0S;TF(0S;TK(0S;TK10S;TKF0S;TKK0S;TKN0S;TKO0S;TKS0S;TKV0S;TN(0S;TN,0S;TN10S;TN;0S;TNC0S;TNE0S;TNF0S;TNK0S;TNN0S;TNO0S;TNS0S;TNT0S;TNV0S;TO(0S;TS(0S;TS,0S;TS;0S;TSC0S;TSF0S;TSK0S;TSO0S;TST0S;TTN0S;TV(0S;TV,0S;TV;0S;TVC0S;TVF0S;TVK0S;TVO0S;TVT0SA(F(0SA(N)0SA(NO0SA(S)0SA(SO0SA(V)0SA(VO0SAF()0SAF(10SAF(F0SAF(N0SAF(S0SAF(V0SASO(0SASO10SASOF0SASON0SASOS0SASOV0SASUE0SATO(0SATO10SATOF0SATON0SATOS0SATOV0SATUE0SAVO(0SAVOF0SAVOS0SAVUE0SB(1)0SB(1O0SB(F(0SB(NO0SB(S)0SB(SO0SB(V)0SB(VO0SB10SB1&(0SB1&10SB1&F0SB1&N0SB1&S0SB1&V0SB1,(0SB1,F0SB1;0SB1;C0SB1B(0SB1B10SB1BF0SB1BN0SB1BS0SB1BV0SB1C0SB1K(0SB1K10SB1KF0SB1KN0SB1KS0SB1KV0SB1O(0SB1OF0SB1OS0SB1OV0SB1U(0SB1UE0SBE(10SBE(F0SBE(N0SBE(S0SBE(V0SBEK(0SBF()0SBF(10SBF(F0SBF(N0SBF(S0SBF(V0SBN0SBN&(0SBN&10SBN&F0SBN&N0SBN&S0SBN&V0SBN,(0SBN,F0SBN;0SBN;C0SBNB(0SBNB10SBNBF0SBNBN0SBNBS0SBNBV0SBNC0SBNK(0SBNK10SBNKF0SBNKN0SBNKS0SBNKV0SBNO(0SBNOF0SBNOS0SBNOV0SBNU(0SBNUE0SBS0SBS&(0SBS&10SBS&F0SBS&N0SBS&S0SBS&V0SBS,(0SBS,F0SBS;0SBS;C0SBSB(0SBSB10SBSBF0SBSBN0SBSBS0SBSBV0SBSC0SBSK(0SBSK10SBSKF0SBSKN0SBSKS0SBSKV0SBSO(0SBSO10SBSOF0SBSON0SBSOS0SBSOV0SBSU(0SBSUE0SBV0SBV&(0SBV&10SBV&F0SBV&N0SBV&S0SBV&V0SBV,(0SBV,F0SBV;0SBV;C0SBVB(0SBVB10SBVBF0SBVBN0SBVBS0SBVBV0SBVC0SBVK(0SBVK10SBVKF0SBVKN0SBVKS0SBVKV0SBVO(0SBVOF0SBVOS0SBVU(0SBVUE0SC0SE(1)0SE(1O0SE(F(0SE(N)0SE(NO0SE(S)0SE(SO0SE(V)0SE(VO0SE1;T0SE1C0SE1O(0SE1OF0SE1OS0SE1OV0SE1T(0SE1T10SE1TF0SE1TN0SE1TS0SE1TV0SE1UE0SEF()0SEF(10SEF(F0SEF(N0SEF(S0SEF(V0SEK(10SEK(E0SEK(F0SEK(N0SEK(S0SEK(V0SEK1;0SEK1C0SEK1O0SEK1T0SEK1U0SEKF(0SEKN;0SEKNC0SEKNE0SEKNT0SEKNU0SEKOK0SEKS;0SEKSC0SEKSO0SEKST0SEKSU0SEKU(0SEKU10SEKUE0SEKUF0SEKUS0SEKUV0SEKV;0SEKVC0SEKVO0SEKVT0SEKVU0SEN;T0SENC0SENEN0SENO(0SENOF0SENOS0SENOV0SENT(0SENT10SENTF0SENTN0SENTS0SENTV0SENUE0SEOKN0SES;T0SESC0SESO(0SESO10SESOF0SESON0SESOS0SESOV0SEST(0SEST10SESTF0SESTN0SESTS0SESTV0SESUE0SEU(10SEU(F0SEU(N0SEU(S0SEU(V0SEU1,0SEU1C0SEU1O0SEUEF0SEUEK0SEUF(0SEUS,0SEUSC0SEUSO0SEUV,0SEUVC0SEUVO0SEV;T0SEVC0SEVO(0SEVOF0SEVOS0SEVT(0SEVT10SEVTF0SEVTN0SEVTS0SEVTV0SEVUE0SF()10SF()F0SF()K0SF()N0SF()O0SF()S0SF()U0SF()V0SF(1)0SF(1N0SF(1O0SF(E(0SF(E10SF(EF0SF(EK0SF(EN0SF(ES0SF(EV0SF(F(0SF(N)0SF(N,0SF(NO0SF(S)0SF(SO0SF(V)0SF(VO0SK(1)0SK(1O0SK(F(0SK(N)0SK(NO0SK(S)0SK(SO0SK(V)0SK(VO0SK)&(0SK)&10SK)&F0SK)&N0SK)&S0SK)&V0SK);E0SK);T0SK)B(0SK)B10SK)BF0SK)BN0SK)BS0SK)BV0SK)E(0SK)E10SK)EF0SK)EK0SK)EN0SK)ES0SK)EV0SK)F(0SK)O(0SK)OF0SK)UE0SK10SK1&(0SK1&10SK1&F0SK1&N0SK1&S0SK1&V0SK1;0SK1;C0SK1;E0SK1;T0SK1B(0SK1B10SK1BF0SK1BN0SK1BS0SK1BV0SK1C0SK1E(0SK1E10SK1EF0SK1EK0SK1EN0SK1ES0SK1EV0SK1O(0SK1OF0SK1OS0SK1OV0SK1U(0SK1UE0SKF()0SKF(10SKF(F0SKF(N0SKF(S0SKF(V0SKN0SKN&(0SKN&10SKN&F0SKN&N0SKN&S0SKN&V0SKN;0SKN;C0SKN;E0SKN;T0SKNB(0SKNB10SKNBF0SKNBN0SKNBS0SKNBV0SKNC0SKNE(0SKNE10SKNEF0SKNEN0SKNES0SKNEV0SKNU(0SKNUE0SKS0SKS&(0SKS&10SKS&F0SKS&N0SKS&S0SKS&V0SKS;0SKS;C0SKS;E0SKS;T0SKSB(0SKSB10SKSBF0SKSBN0SKSBS0SKSBV0SKSC0SKSE(0SKSE10SKSEF0SKSEK0SKSEN0SKSES0SKSEV0SKSO(0SKSO10SKSOF0SKSON0SKSOS0SKSOV0SKSU(0SKSUE0SKUE(0SKUE10SKUEF0SKUEK0SKUEN0SKUES0SKUEV0SKV0SKV&(0SKV&10SKV&F0SKV&N0SKV&S0SKV&V0SKV;0SKV;C0SKV;E0SKV;T0SKVB(0SKVB10SKVBF0SKVBN0SKVBS0SKVBV0SKVC0SKVE(0SKVE10SKVEF0SKVEK0SKVEN0SKVES0SKVEV0SKVO(0SKVOF0SKVOS0SKVU(0SKVUE0SO(1&0SO(1)0SO(1,0SO(1O0SO(E(0SO(E10SO(EE0SO(EF0SO(EK0SO(EN0SO(EO0SO(ES0SO(EV0SO(F(0SO(N&0SO(N)0SO(N,0SO(NO0SO(S&0SO(S)0SO(S,0SO(SO0SO(V&0SO(V)0SO(V,0SO(VO0SO1&(0SO1&10SO1&E0SO1&F0SO1&K0SO1&N0SO1&S0SO1&U0SO1&V0SO1(E0SO1(U0SO1)&0SO1),0SO1);0SO1)B0SO1)C0SO1)E0SO1)F0SO1)K0SO1)O0SO1)U0SO1,(0SO1,F0SO1;0SO1;C0SO1;E0SO1;N0SO1;T0SO1A(0SO1AF0SO1AS0SO1AT0SO1AV0SO1B(0SO1B10SO1BE0SO1BF0SO1BN0SO1BS0SO1BV0SO1C0SO1E(0SO1E10SO1EF0SO1EK0SO1EN0SO1EO0SO1ES0SO1EU0SO1EV0SO1F(0SO1K(0SO1K)0SO1K10SO1KB0SO1KF0SO1KN0SO1KS0SO1KU0SO1KV0SO1N&0SO1N(0SO1N,0SO1NE0SO1NU0SO1SU0SO1SV0SO1T(0SO1T10SO1TE0SO1TF0SO1TN0SO1TS0SO1TT0SO1TV0SO1U0SO1U(0SO1U10SO1U;0SO1UC0SO1UE0SO1UF0SO1UK0SO1UO0SO1US0SO1UT0SO1UV0SO1V(0SO1VF0SO1VO0SO1VS0SO1VU0SOF()0SOF(10SOF(E0SOF(F0SOF(N0SOF(S0SOF(V0SOK&(0SOK&10SOK&F0SOK&N0SOK&S0SOK&V0SOK(10SOK(F0SOK(N0SOK(S0SOK(V0SOK1C0SOK1O0SOKF(0SOKNC0SOKO(0SOKO10SOKOF0SOKON0SOKOS0SOKOV0SOKSC0SOKSO0SOKVC0SOKVO0SON&(0SON&10SON&E0SON&F0SON&K0SON&N0SON&S0SON&U0SON&V0SON(10SON(E0SON(F0SON(S0SON(U0SON(V0SON)&0SON),0SON);0SON)B0SON)C0SON)E0SON)F0SON)K0SON)O0SON)U0SON,(0SON,F0SON1(0SON1O0SON1U0SON1V0SON;0SON;C0SON;E0SON;N0SON;T0SONA(0SONAF0SONAS0SONAT0SONAV0SONB(0SONB10SONBE0SONBF0SONBN0SONBS0SONBV0SONE(0SONE10SONEF0SONEN0SONEO0SONES0SONEU0SONEV0SONF(0SONK(0SONK)0SONK10SONKB0SONKF0SONKS0SONKU0SONKV0SONSU0SONT(0SONT10SONTE0SONTF0SONTN0SONTS0SONTT0SONTV0SONU0SONU(0SONU10SONU;0SONUC0SONUE0SONUF0SONUK0SONUO0SONUS0SONUT0SONUV0SOS0SOS&(0SOS&10SOS&E0SOS&F0SOS&K0SOS&N0SOS&S0SOS&U0SOS&V0SOS(E0SOS(U0SOS)&0SOS),0SOS);0SOS)B0SOS)C0SOS)E0SOS)F0SOS)K0SOS)O0SOS)U0SOS,(0SOS,F0SOS1(0SOS1F0SOS1N0SOS1S0SOS1U0SOS1V0SOS;0SOS;C0SOS;E0SOS;N0SOS;T0SOSA(0SOSAF0SOSAS0SOSAT0SOSAV0SOSB(0SOSB10SOSBE0SOSBF0SOSBN0SOSBS0SOSBV0SOSC0SOSE(0SOSE10SOSEF0SOSEK0SOSEN0SOSEO0SOSES0SOSEU0SOSEV0SOSF(0SOSK(0SOSK)0SOSK10SOSKB0SOSKF0SOSKN0SOSKS0SOSKU0SOSKV0SOST(0SOST10SOSTE0SOSTF0SOSTN0SOSTS0SOSTT0SOSTV0SOSU0SOSU(0SOSU10SOSU;0SOSUC0SOSUE0SOSUF0SOSUK0SOSUO0SOSUS0SOSUT0SOSUV0SOSV(0SOSVF0SOSVO0SOSVS0SOSVU0SOU(E0SOUEK0SOUEN0SOV0SOV&(0SOV&10SOV&E0SOV&F0SOV&K0SOV&N0SOV&S0SOV&U0SOV&V0SOV(E0SOV(U0SOV)&0SOV),0SOV);0SOV)B0SOV)C0SOV)E0SOV)F0SOV)K0SOV)O0SOV)U0SOV,(0SOV,F0SOV;0SOV;C0SOV;E0SOV;N0SOV;T0SOVA(0SOVAF0SOVAS0SOVAT0SOVAV0SOVB(0SOVB10SOVBE0SOVBF0SOVBN0SOVBS0SOVBV0SOVC0SOVE(0SOVE10SOVEF0SOVEK0SOVEN0SOVEO0SOVES0SOVEU0SOVEV0SOVF(0SOVK(0SOVK)0SOVK10SOVKB0SOVKF0SOVKN0SOVKS0SOVKU0SOVKV0SOVO(0SOVOF0SOVOK0SOVOS0SOVOU0SOVS(0SOVS10SOVSF0SOVSO0SOVSU0SOVSV0SOVT(0SOVT10SOVTE0SOVTF0SOVTN0SOVTS0SOVTT0SOVTV0SOVU0SOVU(0SOVU10SOVU;0SOVUC0SOVUE0SOVUF0SOVUK0SOVUO0SOVUS0SOVUT0SOVUV0ST(1)0ST(1O0ST(F(0ST(N)0ST(NO0ST(S)0ST(SO0ST(V)0ST(VO0ST1(F0ST1O(0ST1OF0ST1OS0ST1OV0STE(10STE(F0STE(N0STE(S0STE(V0STE1N0STE1O0STEF(0STEK(0STEK10STEKF0STEKN0STEKS0STEKV0STENN0STENO0STESN0STESO0STEVN0STEVO0STF()0STF(10STF(F0STF(N0STF(S0STF(V0STN(10STN(F0STN(S0STN(V0STN1C0STN1O0STN;E0STN;N0STN;T0STNE(0STNE10STNEF0STNEN0STNES0STNEV0STNF(0STNKN0STNN:0STNNC0STNNO0STNO(0STNOF0STNOS0STNOV0STNSC0STNSO0STNT(0STNT10STNTF0STNTN0STNTS0STNTV0STNVC0STNVO0STS(F0STSO(0STSO10STSOF0STSON0STSOS0STSOV0STTNE0STTNK0STTNN0STTNT0STV(10STV(F0STVO(0STVOF0STVOS0SU(1)0SU(1O0SU(E(0SU(E10SU(EF0SU(EK0SU(EN0SU(ES0SU(EV0SU(F(0SU(N)0SU(NO0SU(S)0SU(SO0SU(V)0SU(VO0SU1,(0SU1,F0SU1C0SU1O(0SU1OF0SU1OS0SU1OV0SU;0SU;C0SUC0SUE0SUE(10SUE(E0SUE(F0SUE(N0SUE(O0SUE(S0SUE(V0SUE10SUE1&0SUE1(0SUE1)0SUE1,0SUE1;0SUE1B0SUE1C0SUE1F0SUE1K0SUE1N0SUE1O0SUE1S0SUE1U0SUE1V0SUE;0SUE;C0SUEC0SUEF0SUEF(0SUEF,0SUEF;0SUEFC0SUEK0SUEK(0SUEK10SUEK;0SUEKC0SUEKF0SUEKN0SUEKO0SUEKS0SUEKV0SUEN0SUEN&0SUEN(0SUEN)0SUEN,0SUEN10SUEN;0SUENB0SUENC0SUENF0SUENK0SUENO0SUENS0SUENU0SUEOK0SUEON0SUES0SUES&0SUES(0SUES)0SUES,0SUES10SUES;0SUESB0SUESC0SUESF0SUESK0SUESO0SUESU0SUESV0SUEV0SUEV&0SUEV(0SUEV)0SUEV,0SUEV;0SUEVB0SUEVC0SUEVF0SUEVK0SUEVN0SUEVO0SUEVS0SUEVU0SUF()0SUF(10SUF(F0SUF(N0SUF(S0SUF(V0SUK(E0SUO(E0SUON(0SUON10SUONF0SUONS0SUS,(0SUS,F0SUSC0SUSO(0SUSO10SUSOF0SUSON0SUSOS0SUSOV0SUTN(0SUTN10SUTNF0SUTNN0SUTNS0SUTNV0SUV,(0SUV,F0SUVC0SUVO(0SUVOF0SUVOS0SVF()0SVF(10SVF(F0SVF(N0SVF(S0SVF(V0SVO(10SVO(F0SVO(N0SVO(S0SVO(V0SVOF(0SVOS(0SVOS10SVOSF0SVOSU0SVOSV0SVS;0SVS;C0SVSC0SVSO(0SVSO10SVSOF0SVSON0SVSOS0SVSOV0SVUE0SVUE;0SVUEC0SVUEK0T(1)F0T(1)O0T(1F(0T(1N)0T(1O(0T(1OF0T(1OS0T(1OV0T(1S)0T(1V)0T(1VO0T(F()0T(F(10T(F(F0T(F(N0T(F(S0T(F(V0T(N(10T(N(F0T(N(S0T(N(V0T(N)F0T(N)O0T(N1)0T(N1O0T(NF(0T(NN)0T(NNO0T(NO(0T(NOF0T(NOS0T(NOV0T(NS)0T(NSO0T(NV)0T(NVO0T(S)F0T(S)O0T(S1)0T(SF(0T(SN)0T(SNO0T(SO(0T(SO10T(SOF0T(SON0T(SOS0T(SOV0T(SV)0T(SVO0T(V)F0T(V)O0T(VF(0T(VO(0T(VOF0T(VOS0T(VS)0T(VSO0T(VV)0T1F(10T1F(F0T1F(N0T1F(S0T1F(V0T1O(10T1O(F0T1O(N0T1O(S0T1O(V0T1OF(0T1OSF0T1OVF0T1OVO0TF()F0TF()O0TF(1)0TF(1O0TF(F(0TF(N)0TF(NO0TF(S)0TF(SO0TF(V)0TF(VO0TN(1)0TN(1O0TN(F(0TN(S)0TN(SO0TN(V)0TN(VO0TN1;0TN1;C0TN1O(0TN1OF0TN1OS0TN1OV0TNF()0TNF(10TNF(F0TNF(N0TNF(S0TNF(V0TNN;0TNN;C0TNNO(0TNNOF0TNNOS0TNNOV0TNO(10TNO(F0TNO(N0TNO(S0TNO(V0TNOF(0TNOSF0TNOVF0TNOVO0TNS;0TNS;C0TNSO(0TNSO10TNSOF0TNSON0TNSOS0TNSOV0TNV;0TNV;C0TNVO(0TNVOF0TNVOS0TSF(10TSF(F0TSF(N0TSF(S0TSF(V0TSO(10TSO(F0TSO(N0TSO(S0TSO(V0TSO1F0TSOF(0TSONF0TSOSF0TSOVF0TSOVO0TVF(10TVF(F0TVF(N0TVF(S0TVF(V0TVO(10TVO(F0TVO(N0TVO(S0TVO(V0TVOF(0TVOSF0U(E(10U(E(F0U(E(K0U(E(N0U(E(S0U(E(V0U(E1)0U(E1O0U(EF(0U(EK(0U(EK10U(EKF0U(EKN0U(EKO0U(EKS0U(EKV0U(EN)0U(ENK0U(ENO0U(EOK0U(ES)0U(ESO0U(EV)0U(EVO0UE(1)0UE(1,0UE(1O0UE(F(0UE(N)0UE(N,0UE(NO0UE(S)0UE(S,0UE(SO0UE(V)0UE(V,0UE(VO0UE10UE1,(0UE1,F0UE1;0UE1;C0UE1C0UE1K(0UE1K10UE1KF0UE1KN0UE1KS0UE1KV0UE1O(0UE1OF0UE1OS0UE1OV0UEF()0UEF(10UEF(F0UEF(N0UEF(S0UEF(V0UEK(10UEK(F0UEK(N0UEK(S0UEK(V0UEK10UEK1,0UEK1;0UEK1C0UEK1K0UEK1O0UEKF(0UEKN0UEKN(0UEKN,0UEKN;0UEKNC0UEKNK0UEKS0UEKS,0UEKS;0UEKSC0UEKSK0UEKSO0UEKV0UEKV,0UEKV;0UEKVC0UEKVK0UEKVO0UEN()0UEN,(0UEN,F0UEN;0UEN;C0UENC0UENK(0UENK10UENKF0UENKN0UENKS0UENKV0UENO(0UENOF0UENOS0UENOV0UES0UES,(0UES,F0UES;0UES;C0UESC0UESK(0UESK10UESKF0UESKN0UESKS0UESKV0UESO(0UESO10UESOF0UESON0UESOS0UESOV0UEV0UEV,(0UEV,F0UEV;0UEV;C0UEVC0UEVK(0UEVK10UEVKF0UEVKN0UEVKS0UEVKV0UEVO(0UEVOF0UEVOS0UF(1O0UF(F(0UF(NO0UF(SO0UF(VO0V&(1&0V&(1)0V&(1,0V&(1O0V&(E(0V&(E10V&(EF0V&(EK0V&(EN0V&(EO0V&(ES0V&(EV0V&(F(0V&(N&0V&(N)0V&(N,0V&(NO0V&(S&0V&(S)0V&(S,0V&(SO0V&(V&0V&(V)0V&(V,0V&(VO0V&10V&1&(0V&1&10V&1&F0V&1&N0V&1&S0V&1&V0V&1)&0V&1)C0V&1)O0V&1)U0V&1;0V&1;C0V&1;E0V&1;T0V&1B(0V&1B10V&1BF0V&1BN0V&1BS0V&1BV0V&1C0V&1EK0V&1EN0V&1F(0V&1K(0V&1K10V&1KF0V&1KN0V&1KS0V&1KV0V&1O(0V&1OF0V&1OS0V&1OV0V&1TN0V&1U0V&1U(0V&1U;0V&1UC0V&1UE0V&E(10V&E(F0V&E(N0V&E(O0V&E(S0V&E(V0V&E10V&E1;0V&E1C0V&E1K0V&E1O0V&EF(0V&EK(0V&EK10V&EKF0V&EKN0V&EKS0V&EKV0V&EN0V&EN;0V&ENC0V&ENK0V&ENO0V&ES0V&ES;0V&ESC0V&ESK0V&ESO0V&EV0V&EV;0V&EVC0V&EVK0V&EVO0V&F()0V&F(10V&F(E0V&F(F0V&F(N0V&F(S0V&F(V0V&K&(0V&K&10V&K&F0V&K&N0V&K&S0V&K&V0V&K(10V&K(F0V&K(N0V&K(S0V&K(V0V&K1O0V&KC0V&KF(0V&KNK0V&KO(0V&KO10V&KOF0V&KOK0V&KON0V&KOS0V&KOV0V&KSO0V&KVO0V&N0V&N&(0V&N&10V&N&F0V&N&N0V&N&S0V&N&V0V&N)&0V&N)C0V&N)O0V&N)U0V&N;0V&N;C0V&N;E0V&N;T0V&NB(0V&NB10V&NBF0V&NBN0V&NBS0V&NBV0V&NC0V&NEN0V&NF(0V&NK(0V&NK10V&NKF0V&NKN0V&NKS0V&NKV0V&NO(0V&NOF0V&NOS0V&NOV0V&NTN0V&NU0V&NU(0V&NU;0V&NUC0V&NUE0V&S0V&S&(0V&S&10V&S&F0V&S&N0V&S&S0V&S&V0V&S)&0V&S)C0V&S)O0V&S)U0V&S10V&S1;0V&S1C0V&S;0V&S;C0V&S;E0V&S;T0V&SB(0V&SB10V&SBF0V&SBN0V&SBS0V&SBV0V&SC0V&SEK0V&SEN0V&SF(0V&SK(0V&SK10V&SKF0V&SKN0V&SKS0V&SKV0V&SO(0V&SO10V&SOF0V&SON0V&SOS0V&SOV0V&STN0V&SU0V&SU(0V&SU;0V&SUC0V&SUE0V&SV0V&SV;0V&SVC0V&SVO0V&V0V&V&(0V&V&10V&V&F0V&V&N0V&V&S0V&V&V0V&V)&0V&V)C0V&V)O0V&V)U0V&V;0V&V;C0V&V;E0V&V;T0V&VB(0V&VB10V&VBF0V&VBN0V&VBS0V&VBV0V&VC0V&VEK0V&VEN0V&VF(0V&VK(0V&VK10V&VKF0V&VKN0V&VKS0V&VKV0V&VO(0V&VOF0V&VOS0V&VS0V&VS;0V&VSC0V&VSO0V&VTN0V&VU0V&VU(0V&VU;0V&VUC0V&VUE0V(EF(0V(EKF0V(EKN0V(ENK0V(U(E0V)&(10V)&(E0V)&(F0V)&(N0V)&(S0V)&(V0V)&10V)&1&0V)&1)0V)&1;0V)&1B0V)&1C0V)&1F0V)&1O0V)&1U0V)&F(0V)&N0V)&N&0V)&N)0V)&N;0V)&NB0V)&NC0V)&NF0V)&NO0V)&NU0V)&S0V)&S&0V)&S)0V)&S;0V)&SB0V)&SC0V)&SF0V)&SO0V)&SU0V)&V0V)&V&0V)&V)0V)&V;0V)&VB0V)&VC0V)&VF0V)&VO0V)&VU0V),(10V),(F0V),(N0V),(S0V),(V0V);E(0V);E10V);EF0V);EK0V);EN0V);EO0V);ES0V);EV0V);T(0V);T10V);TF0V);TK0V);TN0V);TO0V);TS0V);TV0V)B(10V)B(F0V)B(N0V)B(S0V)B(V0V)B10V)B1&0V)B1;0V)B1C0V)B1K0V)B1N0V)B1O0V)B1U0V)BF(0V)BN0V)BN&0V)BN;0V)BNC0V)BNK0V)BNO0V)BNU0V)BS0V)BS&0V)BS;0V)BSC0V)BSK0V)BSO0V)BSU0V)BV0V)BV&0V)BV;0V)BVC0V)BVK0V)BVO0V)BVU0V)C0V)E(10V)E(F0V)E(N0V)E(S0V)E(V0V)E1C0V)E1O0V)EF(0V)EK(0V)EK10V)EKF0V)EKN0V)EKS0V)EKV0V)ENC0V)ENO0V)ESC0V)ESO0V)EVC0V)EVO0V)F(F0V)K(10V)K(F0V)K(N0V)K(S0V)K(V0V)K1&0V)K1;0V)K1B0V)K1E0V)K1O0V)K1U0V)KB(0V)KB10V)KBF0V)KBN0V)KBS0V)KBV0V)KF(0V)KN&0V)KN;0V)KNB0V)KNC0V)KNE0V)KNK0V)KNU0V)KS&0V)KS;0V)KSB0V)KSE0V)KSO0V)KSU0V)KUE0V)KV&0V)KV;0V)KVB0V)KVE0V)KVO0V)KVU0V)O(10V)O(E0V)O(F0V)O(N0V)O(S0V)O(V0V)O10V)O1&0V)O1)0V)O1;0V)O1B0V)O1C0V)O1K0V)O1U0V)OF(0V)ON0V)ON&0V)ON)0V)ON;0V)ONB0V)ONC0V)ONK0V)ONU0V)OS0V)OS&0V)OS)0V)OS;0V)OSB0V)OSC0V)OSK0V)OSU0V)OV0V)OV&0V)OV)0V)OV;0V)OVB0V)OVC0V)OVK0V)OVO0V)OVU0V)U(E0V)UE(0V)UE10V)UEF0V)UEK0V)UEN0V)UES0V)UEV0V,(1)0V,(1O0V,(E(0V,(E10V,(EF0V,(EK0V,(EN0V,(ES0V,(EV0V,(F(0V,(N)0V,(NO0V,(S)0V,(SO0V,(V)0V,(VO0V,F()0V,F(10V,F(F0V,F(N0V,F(S0V,F(V0V;E(10V;E(E0V;E(F0V;E(N0V;E(S0V;E(V0V;E1,0V;E1;0V;E1C0V;E1K0V;E1O0V;E1T0V;EF(0V;EK(0V;EK10V;EKF0V;EKN0V;EKO0V;EKS0V;EKV0V;EN,0V;EN;0V;ENC0V;ENE0V;ENK0V;ENO0V;ENT0V;ES,0V;ES;0V;ESC0V;ESK0V;ESO0V;EST0V;EV,0V;EV;0V;EVC0V;EVK0V;EVO0V;EVT0V;N:T0V;T(10V;T(C0V;T(E0V;T(F0V;T(N0V;T(S0V;T(V0V;T1(0V;T1,0V;T1;0V;T1C0V;T1F0V;T1K0V;T1O0V;T1T0V;T;0V;T;C0V;TF(0V;TK(0V;TK10V;TKF0V;TKK0V;TKN0V;TKO0V;TKS0V;TKV0V;TN(0V;TN,0V;TN10V;TN;0V;TNC0V;TNE0V;TNF0V;TNK0V;TNN0V;TNO0V;TNS0V;TNT0V;TNV0V;TO(0V;TS(0V;TS,0V;TS;0V;TSC0V;TSF0V;TSK0V;TSO0V;TST0V;TTN0V;TV(0V;TV,0V;TV;0V;TVC0V;TVF0V;TVK0V;TVO0V;TVT0VA(F(0VA(N)0VA(NO0VA(S)0VA(SO0VA(V)0VA(VO0VAF()0VAF(10VAF(F0VAF(N0VAF(S0VAF(V0VASO(0VASO10VASOF0VASON0VASOS0VASOV0VASUE0VATO(0VATO10VATOF0VATON0VATOS0VATOV0VATUE0VAVO(0VAVOF0VAVOS0VAVUE0VB(1)0VB(1O0VB(F(0VB(NO0VB(S)0VB(SO0VB(V)0VB(VO0VB10VB1&(0VB1&10VB1&F0VB1&N0VB1&S0VB1&V0VB1,(0VB1,F0VB1;0VB1;C0VB1B(0VB1B10VB1BF0VB1BN0VB1BS0VB1BV0VB1C0VB1K(0VB1K10VB1KF0VB1KN0VB1KS0VB1KV0VB1O(0VB1OF0VB1OS0VB1OV0VB1U(0VB1UE0VBE(10VBE(F0VBE(N0VBE(S0VBE(V0VBEK(0VBF()0VBF(10VBF(F0VBF(N0VBF(S0VBF(V0VBN0VBN&(0VBN&10VBN&F0VBN&N0VBN&S0VBN&V0VBN,(0VBN,F0VBN;0VBN;C0VBNB(0VBNB10VBNBF0VBNBN0VBNBS0VBNBV0VBNC0VBNK(0VBNK10VBNKF0VBNKN0VBNKS0VBNKV0VBNO(0VBNOF0VBNOS0VBNOV0VBNU(0VBNUE0VBS0VBS&(0VBS&10VBS&F0VBS&N0VBS&S0VBS&V0VBS,(0VBS,F0VBS;0VBS;C0VBSB(0VBSB10VBSBF0VBSBN0VBSBS0VBSBV0VBSC0VBSK(0VBSK10VBSKF0VBSKN0VBSKS0VBSKV0VBSO(0VBSO10VBSOF0VBSON0VBSOS0VBSOV0VBSU(0VBSUE0VBV0VBV&(0VBV&10VBV&F0VBV&N0VBV&S0VBV&V0VBV,(0VBV,F0VBV;0VBV;C0VBVB(0VBVB10VBVBF0VBVBN0VBVBS0VBVBV0VBVC0VBVK(0VBVK10VBVKF0VBVKN0VBVKS0VBVKV0VBVO(0VBVOF0VBVOS0VBVU(0VBVUE0VC0VE(1)0VE(1O0VE(F(0VE(N)0VE(NO0VE(S)0VE(SO0VE(V)0VE(VO0VE1;T0VE1C0VE1O(0VE1OF0VE1OS0VE1OV0VE1T(0VE1T10VE1TF0VE1TN0VE1TS0VE1TV0VE1UE0VEF()0VEF(10VEF(F0VEF(N0VEF(S0VEF(V0VEK(10VEK(E0VEK(F0VEK(N0VEK(S0VEK(V0VEK1;0VEK1C0VEK1O0VEK1T0VEK1U0VEKF(0VEKN;0VEKNC0VEKNE0VEKNT0VEKNU0VEKOK0VEKS;0VEKSC0VEKSO0VEKST0VEKSU0VEKU(0VEKU10VEKUE0VEKUF0VEKUS0VEKUV0VEKV;0VEKVC0VEKVO0VEKVT0VEKVU0VEN;T0VENC0VENEN0VENO(0VENOF0VENOS0VENOV0VENT(0VENT10VENTF0VENTN0VENTS0VENTV0VENUE0VEOKN0VES;T0VESC0VESO(0VESO10VESOF0VESON0VESOS0VESOV0VEST(0VEST10VESTF0VESTN0VESTS0VESTV0VESUE0VEU(10VEU(F0VEU(N0VEU(S0VEU(V0VEU1,0VEU1C0VEU1O0VEUEF0VEUEK0VEUF(0VEUS,0VEUSC0VEUSO0VEUV,0VEUVC0VEUVO0VEV;T0VEVC0VEVO(0VEVOF0VEVOS0VEVT(0VEVT10VEVTF0VEVTN0VEVTS0VEVTV0VEVUE0VF()10VF()F0VF()K0VF()N0VF()O0VF()S0VF()U0VF()V0VF(1)0VF(1N0VF(1O0VF(E(0VF(E10VF(EF0VF(EK0VF(EN0VF(ES0VF(EV0VF(F(0VF(N)0VF(N,0VF(NO0VF(S)0VF(SO0VF(V)0VF(VO0VK(1)0VK(1O0VK(F(0VK(N)0VK(NO0VK(S)0VK(SO0VK(V)0VK(VO0VK)&(0VK)&10VK)&F0VK)&N0VK)&S0VK)&V0VK);E0VK);T0VK)B(0VK)B10VK)BF0VK)BN0VK)BS0VK)BV0VK)E(0VK)E10VK)EF0VK)EK0VK)EN0VK)ES0VK)EV0VK)F(0VK)O(0VK)OF0VK)UE0VK10VK1&(0VK1&10VK1&F0VK1&N0VK1&S0VK1&V0VK1;0VK1;C0VK1;E0VK1;T0VK1B(0VK1B10VK1BF0VK1BN0VK1BS0VK1BV0VK1C0VK1E(0VK1E10VK1EF0VK1EK0VK1EN0VK1ES0VK1EV0VK1O(0VK1OF0VK1OS0VK1OV0VK1U(0VK1UE0VKF()0VKF(10VKF(F0VKF(N0VKF(S0VKF(V0VKN0VKN&(0VKN&10VKN&F0VKN&N0VKN&S0VKN&V0VKN;0VKN;C0VKN;E0VKN;T0VKNB(0VKNB10VKNBF0VKNBN0VKNBS0VKNBV0VKNC0VKNE(0VKNE10VKNEF0VKNEN0VKNES0VKNEV0VKNU(0VKNUE0VKS0VKS&(0VKS&10VKS&F0VKS&N0VKS&S0VKS&V0VKS;0VKS;C0VKS;E0VKS;T0VKSB(0VKSB10VKSBF0VKSBN0VKSBS0VKSBV0VKSC0VKSE(0VKSE10VKSEF0VKSEK0VKSEN0VKSES0VKSEV0VKSO(0VKSO10VKSOF0VKSON0VKSOS0VKSOV0VKSU(0VKSUE0VKUE(0VKUE10VKUEF0VKUEK0VKUEN0VKUES0VKUEV0VKV0VKV&(0VKV&10VKV&F0VKV&N0VKV&S0VKV&V0VKV;0VKV;C0VKV;E0VKV;T0VKVB(0VKVB10VKVBF0VKVBN0VKVBS0VKVBV0VKVC0VKVE(0VKVE10VKVEF0VKVEK0VKVEN0VKVES0VKVEV0VKVO(0VKVOF0VKVOS0VKVU(0VKVUE0VO(1&0VO(1)0VO(1,0VO(1O0VO(E(0VO(E10VO(EE0VO(EF0VO(EK0VO(EN0VO(EO0VO(ES0VO(EV0VO(F(0VO(N&0VO(N)0VO(N,0VO(NO0VO(S&0VO(S)0VO(S,0VO(SO0VO(V&0VO(V)0VO(V,0VO(VO0VOF()0VOF(10VOF(E0VOF(F0VOF(N0VOF(S0VOF(V0VOK&(0VOK&10VOK&F0VOK&N0VOK&S0VOK&V0VOK(10VOK(F0VOK(N0VOK(S0VOK(V0VOK1C0VOK1O0VOKF(0VOKNC0VOKO(0VOKO10VOKOF0VOKON0VOKOS0VOKOV0VOKSC0VOKSO0VOKVC0VOKVO0VOS0VOS&(0VOS&10VOS&E0VOS&F0VOS&K0VOS&N0VOS&S0VOS&U0VOS&V0VOS(E0VOS(U0VOS)&0VOS),0VOS);0VOS)B0VOS)C0VOS)E0VOS)F0VOS)K0VOS)O0VOS)U0VOS,(0VOS,F0VOS1(0VOS1F0VOS1N0VOS1S0VOS1U0VOS1V0VOS;0VOS;C0VOS;E0VOS;N0VOS;T0VOSA(0VOSAF0VOSAS0VOSAT0VOSAV0VOSB(0VOSB10VOSBE0VOSBF0VOSBN0VOSBS0VOSBV0VOSC0VOSE(0VOSE10VOSEF0VOSEK0VOSEN0VOSEO0VOSES0VOSEU0VOSEV0VOSF(0VOSK(0VOSK)0VOSK10VOSKB0VOSKF0VOSKN0VOSKS0VOSKU0VOSKV0VOST(0VOST10VOSTE0VOSTF0VOSTN0VOSTS0VOSTT0VOSTV0VOSU0VOSU(0VOSU10VOSU;0VOSUC0VOSUE0VOSUF0VOSUK0VOSUO0VOSUS0VOSUT0VOSUV0VOSV(0VOSVF0VOSVO0VOSVS0VOSVU0VOU(E0VOUEK0VOUEN0VT(1)0VT(1O0VT(F(0VT(N)0VT(NO0VT(S)0VT(SO0VT(V)0VT(VO0VT1(F0VT1O(0VT1OF0VT1OS0VT1OV0VTE(10VTE(F0VTE(N0VTE(S0VTE(V0VTE1N0VTE1O0VTEF(0VTEK(0VTEK10VTEKF0VTEKN0VTEKS0VTEKV0VTENN0VTENO0VTESN0VTESO0VTEVN0VTEVO0VTF()0VTF(10VTF(F0VTF(N0VTF(S0VTF(V0VTN(10VTN(F0VTN(S0VTN(V0VTN1C0VTN1O0VTN;E0VTN;N0VTN;T0VTNE(0VTNE10VTNEF0VTNEN0VTNES0VTNEV0VTNF(0VTNKN0VTNN:0VTNNC0VTNNO0VTNO(0VTNOF0VTNOS0VTNOV0VTNSC0VTNSO0VTNT(0VTNT10VTNTF0VTNTN0VTNTS0VTNTV0VTNVC0VTNVO0VTS(F0VTSO(0VTSO10VTSOF0VTSON0VTSOS0VTSOV0VTTNE0VTTNK0VTTNN0VTTNT0VTV(10VTV(F0VTVO(0VTVOF0VTVOS0VU0VU(1)0VU(1O0VU(E(0VU(E10VU(EF0VU(EK0VU(EN0VU(ES0VU(EV0VU(F(0VU(N)0VU(NO0VU(S)0VU(SO0VU(V)0VU(VO0VU1,(0VU1,F0VU1C0VU1O(0VU1OF0VU1OS0VU1OV0VU;0VU;C0VUC0VUE0VUE(10VUE(E0VUE(F0VUE(N0VUE(O0VUE(S0VUE(V0VUE10VUE1&0VUE1(0VUE1)0VUE1,0VUE1;0VUE1B0VUE1C0VUE1F0VUE1K0VUE1N0VUE1O0VUE1S0VUE1U0VUE1V0VUE;0VUE;C0VUEC0VUEF0VUEF(0VUEF,0VUEF;0VUEFC0VUEK0VUEK(0VUEK10VUEK;0VUEKC0VUEKF0VUEKN0VUEKO0VUEKS0VUEKV0VUEN0VUEN&0VUEN(0VUEN)0VUEN,0VUEN10VUEN;0VUENB0VUENC0VUENF0VUENK0VUENO0VUENS0VUENU0VUEOK0VUEON0VUES0VUES&0VUES(0VUES)0VUES,0VUES10VUES;0VUESB0VUESC0VUESF0VUESK0VUESO0VUESU0VUESV0VUEV0VUEV&0VUEV(0VUEV)0VUEV,0VUEV;0VUEVB0VUEVC0VUEVF0VUEVK0VUEVN0VUEVO0VUEVS0VUEVU0VUF()0VUF(10VUF(F0VUF(N0VUF(S0VUF(V0VUK(E0VUO(E0VUON(0VUON10VUONF0VUONS0VUS,(0VUS,F0VUSC0VUSO(0VUSO10VUSOF0VUSON0VUSOS0VUSOV0VUTN(0VUTN10VUTNF0VUTNN0VUTNS0VUTNV0VUV,(0VUV,F0VUVC0VUVO(0VUVOF0VUVOS0X:=<<<=<><@>=>>@>ABORTABSACCESSIBLEACOSADDDATEADDTIMEAES_DECRYPTAES_ENCRYPTAGAINSTALL_USERSALTERALTER DOMAINALTER TABLEANALYZEANYANYARRAYANYELEMENTANYNONARRYAPPLOCK_MODEAPPLOCK_TESTAPP_NAMEARRAY_AGGARRAY_CATARRAY_DIMARRAY_FILLARRAY_LENGTHARRAY_LOWERARRAY_NDIMSARRAY_PREPENDARRAY_TO_JSONARRAY_TO_STRINGARRAY_UPPERASCASENSITIVEASINASSEMBLYPROPERTYASYMKEY_IDAT TIMEAT TIME ZONEATANATAN2AUTOINCREMENTBEGINBEGIN DECLAREBEGIN GOTOBEGIN TRYBEGIN TRY DECLAREBENCHMARKBIGINTBIGSERIALBINBINARY_DOUBLE_INFINITYBINARY_DOUBLE_NANBINARY_FLOAT_INFINITYBINARY_FLOAT_NANBINBINARYBIT_ANDBIT_COUNTBIT_LENGTHBIT_ORBIT_XORBOOL_ANDBOOL_ORBOTHBTRIMBYTEACALLCASCADECBOOLCBRTCBYTECCURCDBLCEILCEILINGCERTENCODEDCERTPRIVATEKEYCERT_IDCERT_PROPERTYCHANGECHARACTER VARYINGCHARACTER_LENGTHCHARINDEXCHARSETCHAR_LENGTHCHDIRCHDRIVECHECKCHECKSUM_AGGCHOOSECHRCINTCLNGCLOCK_TIMESTAMPCOALESCECOERCIBILITYCOLLATECOLLATIONCOLLATIONPROPERTYCOLUMNCOLUMNPROPERTYCOLUMNS_UPDATEDCOL_LENGTHCOL_NAMECONCAT_WSCONDITIONCONNECTION_IDCONSTRAINTCONTINUECONVERT_FROMCONVERT_TOCONVERT_TZCOTCOUNT_BIGCRC32CREATECREATE ORCREATE OR REPLACECROSSCROSS JOINCSNGCSTRINGCTXSYS.DRITHSX.SNCUME_DISTCURDATECURDIRCURRENT DATECURRENT DEGREECURRENT FUNCTIONCURRENT FUNCTION PATHCURRENT PATHCURRENT SCHEMACURRENT SERVERCURRENT TIMECURRENT TIMEZONECURRENTUSERCURRENT_DATABASECURRENT_PATHCURRENT_QUERYCURRENT_SCHEMACURRENT_SCHEMASCURRENT_SERVERCURRENT_SETTINGCURRENT_TIMEZONECURRVALCURSORCURSOR_STATUSCURTIMECVARDATABASEPROPERTYEXDATABASESDATABASE_PRINCIPAL_IDDATALENGTHDATEADDDATEDIFFDATEFROMPARTSDATENAMEDATEPARTDATESERIALDATETIME2FROMPARTSDATETIMEOFFSETFROMPARTSDATEVALUEDATE_ADDDATE_FORMATDATE_PARTDATE_SUBDATE_TRUNCDAVGDAYOFMONTHDAYOFWEEKDAYOFYEARDAY_HOURDAY_MICROSECONDDAY_MINUTEDAY_SECONDDBMS_LOCK.SLEEPDBMS_PIPE.RECEIVE_MESSAGEDBMS_UTILITY.SQLID_TO_SQLHASHDB_IDDCOUNTDECDECIMALDECODEDECRYPTBYASMKEYDECRYPTBYCERTDECRYPTBYKEYDECRYPTBYKEYAUTOCERTDECRYPTBYPASSPHRASEDEFAULTDEGREESDELETEDENSE_RANKDESCDESCRIBEDES_DECRYPTDES_ENCRYPTDETERMINISTICDFIRSTDIFFERENCEDISTINCTROWDIVDLASTDLOOKUPDMAXDMINDOUBLEDOUBLE PRECISIONDROPDSUMDUALEACHELSEELSEIFELTENCLOSEDENCODEENCRYPTBYASMKEYENCRYPTBYCERTENCRYPTBYKEYENCRYPTBYPASSPHRASEENUM_FIRSTENUM_LASTENUM_RANGEEOMONTHEQVESCAPEDEVENTDATAEXCEPTEXECEXECUTEEXECUTE ASEXECUTE AS LOGINEXITEXPLAINEXPORT_SETEXTRACTEXTRACTVALUEEXTRACT_VALUEFALSEFETCHFIELDFILEDATETIMEFILEGROUPPROPERTYFILEGROUP_IDFILEGROUP_NAMEFILELENFILEPROPERTYFILETOBLOBFILETOCLOBFILE_IDFILE_IDEXFILE_NAMEFIND_IN_SETFIRST_VALUEFLOATFLOAT4FLOAT8FLOORFN_VIRTUALFILESTATSFOR UPDATEFOR UPDATE NOWAITFOR UPDATE OFFOR UPDATE SKIPFOR UPDATE SKIP LOCKEDFOR UPDATE WAITFORCEFOREIGNFROM_BASE64FROM_DAYSFROM_UNIXTIMEFULL JOINFULL OUTERFULLTEXTFULLTEXTCATALOGPROPERTYFULLTEXTSERVICEPROPERTYGENERATE_SERIESGENERATE_SUBSCRIPTSGETATTRGETDATEGETUTCDATEGET_BITGET_BYTEGET_FORMATGET_LOCKGOGRANTGREATESTGROUPGROUP BYGROUPINGGROUPING_IDGROUP_CONCATHANDLERHASHBYTESHAS_PERMS_BY_NAMEHAVINGHOUR_MICROSECONDHOUR_MINUTEHOUR_SECONDIDENTIFYIDENT_CURRENTIDENT_INCRIDENT_SEEDIF EXISTSIF NOTIF NOT EXISTSIFNULLIIFIN BOOLEANIN BOOLEAN MODEINDEXKEY_PROPERTYINDEXPROPERTYINDEX_COLINET_ATONINET_NTOAINFILEINITCAPINNER JOININOUTINSENSITIVEINSERTINSERT DELAYEDINSERT DELAYED INTOINSERT HIGH_PRIORITYINSERT HIGH_PRIORITY INTOINSERT IGNOREINSERT IGNORE INTOINSERT INTOINSERT LOW_PRIORITYINSERT LOW_PRIORITY INTOINSTRREVINT1INT2INT3INT4INT8INTEGERINTERSECTINTERSECT ALLINTO DUMPFILEINTO OUTFILEIS DISTINCTIS DISTINCT FROMIS NOTIS NOT DISTINCTIS NOT DISTINCT FROMISDATEISEMPTYISFINITEISNULLISNUMERICIS_FREE_LOCKIS_MEMBERIS_OBJECTSIGNEDIS_ROLEMEMBERIS_SRVROLEMEMBERIS_USED_LOCKITERATEJSON_KEYSJULIANDAYJUSTIFY_DAYSJUSTIFY_HOURSJUSTIFY_INTERVALKEY_GUIDKILLLAGLASTVALLAST_INSERT_IDLAST_INSERT_ROWIDLAST_VALUELCASELEADLEADINGLEASTLEAVELEFT JOINLIMITLINEARLNLOADLOAD DATALOAD XMLLOAD_EXTENSIONLOAD_FILELOCATELOCK INLOCK IN SHARELOCK IN SHARE MODELOCK TABLELOCK TABLESLOG10LOG2LONGBLOBLONGTEXTLOOPLOWER_INCLOWER_INFLPADLTRIMMAKEDATEMAKE_SETMASTER_BINDMASTER_POS_WAITMASTER_SSL_VERIFY_SERVER_CERTMATCHMAXVALUEMD5MEDIUMBLOBMEDIUMINTMEDIUMTEXTMERGEMIDMIDDLEINTMINUTE_MICROSECONDMINUTE_SECONDMKDIRMODMODIFIESMONEYMONTHNAMENAME_CONSTNATURALNATURAL FULLNATURAL FULL OUTER JOINNATURAL INNERNATURAL JOINNATURAL LEFTNATURAL LEFT OUTERNATURAL LEFT OUTER JOINNATURAL OUTERNATURAL RIGHTNATURAL RIGHT OUTER JOINNETMASKNEXT VALUENEXT VALUE FORNEXTVALNOT BETWEENNOT REGEXPNOT RLIKENOT SIMILARNOT SIMILAR TONOTNULLNOWNO_WRITE_TO_BINLOGNTH_VALUENTILENULLIFNZOBJECTPROPERTYOBJECTPROPERTYEXOBJECT_DEFINITIONOBJECT_IDOBJECT_NAMEOBJECT_SCHEMA_NAMEOCTOCTET_LENGTHOLD_PASSWORDONE_SHOTOPENOPENDATASOURCEOPENQUERYOPENROWSETOPENXMLOPTIMIZEOPTIONOPTIONALLYORDERORDER BYORIGINAL_DB_NAMEORIGINAL_LOGINOVERLAPSOVERLAYOWN3DOWN3D BYPARSENAMEPARTITIONPARTITION BYPATHINDEXPATINDEXPERCENTILE_COUNTPERCENTILE_DISCPERCENTILE_RANKPERCENT_RANKPERIOD_ADDPERIOD_DIFFPG_ADVISORY_LOCKPG_BACKEND_PIDPG_CANCEL_BACKENDPG_CLIENT_ENCODINGPG_CONF_LOAD_TIMEPG_CREATE_RESTORE_POINTPG_HAS_ROLEPG_IS_IN_RECOVERYPG_IS_OTHER_TEMP_SCHEMAPG_LISTENING_CHANNELSPG_LS_DIRPG_MY_TEMP_SCHEMAPG_POSTMASTER_START_TIMEPG_READ_BINARY_FILEPG_READ_FILEPG_RELOAD_CONFPG_ROTATE_LOGFILEPG_SLEEPPG_START_BACKUPPG_STAT_FILEPG_STOP_BACKUPPG_SWITCH_XLOGPG_TERMINATE_BACKENDPG_TRIGGER_DEPTHPOSITIONPOWPOWERPREVIOUS VALUEPREVIOUS VALUE FORPRIMARYPRINTPROCEDURE ANALYSEPUBLISHINGSERVERNAMEPURGEPWDCOMPAREPWDENCRYPTQUARTERQUOTEQUOTENAMEQUOTE_IDENTQUOTE_LITERALQUOTE_NULLABLERADIANSRAISEERRORRANDRANDOMRANDOMBLOBREAD WRITEREADSREAD_WRITEREALREFERENCESREGCLASSREGCONFIGREGDICTIONARYREGEXP_INSTRREGEXP_MATCHESREGEXP_REPLACEREGEXP_SPLIT_TO_ARRAYREGEXP_SPLIT_TO_TABLEREGEXP_SUBSTRREGOPERREGOPERATORREGPROCREGPROCEDUREREGTYPERELEASERELEASE_LOCKRENAMEREPEATREPLICATEREQUIRERESIGNALRESTRICTRETURNREVERSEREVOKERIGHT JOINRIGHT OUTERROW_COUNTROW_NUMBERROW_TO_JSONRPADRTRIMSCHAMA_NAMESCHEMA_IDSCOPE_IDENTITYSECOND_MICROSECONDSEC_TO_TIMESELECTSELECT ALLSELECT DISTINCTSEPARATORSERIAL2SERIAL4SERIAL8SERVERPROPERTYSESSION_USERSETATTRSETSEEDSETVALSET_BITSET_BYTESET_CONFIGSET_MASKLENSHASHA1SHA2SHOWSHUTDOWNSIGNSIGNBYASMKEYSIGNBYCERTSMALLDATETIMEFROMPARTSSMALLINTSMALLSERIALSOMESOUNDEXSOUNDSSOUNDS LIKESPATIALSPECIFICSPLIT_PARTSQLSQLEXCEPTIONSQLITE_VERSIONSQLSTATESQLWARNINGSQL_BIG_RESULTSQL_BUFFER_RESULTSQL_CACHESQL_CALC_FOUND_ROWSSQL_NO_CACHESQL_SMALL_RESULTSQL_VARIANT_PROPERTYSQRTSSLSTARTINGSTATEMENT_TIMESTAMPSTATS_DATESTDDEVSTDDEV_POPSTDDEV_SAMPSTRAIGHT_JOINSTRCMPSTRCOMPSTRCONVSTRING_AGGSTRING_TO_ARRAYSTRPOSSTR_TO_DATESTUFFSUBDATESUBSTRINGSUBSTRING_INDEXSUBTIMESUSER_IDSUSER_NAMESUSER_SIDSUSER_SNAMESWITCHOFFETSYS.DATABASE_NAMESYS.FN_BUILTIN_PERMISSIONSSYS.FN_GET_AUDIT_FILESYS.FN_MY_PERMISSIONSSYS.STRAGGSYSCOLUMNSSYSDATESYSDATETIMESYSDATETIMEOFFSETSYSOBJECTSSYSTEM_USERSYSUSERSSYSUTCDATETMETERMINATEDTERTIARY_WEIGHTSTEXTPOSTEXTPTRTEXTVALIDTHENTIMEDIFFTIMEOFDAYTIMESERIALTIMESTAMPADDTIMEVALUETIME_FORMATTIME_TO_SECTINYBLOBTINYINTTINYTEXTTODATETIMEOFFSETTOPTOTALTOTAL_CHANGESTO_ASCIITO_BASE64TO_CHARTO_DAYSTO_HEXTO_NUMBERTO_SECONDSTO_TIMESTAMPTRAILINGTRANSACTION_TIMESTAMPTRANSLATETRIGGERTRIGGER_NESTLEVELTRUETRUNCATETRY_CASTTRY_CONVERTTRY_PARSETYPEOFTYPEPROPERTYTYPE_IDTYPE_NAMEUCASEUESCAPEUNCOMPRESSUNCOMPRESS_LENGTHUNDOUNHEXUNICODEUNIONUNION ALLUNION ALL DISTINCTUNION DISTINCTUNION DISTINCT ALLUNIQUEUNIX_TIMESTAMPUNI_ONUNKNOWNUNLOCKUNNESTUNSIGNEDUPDATEXMLUPPER_INCUPPER_INFUSAGEUSEUSER_LOCK.SLEEPUSINGUTC_DATEUTC_TIMEUTC_TIMESTAMPUTL_HTTP.REQUESTUTL_INADDR.GET_HOST_ADDRESSUTL_INADDR.GET_HOST_NAMEUUIDUUID_SHORTVALUESVARBINARYVARCHARVARCHARACTERVARIANCEVARPVAR_POPVAR_SAMPVERIFYSIGNEDBYASMKEYVERIFYSIGNEDBYCERTVOIDWAITFORWAITFOR DELAYWAITFOR RECEIVEWAITFOR TIMEWEEKDAYWEEKDAYNAMEWEEKOFYEARWHENWHEREWHILEWIDTH_BUCKETWITHWITH ROLLUPXMLAGGXMLCOMMENTXMLCONCATXMLELEMENTXMLEXISTSXMLFORESTXMLFORMATXMLPIXMLROOTXMLTYPEXML_IS_WELL_FORMEDXPATHXPATH_EXISTSXP_EXECRESULTSETYEARWEEKYEAR_MONTHZEROBLOBZEROFILL^=_ARMSCII8_BIG5_BINARY_CP1250_CP1251_CP1257_CP850_CP852_CP866_CP932_DEC8_EUCJPMS_EUCKR_GB2312_GBK_GEOSTD8_GREEK_HEBREW_HP8_KEYBCS2_KOI8R_KOI8U_LATIN1_LATIN2_LATIN5_LATIN7_MACCE_MACROMAN_SJIS_SWE7_TIS620_UJIS_USC2_UTF8|/|=||~* <>:\?=@!#~+-*/&|^%(),';
MODSEC_2.59MODSEC_%s.%smodsec_register_tfnmodsec_register_operatormodsec_register_variableMODSECURITY_INMODSECURITY_OUTmod_security2.cmodsecurity-tx-contextmodsecurity-init-flag%s configured.1.7.4%d.%d Lua 5.32.9.7for subrequest Initialising logging.-%ld %ld "%s" %d%s %s %s %s L ap_register_log_handlermodsecurity is NULL (phase %d)%{Access denied with code %d%s.mod_proxy.cproxy:%sproxy-serverAccess allowed%s.Paused Access%s.Access to phase allowed%s.Access to request allowed%s.%s. Deny with code (%d)%lumod_log_config.cmod_env.cmod_log_forensic.cmod_rpaf.cmod_rpaf-2.0.cmod_extract_forwarded.cmod_extract_forwarded2.cmod_remoteip.cmod_custom_header.cmod_breach_realip.cmod_breach_trans.cmod_unique_id.cmod_fcgid.cmod_cgid.cmod_ssl.cmodsec_register_reqbody_processorModSecurity: ModSecurity requires mod_unique_id to be installed.Initialising transaction (txid %s).Failed to initialise transaction (txid %s).Transaction context created (dcfg %pp).ModSecurity: going to loop through %d servers with %d threadsModSecurity: threads in READ: %ld of %ld, WRITE: %ld of %ld, IP: %sModSecurity: Too many threads [%ld] of %ld allowed in READ state from %s - There is a suspission list but that IP is not part of it, access grantedModSecurity: Too many threads [%ld] of %ld allowed in READ state from %s - Ip is on whitelist, access grantedModSecurity: Access denied with code 400. Too many threads [%ld] of %ld allowed in READ state from %s - Possible DoS Consumption Attack [Rejected]ModSecurity: Too many threads [%ld] of %ld allowed in WRITE state from %s - There is a suspission list but that IP is not part of it, access grantedModSecurity: Too many threads [%ld] of %ld allowed in WRITE state from %s - Ip is on whitelist, access grantedModSecurity: Access denied with code 400. Too many threads [%ld] of %ld allowed in WRITE state from %s - Possible DoS Consumption Attack [Rejected]SecServerSignature: Apache returned null as signature.SecServerSignature: original signature too short. Please set ServerTokens to Full.SecServerSignature: Failed to change server signature to "%s".SecServerSignature: Changed server signature to "%s".ModSecurity: chroot checkpoint #2 (pid=%ld ppid=%ld)ModSecurity: chroot failed, unable to chdir to %s, errno=%d (%s)ModSecurity: chroot failed, path=%s, errno=%d(%s)ModSecurity: chdoot failed, unable to chdir to /, errno=%d (%s)ModSecurity: chroot successful, path=%sModSecurity: chroot checkpoint #1 (pid=%ld ppid=%ld)ModSecurity for Apache/2.9.7 (http://www.modsecurity.org/)ModSecurity: APR compiled version="%s"; loaded version="%s"ModSecurity: Loaded APR do not match with compiled!ModSecurity: PCRE compiled version="%s"; loaded version="%s"ModSecurity: Loaded PCRE do not match with compiled!ModSecurity: LUA compiled version="%s"ModSecurity: YAJL compiled version="%d.%d.%d"ModSecurity: LIBXML compiled version="%s"ModSecurity: Original server signature: %sModSecurity: Status engine is currently disabled, enable it by set SecStatusEngine to On.ModSecurity: Loaded %d rule from: '%s'.ModSecurity: Loaded %d rules from: '%s'.ModSecurity: Problems loading external resources: %sHook insert_error_filter: Processing disabled, skipping.Hook insert_error_filter: Adding output filter (r %pp).Hook insert_error_filter: Output buffering already complete.Hook insert_filter: Adding input forwarding filter %s(r %pp).Hook insert_filter: Processing disabled, skipping.Hook insert_filter: Adding output filter (r %pp).Context created after request failure.Audit Log: Atomic PIPE write buffer too small: %dModSecurity: Failed to initialise engine.Internal Error: Asked to intercept request but was_intercepted is zeroInternal Error: Asked to intercept request in phase %d.Pausing transaction for %d msec.Access denied with code 500%s (Internal Error: Invalid status code requested %d).Access denied with code 500%s (Configuration Error: Proxy action to %s requested but mod_proxy not found).Access denied using proxy to%s %s.Access denied with code 500%s (Configuration Error: Proxy action requested but it does not work in output phases).Access denied with connection close%s.Access denied with code 500%s (Error: Connection drop requested but failed to close the socket).Access denied with code 500%s (Error: Connection drop requested but socket not found.Access denied with redirection to %s using status %d%s.Access denied with code 500%s (Internal Error: invalid interception action %d).Internal Error: Attempted to process the request body more than once.Processing disabled, skipping (hook request_late).Second phase starting (dcfg %pp).Request body (Content-Length) is larger than the configured limit (%ld). Deny with status (%d)Request body (Content-Length) is larger than the configured limit (%ld).Processing disabled, skipping (hook request_early).4c���b��`��a��b��|b���a���b���b���g���g���g���h��h��h���h��Unknown error.%s %s%sTransfer-EncodingContent-TypeURLENCODEDMULTIPARTQUERY_STRINGCookiemultipart/form-dataStarting phase REQUEST_BODY.Starting phase RESPONSE_BODY.Starting phase LOGGING.Invalid processing phase: %dRegex processing failed (rc %d): %sapplication/x-www-form-urlencodedInitialisation: Error occurred while parsing QUERY_STRING arguments.Cookie v0 parser: Using comma as a separator. Semi-colon was not identified!Skipping phase %d as request was already intercepted.Skipping phase %d because it was previously run (at %d now).Cleared transformation cache for phase %dStarting phase REQUEST_HEADERS.Skipping phase REQUEST_BODY (allow used).Skipping phase RESPONSE_HEADERS (allow used).Starting phase RESPONSE_HEADERS.Skipping phase RESPONSE_BODY (allow used).Recording persistent data took %ld microseconds.Garbage collection took %ld microseconds.Audit log: Not configured to run for this request.Audit log: Ignoring a non-relevant request.Internal error: Could not determine if auditing is needed, so forcing auditing.Audit log: Logging this transaction.�s���p��Hs���r���r��(q��%02x:%02x:%02x:%02x:%02x:%02x%s%02xstatus.modsecurity.org%s.%ld.%smsc_status_engine.c%.25s,%.25s,%s/%s,%s/%s,%s,%s,%sModSecurity: StatusEngine call: "%s"ModSecurity: StatusEngine call successfully sent. For more information visit: http://%s/ModSecurity: StatusEngine call failed. Query: %sABCDEFGHIJKLMNOPQRSTUVWXYZ234567%s://:%d?%s#%s%.*s(null)charset=ISO-8859-1MSC_PCRE_LIMITS_EXCEEDED ;UTF-8HTMLasciitext/html;%shttp:Signing data [%s]Using session id [%s]Signing data [%s] size %zu%s?%s=%s%s&%s=%s//*[@href]href//formoption//iframesrc//frameHTTP status (%d)��������p���`���P���@���������X�������init_response_body_html_parser: skipping html_tree generation for Content[%s].init_response_body_html_parser: skipping html_tree generation for zero length respomse body.init_response_body_html_parser: assuming ISO-8859-1.init_response_body_html_parser: Enconding[%s].init_response_body_html_parser: Failed to parse response body.init_response_body_html_parser: Successfully html parser generated.init_response_body_html_parser: Charset[%s]Execution error - PCRE limits exceeded for Hash regex [%s] (%d): %sRegex execution failed (%d): %sinject_hashed_response_body: Cannot parse NULL html treeinject_hashed_response_body: Detected encoding type [%s].inject_hashed_response_body: Using content-type [%s].inject_hashed_response_body: Unable to allocate memory buffer.inject_hashed_response_body: NEW_BUFFER Output buffer is null.inject_hashed_response_body: NEW BUFFER Stream Output is null.inject_hashed_response_body: Copying XML tree from CONTENT to stream buffer [%zu] bytes.inject_hashed_response_body: Conv is null.inject_hashed_response_body: Stream Output data is NULL.inject_hashed_response_body: Copying XML tree from CONV to stream buffer [%zu] bytes.inject_hashed_response_body: Setting new content value %sinject_hashed_response_body: Stream buffer [%lu]. DoneSession id is empty. Using REMOTE_IPhash_response_body_links: Cannot parse NULL html treehash_response_body_links: Unable to create Xpath context.hash_response_body_links: Unable to evaluate xpath expression.hash_response_body_links: Processed [%d] iframe src, [%d] hashed.hash_response_body_links: Processed [%d] frame src, [%d] hashed.hash_response_body_links: Processed [%d] form actions, [%d] hashed.hash_response_body_links: Processed [%d] links, [%d] hashed.Skipping status other than 302 an 301Processing reponse header location [%s]Setting new reponse header location [%s]0123456789abcdefCould not open geo database "%s": %sGeo lookup for "%s" failed: %sGEO: Using address "%s" (0x%08lx). %luGeo Lookup: Failed to lock proc mutex: %sNo geo data for "%s" (country %d).Geo lookup for "%s" succeeded.Congo, The Democratic Republic of theMicronesia, Federated States ofSouth Georgia and the South Sandwich IslandsHeard Island and McDonald IslandsBritish Indian Ocean TerritoryKorea, Democratic People's Republic ofLao People's Democratic RepublicUnited States Minor Outlying IslandsSaint Vincent and the GrenadinesBonaire, Sint Eustatius and SabaN/AGEO: Looking up "%s".No geo data for "%s").GEO: rec="%s"GEO: country="%.*s"GEO: region="%.*s"GEO: city="%.*s"GEO: postal_code="%.*s"GEO: latitude="%.*s"GEO: longitude="%.*s"GEO: dma/area="%.*s"Asia/Pacific RegionEuropeAndorraUnited Arab EmiratesAfghanistanAntigua and BarbudaAnguillaAlbaniaArmeniaNetherlands AntillesAngolaAntarcticaArgentinaAmerican SamoaAustriaAustraliaArubaAzerbaijanBosnia and HerzegovinaBarbadosBangladeshBelgiumBurkina FasoBulgariaBahrainBurundiBeninBermudaBrunei DarussalamBoliviaBrazilBahamasBhutanBouvet IslandBotswanaBelarusBelizeCanadaCocos (Keeling) IslandsCentral African RepublicCongoSwitzerlandCote D'IvoireCook IslandsChileCameroonChinaColombiaCosta RicaCubaCape VerdeChristmas IslandCyprusCzechiaGermanyDjiboutiDenmarkDominicaDominican RepublicAlgeriaEcuadorEstoniaEgyptWestern SaharaEritreaSpainEthiopiaFinlandFijiFalkland Islands (Malvinas)Faroe IslandsFranceFrance, MetropolitanGabonUnited KingdomGrenadaGeorgiaFrench GuianaGhanaGibraltarGreenlandGambiaGuadeloupeEquatorial GuineaGreeceGuatemalaGuamGuinea-BissauGuyanaHong KongHondurasCroatiaHaitiHungaryIndonesiaIrelandIsraelIndiaIraqIran, Islamic Republic ofIcelandItalyJamaicaJordanJapanKenyaKyrgyzstanCambodiaKiribatiComorosSaint Kitts and NevisKorea, Republic ofKuwaitCayman IslandsKazakhstanLebanonSaint LuciaLiechtensteinSri LankaLiberiaLesothoLithuaniaLuxembourgLatviaLibyan Arab JamahiriyaMoroccoMonacoMoldova, Republic ofMadagascarMarshall IslandsMacedoniaMaliMyanmarMongoliaMacauNorthern Mariana IslandsMartiniqueMauritaniaMontserratMaltaMauritiusMaldivesMalawiMexicoMalaysiaMozambiqueNamibiaNew CaledoniaNigerNorfolk IslandNigeriaNicaraguaNetherlandsNorwayNepalNauruNiueNew ZealandOmanPanamaPeruFrench PolynesiaPapua New GuineaPhilippinesPakistanPolandSaint Pierre and MiquelonPitcairn IslandsPuerto RicoPalestinian TerritoryPortugalPalauParaguayQatarReunionRomaniaRussian FederationRwandaSaudi ArabiaSolomon IslandsSeychellesSwedenSingaporeSaint HelenaSloveniaSvalbard and Jan MayenSlovakiaSierra LeoneSan MarinoSenegalSomaliaSurinameSao Tome and PrincipeEl SalvadorSyrian Arab RepublicSwazilandTurks and Caicos IslandsChadFrench Southern TerritoriesTogoThailandTajikistanTokelauTurkmenistanTunisiaTongaTimor-LesteTurkeyTrinidad and TobagoTuvaluTaiwanTanzania, United Republic ofUkraineUgandaUnited StatesUruguayUzbekistanHoly See (Vatican City State)VenezuelaVirgin Islands, BritishVirgin Islands, U.S.VietnamVanuatuWallis and FutunaYemenMayotteSerbiaSouth AfricaZambiaMontenegroZimbabweAnonymous ProxySatellite ProviderOtherAland IslandsGuernseyIsle of ManJerseySaint BarthélemyCuraçaoSaint Martin (French part)South SudanSint Maarten (Dutch part)--ASEUEUASASSASAEUASSAAFANSAOCEUOCSAASEUSAASEUAFEUASAFAFSAASSASASAASAFAFEUSANAASAFAFAFEUAFOCSAAFASSASASAAFASASEUEUAFEUSASAAFSAEUAFAFAFEUAFEUOCSAOCEUEUEUAFEUSAASSAAFEUSAAFAFSAAFEUSASAOCAFSAASAFSAEUSAEUASEUASASASASASEUEUSAASASAFASASOCAFSAASASASSAASASASSAEUASAFAFEUEUEUAFAFEUEUAFOCEUAFASASASOCSAAFSAEUAFASAFNAASAFAFOCAFOCAFSAEUEUASOCOCOCASSASAOCOCASASEUSAOCSAASEUOCSAASAFEUASAFASOCAFAFEUASAFEUEUEUAFEUAFAFSAAFSAASAFSAAFAFAFASASOCASAFOCASASSAOCASAFEUAFOCNASAASEUSASASASAASOCOCOCASAFEUAFAFEUAF------EUEUEUEU--------AF----APEUANDAREAFGATGAIAALBARMANTAGOAQARGASMAUTAUSABWAZEBIHBRBBGDBELBFABGRBHRBDIBENBMUBRNBOLBRABHSBTNBVBWABLRBLZCANCCCODCAFCOGCHECIVCOKCHLCMRCHNCOLCRICUBCPVCXCYPCZEDEUDJIDNKDMADOMDZAECUESTEGYESHERIESPETHFINFJIFLKFSMFROFRAFXGABGBRGRDGEOGUFGHAGIBGRLGMBGINGLPGNQGRCGSGTMGUMGNBGUYHKGHMHNDHRVHTIHUNIDNIRLISRINDIOIRQIRNISLITAJAMJORJPNKENKGZKHMKIRCOMKNAPRKKORKWTCYMKAZLAOLBNLCALIELKALBRLSOLTULUXLVALBYMARMCOMDAMDGMHLMKDMLIMMRMNGMACMNPMTQMRTMSRMLTMUSMDVMWIMEXMYSMOZNAMNCLNERNFKNGANICNLDNORNPLNRUNIUNZLOMNPANPERPYFPNGPHLPAKPOLSPMPCNPRIPSEPRTPLWPRYQATREUROURUSRWASAUSLBSYCSDNSWESGPSHNSVNSJMSVKSLESMRSENSOMSURSTPSLVSYRSWZTCATCDTFTGOTHATJKTKLTKMTUNTONTLSTURTTOTUVTWNTZAUKRUGAUMUSAURYUZBVATVCTVENVGBVIRVNMVUTWLFWSMYEMYTSRBZAFZMBMNEZWEA1A2O1ALAGGYIMNJEYBLMBESCUWMAFSSDSXM--APEUADAEAFAGAIALAMANAOAQARASATAUAWAZBABBBDBEBFBGBHBIBJBMBNBOBRBSBTBVBWBYBZCACCCDCFCGCHCICKCLCMCNCOCRCUCVCXCYCZDEDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRFXGAGBGDGEGFGHGIGLGMGNGPGQGRGSGTGUGWGYHKHMHNHRHTHUIDIEILINIOIQIRISITJMJOJPKEKGKHKIKMKNKPKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMGMHMKMLMMMNMOMPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPRPSPTPWPYQARERORURWSASBSCSDSESGSHSISJSKSLSMSNSOSRSTSVSYSZTCTDTFTGTHTJTKTMTNTOTLTRTTTVTWTZUAUGUMUSUYUZVAVCVEVGVIVNVUWFWSYEYTRSZAZMMEZWA1A2O1AXGGIMJEBLBQCWMFSSSX��@�f@Could not open gsb database "%s": %sCould not cannot get gsb malware file information "%s": %sCould not alloc memory for gsb dataCould not alloc memory for gsb table malwarearrayNew JSON hash key '%s'truefalseJSON parser initializationJSON depth limit exceededNew JSON hash context (prefix '%s')Adding JSON argument '%s' with value '%s'Skipping request argument, over limit (%s): name "%s", value "%s"yajl JSON parsing callback initializationJSON: Cleaning up JSON resultsLogging: Invalid phase %d/%s%s-%sactionsetrevversionseverityaccuracymaturityphaseis_chainedchain_startertagsoperator_paramnegatedconfigfilenameline_numunparsedis_matched%ldDETECTION_ONLYENABLED<Unknown Content-Type>transactiontimetransaction_idremote_addressremote_portlocal_addresslocal_portrequestrequest_lineAudit log: %sfake_bodyresponseprotocolstatusaudit_dataerror_messagesinterceptedmessagestopwatchp1p2p3p4p5swgcresponse_body_dechunkedproducersanitizedargsrequest_headersresponse_headerswebapp_infosessionuser_idsensor_idengine_moderules_performance_infouploadsfile_sizefile_namecontent_typetotalmatched_ruleschainfull_chain_match%s %d %d md5:%s, <Unknown ContentType>[%s] %s %s %u %s %u --%s-%c-- %s %s %s %u Message: %s Apache-Error: %s Apache-Handler: %s Stopwatch: %ld %ld (- - -) Stopwatch2: %ld %ld; %s Producer: %s. Producer: %s; %sServer: %s Sanitised-Args: %s"%s"%sSanitised-Request-Headers: Sanitised-Response-Headers: WebApp-Info: "%s" "%s" "%s" Sensor-Id: "%s" Engine-Mode: "%s" Rules-Performance-Info: %s"%s=%s"%s%d,%u,"%s","%s" Total,%u #%s %s
���̙��ܙ��������\���/%Y%m%d/%Y%m%d-%H%M/%Y%m%d-%H%M%SUnable to sanitize variable "%s" at offset %u (size %d) of QUERY_STRING because the request line is too short.Unable to sanitize variable "%s" at offset %u of QUERY_STRINGbecause the request line is too short.Audit log: Failed writing (requested %lu bytes, written %lu): %sGuardianLog: Atomic pipe write size too small: %dGuardianLog: Reduced remote_user to 32.GuardianLog: Reduced local_user to 32.GuardianLog: Atomic pipe write size too small: %d.GuardianLog: Reduced the_request to %d bytes.%s %s %s %s [%s] "%s" %u %s "%s" "%s" %s "%s"Audit log: Skipping request whose request_line is null.Audit log: Skipping request since there is nowhere to write to.Audit log: Failed to create subdirectories: %s (%s)Audit log: Failed to create file: %s (%s)Audit log: Failed to lock global mutex: %sAudit log: Failed to reconstruct request body.Audit log: Failed to unlock global mutex: %sAudit Log: Writing %lu bytes to primary concurrent indexAudit Log: Writing %lu bytes to secondary concurrent indexAction: Intercepted (phase %d) Response-Body-Transformed: Dechunked __msr__rulevalueLua: Executing script: %sluaL_mscmaingetvargetvarssetvarm.setvar: Failed m.setvar funtion must has 2 argumentsm.setvar: Must specify a collection using dot character - ie m.setvar(tx.myvar,mydata)SecRuleScript: Invalid transformation function: %sSecRuleScript: Transformation parameter must be a transformation name or array of transformation names, but found "%s" (type %d).ModSecurity: Failed to compile script %s: %sLua: Failed to restore script with %i.Lua: Script execution failed: %sLua: Script completed in %ld usec, returning: %s.boundary (quoted)Multipart: Invalid MIME type.Multipart: Boundary%s: %sContent-Dispositionfilename=%s/%s-%s-file-XXXXXX%s/%sMultipart: Added file part %pp to the list: name "%s" file name "%s" (offset %u, length %u)Multipart: Added part %pp to the list: name "%s" (offset %u, length %u)Multipart: Skipping invalid part %pp (part name missing): (offset %u, length %u)Multipart: Invalid quoting detected: %s length %d bytesMultipart: Content-Type header not available.Multipart: Invalid boundary in C-T (length).Multipart: Multiple boundary parameters in C-T.Multipart: Invalid boundary in C-T (malformed).Multipart: Invalid boundary in C-T (parameter name).Multipart: Invalid boundary in C-T (quote).Multipart: Invalid boundary in C-T (content).Multipart: Invalid boundary in C-T (characters).Multipart: Invalid boundary in C-T (empty).Multipart: Invalid boundary in C-T (case sensitivity).Multipart: Boundary not found in C-T.Multipart: Warning: seen data before first boundary.Multipart: Warning: seen data after last boundary.Multipart: Warning: boundary was quoted.Multipart: Warning: boundary whitespace in C-T header.Multipart: Warning: header folding used.Multipart: Warning: mixed line endings used (CRLF/LF).Multipart: Warning: incorrect line endings used (LF).Multipart: Warning: missing semicolon in C-T header.Multipart: Warning: invalid quoting used.Multipart: Warning: invalid part parsing.Multipart: Warning: invalid header folding used.Multipart: Warning: Invalid part (data contains final boundary)Multipart: No boundaries found in payload.Multipart: Final boundary missing.Multipart: Ignoring data after last boundary (received %u bytes)Multipart: Internal error in process_chunk: no space left in the bufferMultipart: Warning: Invalid part (data contains boundary)Multipart: Invalid boundary (final duplicate).Multipart: Invalid boundary: %sMultipart: Invalid boundary (quotes).Multipart: Invalid boundary (whitespace).Multipart: Ignoring data before first boundary.Multipart: Part header line over %d bytes longMultipart: Nul byte in part headers.Multipart: Part missing Content-Disposition header.Multipart: Warning: Duplicate Content-Disposition name: %sMultipart: Content-Disposition name: %sMultipart: Warning: Duplicate Content-Disposition filename: %sMultipart: Content-Disposition filename: %sMultipart: Invalid quoting detected: %s length %zu bytesMultipart: Invalid Content-Disposition header (%d): %s.Multipart: Content-Disposition header missing name field.Multipart: Invalid Content-Disposition header (filename).Multipart: Added part header line "%s"Multipart: Invalid part header (folding error).Multipart: Continued folder header "%s" with "%s"Multipart: Part header too long.Multipart: Invalid part header (colon missing): %s.Multipart: Invalid part header (header name missing).Multipart: Duplicate part header: %s.Multipart: Added part header "%s" "%s"Multipart: Upload file limit exceeded SecUploadFileLimit %d.Multipart: Failed to create file: %sMultipart: Created temporary file %d (mode %04o): %sMultipart: writing to "%s" failedMultipart: Added data to variable: %sMultipart: unknown part type %dMultipart: Ignoring data after last boundary (%u bytes left)Multipart: Cleanup started (remove files %d).Input filter: SecUploadDir is undefined, unable to store multipart files.Multipart: Failed to delete file (part) "%s" because %d(%s)Multipart: Deleted file (part) "%s"Multipart: Failed to delete empty file (part) "%s" because %d(%s)Multipart: Deleted empty file (part) "%s"Not moving part to identical locationInput filter: Failed to rename file from "%s" to "%s".Input filter: Moved file from "%s" to "%s".Cookie parser: Received null for argument.Adding request cookie: name "%s", value "%s"Adding request cookie: name "%s", value emptyAdding request argument (%s): name "%s", value "%s"$%s_%sSecArgumentsLimit exceeded-dev-rc -tw -trunk not allowed here takes no arguments takes one argument takes two arguments takes 1-2 arguments takes three arguments takes two or three arguments takes one or three arguments must be On or OffModSec-unique-id: %sModSec-status: %sModSec-key: %smodesecurityopensslUnknown command in config: remote server takes one, two or three arguments requires at least two arguments is improperly configured internally (server bug)Failed to retrieve beacon string%sFailed to download: "%s" error: %s. Failed to download: "%s" error: %s Internal error - apr_crypto_passphrase: Missing keyInternal error - apr_crypto_passphrase: APR_EPADDINGInternal error - apr_crypto_passphrase: APR_EKEYTYPEInternal error - apr_crypto_passphrase: Unknown errorFailed to download rules from a remote server: Unexpected content.Internal error: failed to init cryptoInternal error - apr_crypto_get_driver: Unknown errorInternal error - apr_crypto_make: Unknown errorInternal error - apr_crypto_block_decrypt_init: Missing keyInternal error - apr_crypto_block_decrypt_init: Missing IVInternal error - apr_crypto_block_decrypt_init: Wrong key typeInternal error - apr_crypto_block_decrypt_init: Wrong key lengthInternal error - apr_crypto_block_decrypt_init: Unknown errorInternal error - apr_crypto_block_decrypt: Failed to decryptInternal error - apr_crypto_block_decrypt_finish: Failed to decrypt\��t�����$�����|������������,�����t��Internal error, request body length will overflow: %uUnable to allocate memory to hold request body. Asked for %u bytes.Internal error, request body buffer overflow.Failed to create structure to hold request body.Input filter: Failed to generate an on-disk filename.Input filter: Failed to create temporary file: %sInput filter: Created temporary file to store request body: %sInput filter: Failed writing %lu bytes to temporary file (rc %lu).Multipart parsing error (init): %sUnknown request body processor: %sInput filter: Failed to prepare in-memory storage.Input filter: Request too large to store in memory, switching to disk.Input filter: Wrote %u bytes from memory to disk.Input filter: Failed to allocate %d bytes for request body chunk data.Internal error, unknown value for msc_reqbody_storage: %uUnable to allocate memory to hold request body on stream. Asked for %lu bytes.%s parsing error (complete): %sMultipart parsing error: Failed to retrieve arguments.Initialisation: Error occurred while parsing BODY arguments.Request body no files length: %luFailed to allocate %d bytes for request body disk chunk data.Failed to open temporary file for reading: %sInternal error, retrieving request body chunk.Input filter: Error reading from temporary file: %sInternal error, invalid msc_reqbody_storage value: %uInput filter: SecUploadDir is undefined, unable to store PUT file.Not moving file to identical location.Input filter: Failed to generate basename to PUT file "%s"Input filter: Failed to generate filename to PUT file "%s"Input filter: Failed to delete temporary file: %sInput filter: Removed temporary file: %s%s/%s-%s-request_body-XXXXXX%s parsing error (init): %sXML parsing error (init): %sJSON parsing error (init): %s%s parsing error: %sMultipart parsing error: %sXML parsing error: %sJSON parsing error: %sJSON parser error: %sXML parser error: %sPUTTreePrefixNetmask: prefix is NULL.TreePrefixNetmask: Cannot find a prefix with correct netmask.TreePrefixNetmask: Found a prefix with correct netmask.TreePrefixNetmask: Check if a prefix has a the correct netmaskCPTRetriveNode: Node tree is NULL.CPTRetriveNode: Empty ip address. Nothing to search for.CPTRetriveNode: Found the node for provided ip address.CPTFindElementIPNetblock: Node tree is NULL.CPTFindElementIPNetblock: Found a tree node but netmask is different.CPTFindElementIPNetblock: Found a tree node but prefix is NULL.CPTFindElementIPNetblock: Node found for provided ip addressCPTFindElement: Tree is NULL. Cannot proceed searching the ip.CPTFindElement: Tree head is NULL. Cannot proceed searching the ip.CPTFindElement: Netmask cannot be greater than 255CPTFindElement: Found a tree node but netmask is different.CPTFindElement: Node tree is NULL.CPTFindElement: Found a tree node but prefix is NULL.CPTFindElement: Node found for provided ip addressCPTIpMatch: Tree is NULL. Cannot proceed searching the ip.CPTIpMatch: Empty ip address. Nothing to search for.CPTIpMatch: Searching ip type 0x%xCPTIpMatch: Unknown ip type 0x%xCould not open unicode map file "%s": %sCould not cannot get unicode map file information "%s": %sCould not alloc memory for unicode map
������������ !"#$%&'()*+,-./0123��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������Content length is 0.Unsupported escape sequence./tmp/TMPDIRTEMPTMP%d/%b/%Y:%H:%M:%S.%06ld %c%.2d%.2d%Y%m%d-%H%M%Squotampgtnbsp%02i%02i%02i%1i%02i%s%s: %s Error allocating memory for pattern matching content.Added phrase match to TX.%d: %sFailed allocating memory to TreeRoot.IPmatch: Tree initialization failed.Could not open ipmatch file "%s": %sCould not read "%s" line %d: %sInvalid char "%c" in line %d of file %sCould not add entry "%s" in line %d of file %s to IP listInvalid char "%c" in line %d of uri %sIPmatch: bad IPv4 specification "%s".IPmatch: bad IPv6 specification "%s".Could not add entry "%s" from: %s.XML: Initialising parser.body.xmlXML: Failed parsing document.XML: Failed to create parsing context.XML: Parsing complete (well_formed %u).collection_unpack: BLOB[%d]: %scollection_unpack: Possibly corrupted database: var name length = 0 at blob offset %u-%u.collection_unpack: Read variable: name "%s", value "%s".collection_retrieve_ex: Unable to retrieve collection (name "%s", key "%s"). Use SecDataDir to define data directory first.collection_retrieve_ex: collection_retrieve_ex: Retrieving collection (name "%s", filename "%s")collection_retrieve_ex: Failed to read from DBM file "%s": %scollection_retrieve_ex: Removing key "%s" from collection.collection_retrieve_ex: Removed expired variable "%s".collection_retrieve_ex: Failed to access DBM file "%s": %scollection_retrieve_ex: Failed deleting collection (name "%s", key "%s"): %scollection_retrieve_ex: Collection expired (name "%s", key "%s").collection_retrieve_ex: Deleted collection (name "%s", key "%s").collection_retrieve_ex: Retrieved collection (name "%s", key "%s").collection_retrieve_ex: Internal Error: Collection remained open (name "%s", key "%s").collection_store: Unable to store collection (name "%s", key "%s"). Use SecDataDir to define data directory first.collection_store: Retrieving collection (name "%s", filename "%s")collection_store: Failed to access DBM file "%s": %scollection_store: Failed to exclusivly lock DBM file "%s": %scollection_store: Re-retrieving collection prior to store: %scollection_store: Delta applied for %s.%s %d->%d (%d): %d + (%d) = %d [%s,%d]collection_store: Wrote variable: name "%s", value "%s".collection_store: Failed to write to DBM file "%s": %scollection_store: Persisted collection (name "%s", key "%s").collections_remove_stale: Retrieving collection (name "%s", filename "%s")collections_remove_stale: Failed to access DBM file "%s": %scollections_remove_stale: Failed to lock DBM file "%s": %scollections_remove_stale: Found %d record(s) in file "%s".collections_remove_stale: Failed reading DBM file "%s": %scollections_remove_stale: Collection cleanup discovered entry with no __expire_KEY (name "%s", key "%s").collections_remove_stale: Record (name "%s", key "%s") set to expire in %ld seconds.collections_remove_stale: Failed deleting collection (name "%s", key "%s"): %scollections_remove_stale: Removed stale collection (name "%s", key "%s").__expire___expire_KEYCREATE_TIMEUPDATE_COUNTERUPDATE_RATE__name__keyIS_NEWTIMEOUTLAST_UPDATE_TIMEloggingemergencyalertcriticalerrorwarningnoticedebugARGS:ARGS_NAMES:REQUEST_HEADERS:REQUEST_HEADERS_NAMES:RESPONSE_HEADERS:RESPONSE_HEADERS_NAMES:ruleEngineCtl: Set ruleEngine to %s.HashEnforcementCtl: Set HashEngine to %s.ruleRemoveByIdCtl: Removed rule by id : %s.ruleRemoveByTagruleRemoveByMsgrequestBodyAccessforceRequestBodyVariablerequestBodyProcessorresponseBodyAccessauditEngineCtl: Set auditEngine to %d.auditLogPartsCtl: Set auditLogParts to %s.debugLogLevelCtl: Set debugLogLevel to %d.requestBodyLimitresponseBodyLimitruleRemoveTargetByIdruleRemoveTargetByTagruleRemoveTargetByMsgInvalid ctl name setting: %sFailed to execute: %sT (%d) %s: "%s"Deprecating variable: %s=%sExpiring variable: %s=%s__expire_%sSetting env variable: %s=%sUnset env variable "%s".Set env variable "%s" to: %s[nocanon]proxy-nocanon%s_USER%s_RESOURCE%s_SESSIONSetting variable: %s=%stxUnset variable "%s.%s".Relative change: %s=%d%sSet variable "%s.%s" to "%s".markermsglogdatanolognoauditlogblockdenydroppauseredirectproxyskipskipAfterallowctlxmlnscapturesanitiseArgsanitiseMatchedBytessanitizeMatchedBytessanitizeArgsanitiseMatchedsanitizeMatchedsanitiseRequestHeadersanitizeRequestHeadersanitiseResponseHeadersanitizeResponseHeadersetenvexpirevardeprecatevarinitcolsetsidsetrscsetuidexecmultiMatchprependappendInvalid parameter for allow: %ssanitizeMatched: Don't know how to handle variable: %sMissing xmlns href for prefix: %sCtl: Set HashEnforcement to %s.ModSecurity: Invalid regular expression "%s"Ctl: Removed rule by tag : %s.Ctl: Removed rule by msg : %s.Ctl: Set requestBodyAccess to %d.Ctl: Set requestBodyProcessor to %s.Ctl: Set responseBodyAccess to %d.Ctl: Set requestBodyLimit to %ld.Ctl: Set responseBodyLimit to %ld.Ctl: ruleRemoveTargetById id=%s targets=%sModSecurity: Missing target for id "%s"Ctl: ruleRemoveTargetByTag tag=%s targets=%sModSecurity: Missing target for tag "%s"Ctl: ruleRemoveTargetByMsg msg=%s targets=%sModSecurity: Missing target for msg "%s"Internal Error: Unknown ctl action "%s".Missing ctl value for name: %sInvalid setting for ctl name ruleEngine: %sInvalid setting for ctl name requestBodyAccess: %sInvalid setting for ctl name forceRequestBodyVariable: %sInvalid setting for ctl name responseBodyAccess: %sInvalid setting for ctl name auditEngine: %sInvalid setting for ctl name auditLogParts: %sInvalid setting for ctl name debugLogLevel: %sInvalid setting for ctl name requestBodyLimit: %sRequest size limit cannot exceed the hard limit: %ldInvalid setting for ctl name responseBodyLimit: %sResponse size limit cannot exceed the hard limit: %ldruleRemoveTargetById must has at least id;VARIABLEruleRemoveTargetByTag must has at least tag;VARIABLEruleRemoveTargetByMsg must has at least msg;VARIABLEInvalid setting for ctl name HashEnforcement: %sInvalid setting for ctl name HashEngine: %sModSecurity: Invalid value for action ID: %sInvalid transformation function: %sWarning: Possibly unterminated macro: "%s"Resolved macro %%{%s%s%s} to: %sFailed to resolve macro %%{%s%s%s}: %sFailed to allocate space to expand name macrosCould not deprecate variable "%s.%s" as the collection does not exist.Asked to deprecate variable "%s", but no collection name specified. Asked to deprecate variable "%s.%s", but it does not exist.Incorrect format for the deprecatevar argument: "%s"Deprecated variable "%s.%s" from %ld to %ld (%ld seconds since last update).Not deprecating variable "%s.%s" because the new value (%ld) is the same as the old one (%ld) (%ld seconds since last update).Could not expire variable "%s.%s" as the collection does not exist.Asked to expire variable "%s", but no collection name specified. Variable "%s.%s" set to expire in %s seconds.Failed to allocate space to expand value macrosInternal Error: Attempt to record NULL original variable.Failed to allocate space for original collection.Original collection variable: %s.%s = "%s"Failed to allocate space for original collection variable.Recorded original collection variable: %s.%s = "%s"Creating collection (name "%s", key "%s").Setting default timeout collection value %d.Added collection "%s" to the list as "%s".Added collection "%s" to the list.Asked to set variable "%s", but no collection name specified. Could not set variable "%s.%s" as the collection does not exist.Warning.HTTP_REQUEST_HEADERSUnknown variable: %sUnknown action: %sphase:2,log,auditlog,pass [file "%s"] [line "%d"] [id "%s"] [rev "%s"] [msg "%s"] [data "%s [severity "%s"] [ver "%s"] [maturity "%d"] [accuracy "%d"]%s [tag "%s"]SecRule "%s" "%s"SecRule "%s" "%s" "%s"SecAction "%s"SecMarker "%s"SecRuleScript "%s"SecRuleScript "%s" "%s"re.c%s|rxError creating rule: %sError parsing actions: %s%s%s:%sTarget value: "%s"Operator error: %s%.252s ...chained Found rule %pp id="%s".Rule %pp: %sRule returned %d.%s|%sExpanded "%s" to "%s".CACHE: Enabled%x;%sMatch -> mode NEXT_RULE.Skipping %d rules/chains.EMERGENCYALERTCRITICALNOTICEDEBUGUnexpected character at position %d: %sMissing closing quote at position %d: %sInvalid quoted pair at position %d: %sThe & modificator does not apply to non-collection variables.Missing mandatory parameter for variable %s.Variable %s does not support parameters.Internal error: msre_actionset_create, not able to create actions tableInternal error: msre_parse_actions, failed to create vartableInternal error: msre_parse_actions, msre_parse_generic failed. Return code: %dMissing mandatory parameter for action %sExtra parameter provided to action %sAction %s does not allow +/- modificators.Internal error: msre_parse_actions, msre_create_action failed.Internal error: msre_actionset_create, msre_parse_actions failed without further information. Return code: %dError creating memory pool: %dError to update target - memory allocationError to update target - [%s] is not valid targetTrying to replace by variable name [%s] value [%s] ModSecurity: Trying to replace by variable name [%s] value [%s]Error parsing rule targets to replace variable ModSecurity: Error parsing rule targets to replace variableSuccessfully replaced variable ModSecurity: Successfully replaced variableCannot find variable to replace ModSecurity: Cannot find varibale to replaceTrying to append variable name [%s] value [%s] ModSecurity: Trying to append variable name [%s] value [%s]Error parsing rule targets to append variable ModSecurity: Error parsing rule targets to append variableSkipping variable, already appended ModSecurity: Skipping variable, already appendedSuccessfully appended variable ModSecurity: Successfully appended variableError creating rule: Failed to resolve operator: %sTrying to update without a targetfetch_target_exception: Found exception target list [%s] for rule id %sfetch_target_exception: Target %s will not be processed.fetch_target_exception: No exception target found for rule id %s.Executing operator "%s%s" with param "%s" against %s skipped.Executing operator "%s%s" with param "%s" against %s.Operator completed in %ld usec.Match of "%s %s" against "%s" required.Internal Error: Invalid phase %dThis phase consists of %d rule(s).Current rule is id="%s" [chained %d] is trying to find the SecMarker="%s" [stater %d]Continuing execution after rule id="%s".Checking removal of rule msg="%s" against: %sChecking removal of rule id="%s" against: %sChecking removal of rule tag="%s" against: %sNot processing %srule id="%s": removed by ctl actionRecipe: Invoking rule %pp;%s%s%s.CACHE: Disabled - &%s is dynamicCACHE: Disabled - %s is not yet available in phase %d (requires phase %d or later)CACHE: Disabled - %s value length=%u, smaller than minlen=%luCACHE: Disabled - %s value length=%u, larger than maxlen=%luCACHE: %s transformations are not cacheableT (%d) %s: "%s" [fully cached hits=%d]Transformation completed in %ld usec.T (%d) %s: "%s" [partially cached hits=%d]CACHE: Disabled - phase=%d maxitems=%lu limit reached.No match, chained -> mode NEXT_CHAIN.No match, not chained -> mode NEXT_RULE.Match, intercepted -> returning.Skipping after rule %pp id="%s" -> mode SKIP_RULES.Skipping %d rules/chains (from a chain).Rule processing failed (id=%s, msg=%s).Ruled failed, chained -> mode NEXT_CHAIN.Rule failed, not chained -> mode NEXT_RULE.Rule processing failed with unknown return code: %d (id=%s, msg=%s).p��0��@��P��`������������������Z���Unconditional match in SecAction.Error validating UTF-8 decoding at %s. [offset "%d"]Invalid UTF-8 encoding: not enough bytes in character at %s. [offset "%d"]Invalid UTF-8 encoding: invalid byte value in character at %s. [offset "%d"]Invalid UTF-8 encoding: overlong character detected at %s. [offset "%d"]Invalid UTF-8 encoding: use of restricted character at %s. [offset "%d"]Invalid URL Encoding: Internal Error (rc = %d) at %sInvalid URL Encoding: Non-hexadecimal digits used at %s.Invalid URL Encoding: Not enough characters at the end of input at %s.Internal Error: validateByteRange table not initialised.Value %d in %s outside range: %sFound %d byte(s) in %s outside range: %s.Missing parameter for validateByteRange.Operator @inspectFile requires parameter.Harvester and comment spammer IPSuspicious harvester comment spammer IPRBL httpBl called but no key defined: set SecHttpBlKeyRBL lookup of %s succeeded at %s (BLACK).RBL lookup of %s succeeded at %s (GREY).RBL lookup of %s succeeded at %s (RED).RBL lookup of %s succeeded at %s (BLACK,GREY,RED).RBL lookup of %s succeeded at %s (DNS IS BLOCKED).RBL lookup of %s succeeded at %s (WHITE).RBL lookup of %s succeeded at %s (Static UBE sources).RBL lookup of %s succeeded at %s (Illegal 3rd party exploits).RBL lookup of %s succeeded at %s (Delivering unauthenticated SMTP email).RBL lookup of %s succeeded at %s.RBL lookup of %s failed: bad responseRBL lookup of %s succeeded at %s. %s: %d days since last activity, threat score %dRBL lookup of %s failed at %s.Error compiling pattern (offset %d): %sGeo lookup for "%s" attempted without a database. Set SecGeoLookupDB.Geo lookup for "%s" failed at %s.Geo lookup for "%s" succeeded at %s.GEO: %s={country_code=%s, country_code3=%s, country_name=%s, country_continent=%s, region=%s, city=%s, postal_code=%s, latitude=%f, longitude=%f, dma_code=%d, area_code=%d}Internal Error: regex data is null.Continuing CC# search at target offset %d.CC# regex execution failed: %sCC# Luhn check failed at target offset %d: "%.*s"Added regex subexpression to TX.%d: %sCC# match "%s" at %s. [offset "%d"]Continuing CPF# search at target offset %d.CPF# regex execution failed: %sCPF# check failed at target offset %d: "%.*s"CPF# match "%s" at %s. [offset "%d"]Internal Error: match string is null.String match within "%s" at %s.detected SQLi using libinjection with fingerprint '%s'ISSQL: libinjection fingerprint '%s' matched input '%s'ISSQL: not sqli, no libinjection sqli fingerprint matched input '%s'Missing parameter for operator 'pmFromFile'.HTTPS address or file path are expected for operator pmFromFile "%s"Could not open phrase file "%s": %sMissing parameter for operator 'pm'.Matched phrase "%.252s ..." at %s.Added phrase match to TX.0: %sRule %pp [id "%s"][file "%s"][line "%d"] - Execution error - PCRE limits exceeded (%d): %sRequest URI matched "%.252s ..." at %s.Request URI matched "%s" at %s.Request URI without hash parameter [%s]Request URI matched "%.252s ..." at %s. No Hash parameterRequest URI matched "%s" at %s. No Hash parameterRequest URI matched "%.252s ..." at %s. Hash parameter hash value = [%s] Requested URI hash value = [%s]Request URI matched "%s" at %s. Hash parameter hash value = [%s] Requested URI hash value = [%s]Ignoring regex captures since "capture" action is not enabled.Pattern match "%.252s ..." at %s.Operator rsub only works with STREAM_* variablesipMatchFromFile: tree value is null.IPmatchFromFile: Total tree entries: %d, ipv4 %d ipv6 %dIPmatchFromFile: "%s" matched at %s.ipMatch Internal Error: ipmatch value is null.Missing parameter for operator 'ipmatchFromFile'.Empty file specification for operator ipmatchFromFile "%s"HTTPS address or file path are expected for operator ipmatchFromFile "%s"Error rsub operator format, must be s/ patternError rsub operator format - must be s/regex/str/[flags]Error rsub operator parsing input dataModSecurity was not compiled with ssdeep support.Internal Error: strnmatch data is null.Execution of the approver script "%s" failed (invocation failed).Execution of the approver script "%s" failed (no output).File "%s" rejected by the approver script "%s": %sInternal Error: regex is null.GSB lookup failed without a database. Set SecGsbLookupDB.Internal Error: cannot allocate memory for match.GSB: Successfully extracted url: %sGsb lookup for "%s" succeeded.Continuing SSN# search at target offset %d.SSN# regex execution failed: %sSSN# check failed at target offset %d: "%.*s"SSN# match "%s" at %s. [offset "%d"]XML document tree could not be found for schema validation.XML: Schema validation failed because content is not well formed.XML: Schema validation could not proceed due to previous processing errors.XML: Failed to load Schema from file: %sXML: Failed to load Schema: %sXML: Failed to create validation context.XML: Schema validation failed.XML: Successfully validated payload against Schema: %sXML document tree could not be found for DTD validation.XML: DTD validation failed because content is not well formed.XML: DTD validation could not proceed due to previous processing errors.XML: Failed to create a validation context.XML: Successfully validated payload against DTD: %sdetected XSS using libinjection.IS_XSS: libinjection detected XSS.IS_XSS: not XSS, libinjection was not able to find any XSS.No match.Valid URL Encoding at %s.Operator EQ matched %d at %s.Invalid range value: %dInvalid range start value: %dInvalid range end value: %dInvalid range: %d-%dSearch EngineSuspicious IPHarvester IPSuspicious harvester IPComment spammer IPSuspicious comment spammer IP%d.%d.%d.%dhttpbl.org%s.%d.%d.%d.%d.%suribl.comspamhaus.orgCOUNTRY_CODECOUNTRY_CODE3COUNTRY_NAMECOUNTRY_CONTINENTREGIONCITYPOSTAL_CODELATITUDE%fLONGITUDEDMA_CODEAREA_CODE%iError compiling pattern: %sString match "" at %s.String match "%s" at %s.String match within "" at %s.http://https://<Unknown Match>ACMPTree is null.Matched phrase "%s" at %s.Escaping pattern [%s]Validating URI %s size %zuPattern match "%s" at %s.STREAM_OUTPUT_BODYSTREAM_INPUT_BODYOperator rsub succeeded.IPmatch: "%s" matched at %s.Regex flag not supportedOperator GE matched %d at %s.Operator LE matched %d at %s.Operator LT matched %d at %s.Operator GT matched %d at %s.Executing %s to inspect %s././http%s/?%d%d%d%dXML: Failed to load DTD: %sXML: DTD validation failed.ipmatchipmatchFromFileipmatchfrsubvalidateHashpmpmFromFilepmfwithincontainscontainsWorddetectSQLidetectXSSstreqbeginsWithendsWithstrmatchvalidateDTDvalidateSchemaverifyCCverifyCPFverifySSNgeoLookupgsbLookuprblinspectFilefuzzyHashvalidateByteRangevalidateUrlEncodingvalidateUtf8Encoding������������������_����� base64Decodebase64EncodecompressWhitespacecssDecodeescapeSeqDecodesqlHexDecodehexDecodehexEncodehtmlEntityDecodejsDecodelengthlowercasemd5normalisePathnormalizePathnormalisePathWinnormalizePathWinparityEven7bitparityZero7bitparityOdd7bitremoveWhitespaceremoveNullsreplaceNullsremoveCommentsremoveCommentsCharreplaceCommentssha1trimtrimLeftcmdlinetrimRighturlDecodeurlDecodeUniUtf8toUnicodeurlEncodebase64DecodeExt܆��܆��������܆��������������������������������������������������������܆��������������������������������������܆���������������������������������������������܆�������������������������������������������������������������������������������������������������������������[XML document tree]TX:%sGEO:%sFILES_NAMES:%sARGS_NAMES:%sARGS:%s%02d%02d%02d%02d%02d%02d%02dPERF_RULES:%sRESPONSE_HEADERS_NAMES:%sRESPONSE_HEADERS:%sREQUEST_HEADERS_NAMES:%sREQUEST_HEADERS:%sREQUEST_COOKIES_NAMES:%sREQUEST_COOKIES:%sMULTIPART_PART_HEADERS:%sFILES_TMPNAMES:%sFILES_SIZES:%sFILES:%suserUSER:%sSESSION:%sresourceRESOURCE:%sIP:%sglobalGLOBAL:%sMATCHED_VARS:MATCHED_VARS_NAMES:FILES_TMP_CONTENT:%sARGS_POST_NAMES:%sARGS_POST:%sARGS_GET_NAMES:%sARGS_GET:%sParameter required for ENV.%04x0.0.0.0ARGSARGS_COMBINED_SIZEARGS_GETARGS_GET_NAMESARGS_NAMESARGS_POSTARGS_POST_NAMESAUTH_TYPEENVFILESFILES_COMBINED_SIZEFILES_NAMESFILES_SIZESFILES_TMPNAMESFILES_TMP_CONTENTMULTIPART_PART_HEADERSGEOGLOBALHIGHEST_SEVERITYMATCHED_VARMATCHED_VAR_NAMEMODSEC_BUILDMULTIPART_FILENAMEMULTIPART_NAMEMULTIPART_BOUNDARY_QUOTEDMULTIPART_BOUNDARY_WHITESPACEMULTIPART_DATA_AFTERMULTIPART_DATA_BEFOREMULTIPART_HEADER_FOLDINGMULTIPART_CRLF_LINEMULTIPART_CRLF_LF_LINESMULTIPART_LF_LINEMULTIPART_MISSING_SEMICOLONMULTIPART_INVALID_PARTMULTIPART_INVALID_QUOTINGMULTIPART_FILE_LIMIT_EXCEEDEDMULTIPART_STRICT_ERRORMULTIPART_UNMATCHED_BOUNDARYPATH_INFOUSERAGENT_IPREMOTE_HOSTREMOTE_PORTREMOTE_USERREQBODY_PROCESSORSDBM_DELETE_ERRORREQBODY_PROCESSOR_ERRORREQBODY_PROCESSOR_ERROR_MSGREQBODY_ERRORREQBODY_ERROR_MSGREQUEST_BASENAMEFULL_REQUESTFULL_REQUEST_LENGTHREQUEST_BODYREQUEST_BODY_LENGTHMATCHED_VARS_NAMESMATCHED_VARSREQUEST_COOKIESREQUEST_COOKIES_NAMESREQUEST_FILENAMEREQUEST_HEADERS_NAMESREQUEST_LINEREQUEST_METHODREQUEST_PROTOCOLREQUEST_URIREQUEST_URI_RAWRESPONSE_BODYRESPONSE_CONTENT_LENGTHRESPONSE_CONTENT_TYPERESPONSE_HEADERSRESPONSE_HEADERS_NAMESRESPONSE_PROTOCOLRESPONSE_STATUSRULESCRIPT_GIDSCRIPT_BASENAMESCRIPT_FILENAMESCRIPT_GROUPNAMESCRIPT_MODESCRIPT_UIDSCRIPT_USERNAMESERVER_ADDRSERVER_NAMESERVER_PORTSESSIONIDSTATUS_LINEURLENCODED_ERRORINBOUND_DATA_ERROROUTBOUND_DATA_ERRORUSERIDPERF_RULESPERF_ALLPERF_COMBINEDPERF_GCPERF_LOGGINGPERF_PHASE1PERF_PHASE2PERF_PHASE3PERF_PHASE4PERF_PHASE5PERF_SREADPERF_SWRITEDURATIONTIME_DAYTIME_EPOCHTIME_HOURTIME_MINTIME_MONTIME_SECTIME_WDAYTIME_YEARTXWEBAPPIDWEBSERVER_ERROR_LOGXML: Unable to create new XPath context.Failed to register XML namespace href "%s" prefix "%s".Registered XML namespace href "%s" prefix "%s".XML: Unable to evaluate xpath expression.Set variable "%s" value "%s" size %d to collection.Set variable "%s" size %d to collection.Regular expressions not supported in ENV.Variable FULL_REQUEST failed. Problems to measure headers length.Variable FULL_REQUEST will not be created, not enough memory available.Variable FULL_REQUEST will not be created, failed to fill headers buffer.combined=%ld, p1=%ld, p2=%ld, p3=%ld, p4=%ld, p5=%ld, sr=%ld, sw=%ld, l=%ld, gc=%ldMULTIPART_INVALID_HEADER_FOLDING;�������8������������lȝ��������x���0����|ؤ����������������0(���D8���Xh���lx��������������ȥ������8�������H����dب���ة��\ت������8h���d�����(�������<��������������H���8H���lh����H���ظ��HH���������(��������( ���` ����� ����� h���!����<!8���P!�����!ؽ���!x���"���L"�����"h����"���4#����l#���#���$X��D$���$����$8��(%���p%X���%���&h��D&����&����&���('��d'x���'����'h��(��h(����(���,)(���)x��*���$*���@*H���*����*���(+8��x+���,h��L,���,h���,x��-���T-����-���-��.�X.X����.���</����x/H����/���� 0X���t0����0�����0x��,18��x1H���1��2h��D2���x2X���2��3h��l3( ���3� ���3X"��04�"��X4�"��l4(#���4�#���4�#���4�#���4$��5�$��T5H&���5�'���5�)���68*���6+���6�+��P7�,���7�-���7x3���8�3���8(4���8�4���8�4���85��9H5��9x5��,9�5��@9�7��d989���9;��(:�<��t:�?���:(@��;X@�� ;�B��l;�G���;�H��<hK��l<�L���<XM���<(P��=8P��0=xP��D=�P��X=8R���=�R���=xS�� >HZ���>h[���>x[���>h\��?�\��,?]��X?H]��l?�t���?�u���?�v��@�z��x@�z���@{���@8{���@�|��AH}��XA8����A�����A����XB����B؇���BH���$C�����C����Dؐ�� DX����E�����E�����E���E����Fx���XF�����F(����FX���G����DG(����G�����G����Hx���DHx���pHx����HX����HȰ���H���I����TI(����Ih����Ix����I����J��XJ����J���JH��K���dKH���K���L���dL����L8��@MX��|M����M���N��hN����NX�O��\O��O�����OH���,P(���P����P8��Q���@QH��|QH���Q����QX��$R8 ��tRH ���RX ���R� ���R� ���R� ���Rh��TS(���Sh���S8��T���@TH���T(���T���0U��|UH���Ux��V�;��PVhX���V�X���V�X���V8Y��WXZ��dW�Z���W�\���WX^��4XX`���X(a���X�c��@YXd��pY(h���Yi��8Zhn���Z�r���Z����@[����[�����[���H\H����\�����\���@]�����]���]X���^x���,^����@^����`^8����^X����^Ȣ���^���_��\_���_����`x���\`����x`����`X���Da(����a�����aظ���aH���(b8���tb����b���@c(��xch���c���c��dH��4d���Hd���`d���|dX���d��8eh��Le���`e���te����e����e����e���df(��xf8���f���f8���f��LgX��g���g��Xh���h��h��DiX�i��i(��iH���(j����Pj���xj�����j���j(����j���,k��|k����k�����k�����k����,l���Ll���lh����l���l(����l�����l���m��Hmx��|m����m����m���mX��n���<n���dn���xn����nx���n8���n��oX ��to8 ���o���pX��Tp���p���qH��dq����q8���q��$r���8r��lr( ���r� ��s8!��Ls�#���s�%���s�&��Pt�'���tx(���t�(��u�(��$u�)��pu�*���u8+���u8-��vh5��tv�5���vh?��4w�E���w�E���w�E���w�E���wF���wF��x(F�� x8F��4xXF��HxhF��\xxF��px�F���x�F���x�F���x�F���x�F���xG���x8G���xXG��yhG��$yxG��8yH���y�H���yI���y8I��zhI��z�I��4z�I��Pz�I��lz�I���z�J���z�K��{xL��D{(O���{�O���{hP���{�[��<|�b���|�c���|(d��}�d��\}(e���}8e���}He���}Xe���}he���}xe���}�e��~�e��~�e��0~g��|~�h���~�m��dn����n����r��D��u��Āx��,��x��l�Xy����H{���x���@�(���|�ȁ����x����H���T�Ȉ��ԃh����(�����8���$�����\�h���؉���� �����h�H�����X���ȊH����H���h�h���|�h���ȋ����8��� �����4�Ȩ��T�x����������ت��،(���X�H����ȿ������8�������������0����D��������������h�X����L�8��H��X��h����В�������@�����������8���d�8������� ����X����l������������ ��(���������h��$����p��������h��T�X ���"��d�#����($���8$���*��`�X+�����-����2�����:���X@��D�hA����XB����D��X�HE����XH��НXI���XJ��X�XK����XL����L����XM��X�O�����O���HY��T�`����Hb���d��L��d����8e��ءHe����e��$��e��8��i��X�j��l�xl����xn���Ho��$��o��\��o����p����Hp��ܣ�p���q��\��q����r����r��4��s����t��̥Ht�����t��,��t��d�u����Xu��Ħ�u�����u��$��u��P�(v��|�hv�����v����v��(�Xw��`��w��t�Hx�����x��بHy�� �Xz��x��z��̩8{����H{���x~��(��~��<���x��������������$�(���\�����8�������4�X���������̬���������d�H�����Ȍ���h��� �����X����������Ȯ�����8���8�Ȑ��p�����������h���<����������X��� �����l�������H����(���P�������X����ء��4�8���������̳�����X���d�������ت������P�h�����Ȱ���8���8����������жص���8���<�x���h�����|�ض���������8��������������P��������������H����x���(�����<�����t�(�����X���������Թ�����(��� �x���X�ȼ����������(�����x���������ؽ������,�8���@�h���T�����������8���ػh���������ȿ���h���(�����<����P������H���������8��0����p������H����������P�H�������Ծ���X��D�h��X����l������(����h������������п(���h����������� �8��4�x��H����\����p�8����x���������(���H����h������ ����4����H����\���p�(����H���������(�������4���l������zRx�$�j���FJw�?;*3$"(DH���oF�G�G WAAA��Tp����DB�E�H �E(�D0�G8�FP�XO`RXAPM 8A0A(B BBBFT������B�E�B �E(�A0�A8�D`hlpThA`m 8A0A(B BBBA, �����B�H�D �F0� DAB8P�����B�B�A �A(�G0p (A ABBEH�@���,B�B�B �B(�A0�A8�Dp� 8A0A(B BBBI`�$���*B�E�B �B(�A0�D8�GP� 8C0A(B BBBG_ 8F0A(B BBBA<�P��d��x������܋���؋��"�� �� ����������A�U44���OB�D�F �m CBJACB4l ���GB�D�F �h CBGACB�8���A�Yd�<���.B�B�E �J(�D0�D8�D@) 8C0A(B BBBD� 8K0A(B BBBL�(����B�E�E �J(�D0�D8�D@X 8L0A(B BBBID 8J0A(B BBBII 8K0A(B BBBKD8C0A(B BBB��t����B�E�E �J(�D0�D8�D@X 8L0A(B BBBID 8J0A(B BBBII 8K0A(B BBBKD8C0A(B BBBHH��-B�B�B �J(�A0�D8�GP� 8C0A(B BBBB(�Ȑ��[B�D�I �FCB�������B�B�B �B(�A0�A8�DP� 8A0A(B BBBJ� 8A0A(B BBBDU 8A0A(B BBBAX 8A0A(B BBBFT����0dK(l���eB�D�A �| CBHT�T���A�D�G0i AAIW AAGj8a@HHHPR0\8a@HHHPK0P�����B�A�D �T CBHO CBLG ABFE KBF$D����KA�G n CGIA$l��KA�G n CGIA0�����B�L�A �J�g DABIT�ԕ��N�D�B �E(�A0�C8�D�_ 8A0A(B BBBF�������< �����_�F�G �D(�K0�(C ABBD����@`<����B�F�D �v CBIE HIJOCB4�����kG�F�D �p ABDO�C�B�4�����kG�F�D �p ABDO�C�B�4 ����kG�F�D �p ABDO�C�B�4L 0���kG�F�D �p ABDO�C�B�4� h���kG�F�D �p ABDO�C�B�4� ����sG�F�D �s ABIO�C�B�4� ��kY�K�J U CAIHF�H�4, ���kY�K�J U CAIHF�H�0d X���KA�F�O U CAAHFH� t���v4� ��GB�D�G �] CBIKAB4� ����JB�D�G �] CBIDAL@����J�K�O o CAIH J�A�MNCAF��D`l����K�G�K �m ABCP �C�B�KTABI���D�Ĝ���K�G�K �l ABDP �C�B�KMABH���P�����K�K�G �A ABGO ABFO ABFO�C�B�HDx����K�G�K �K �C�B�KM ABHIABD���4�ܝ��cF�G�N W CAJYCAC��D�����K�G�K �l ABDP �C�B�KMABH���L \����J�N�G } CAHN CAFN CAFHF�H�<` ̞��{A�N�G j CADH FHJNCAP� ����K�K�G �M ABCL ABAL ABAO�C�B�D� x����G�D�D �y ABEF �K�D�KJABC���D<�����G�D�D �y ABEF �K�D�KJABC���D�����G�G�K �i ABKP �C�B�KJABC���D�P����G�G�K �i ABKP �C�B�KJABC���D�����G�G�K �i ABKP �C�B�KJABC���@\��yB�G�K �j CBEP CBKKCB@����yB�G�K �j CBEP CBKKCBL�X����B�G�K �} CBJK CBHK CBHPCBL4�����T�E�K �G(�G0U (C ABBAX(C ABBH����8�h���cG�K�G �[ ABIWABF���8�����cG�K�G �[ ABIWABF����Т��3Y�YH��B�E�I �D(�D0g (C ABBIH(K ABB\dX����B�E�E �D(�D0�~ (D EEDLM (C BBBJQ(C BBBH�����yB�F�B �B(�A0�A8�D`{ 8D0A(B BBBFtܤ��B�B�G �E(�A0�I8�J`� 8A0A(B BBBHY 8A0A(B BBBEY8A0A(B BBB��t���sB�E�E �E(�D0�C8�GP}XI`IXAP^ 8A0A(B BBBI� 8H0A(B BBBEe 8A0A(B BBBAM 8A0A(B BBBI4,P���FB�D�D �X(I0U(A AABdh���&DL U�|���0DM ^`�����iO�G�G �AAH��H ��H K�A�LD HACD HACHK�A�0����lA�G�G r CAKLCHL4ث���B�D�A �G CBEF KDKy CBJFKBL�h����B�B�D �D(�G@S (A ABBDI (A ABBA������rK�B�E �D(�K0�J@� 0A(A BBBHC 0A(A BBBEV 0A(A BBBJ������H@�����H\�����K�G�K �K �C�B�KM ABHPABE���H�����K�G�K �K �C�B�KM ABHPABE���4�x���GB�D�G �\ CBJKABH,����B�E�D �N0t8B@I8A0U AABFD HAB4xT���WB�I�D �b CBJOABH�|����B�E�I �D(�D0g (C ABBIH(K ABB(���/B�I�H �ABL(��� B�B�E �F(�D0�� (A BBBE�(A BBB8xt���bJ�A�D � AAJ���H ��x����IB�E�B �E(�D0�I8�G`� 8A0A(B BBBFt 8A0A(B BBBB� 8A0A(B BBBHd0|���K�D�D �D(�O0P (A ABBDH (F� H�B�B�FK(C ABBE����8����bB�M�D �I(�G8R@V(M ABBd����K�D�D �D(�O0P (A ABBDH (F� H�B�B�FK(C ABBE����<<`��bB�M�D �I(�G8R@V(M ABBP|����B�A�A �� ABH� ABD� ABDm ABH �����i�L K_�(�h���A�G�D S CAEd ����B�B�B �E(�A0�D8�D`� 8D0A(B BBBD�hIp\hB`�hcpQhG`H�D���B�B�B �B(�A0�A8�Dp| 8D0A(B BBBIt����B�B�B �B(�A0�A8�Gp� 8A0A(B BBBG, 8A0A(B BBBJxj�`xBp(LP��B�F�D ��FB$x��\A�H�D IDA0��JA�D�G U AAEXDA|�8��B�H�B �B(�I0�D8�J�a�G�N�H�X�] 8A0A(B BBBF��A�I�B�A�F�V� TX��G���S�LLx��ZB�E�B �E(�D0�A8�G�N 8A0A(B BBBF ����G�t�h�O ����G�t�h�Ox,�cK�B�B �B(�A0�D8�G@�HJPUHA@D 8A0A(B BBBHI 8C0A(B BBBCP������$� �cK�T A{E��h��d�LH����B�B�B �A(�A0�g (A BBBJ\(A BBB(� <� P�� Hd���B�G�B �B(�A0�A8�G@U 8F0A(B BBBFH�L��B�B�E �B(�A0�A8�DP� 8F0A(B BBBCH���B�B�I �E(�A0�A8�DP{ 8F0A(B BBBF�H���B�B�B �B(�A0�A8�DPz 8C0A(B BBBD� 8A0A(B BBBEI 8A0A(B BBBEq 8A0A(B BBBEu8A0A(B BBB��{\, ���U�W DS �M[ UE�l< 0��B�B�A �A(�D0k (A ABBEL (D ABBKD (C ABBDO(A ABB<� ��U�W DF JG �IE �KE �KHJ�`� `����B�B�B �A(�A0�i (A BBBH_ (A BBBJD (A BBBB�P!����B�B�B �B(�A0�A8�D@� 8A0A(B BBBAf 8A0A(B BBBHD 8D0A(B BBBGL 8D0A(B BBBGD 8D0A(B BBBO�!���|"<���+L$"X����8"� L"�-`"���-t"(���,�"D���` �"�����A� Hb Fp�"L���wI�B�B �E(�F0�q (D BBBEi (A BBBHf (A BBBCo(A BBBL4#X����B�G�E �A(�A0�� (A BBBEp (E BBBEH�#����B�G�B �B(�A0�D8�D@� 8D0A(B BBBA`�#|���B�L�H �H(�G0�D8�K`� 8E0A(B BBBH� 8A0A(B BBBB04$���vA�M�G G DAGHDAh$��%H|$0��%B�B�B �B(�D0�A8�DP� 8D0A(B BBBAH�$��IB�B�E �B(�A0�A8�D`� 8D0A(B BBBJL%���B�B�A �A(�G0B (D ABBHm (D ABBJ`d%����B�B�B �B(�A0�D8�D@U 8E0A(B BBBDp 8E0A(B BBBJ`�%����B�B�B �B(�A0�D8�DP� 8D0A(B BBBJc 8E0A(B BBBG,& ��Vi�e BE(L&`���N��D�H�z Fx&���&��;�&,��*`�&H���B�B�B �B(�A0�D8�DP� 8D0A(B BBBJc 8E0A(B BBBG't��VL,'����B�B�B �A(�A0�\ (A BBBEA (C BBBAd|'P���B�B�B �B(�A0�A8�Dp� 8D0A(B BBBH� 8A0A(B BBBE,�'���A�I�� AAh AA(���H((����B�B�B �A(�A0�L (A BBBE�(A BBBt(H��b(�(���4B�U�H �QAB�(���$L�(����B�J�E �B(�A0�A8�G�� 8D0A(B BBBA()45���A�A�G � DAF(D)6���A�N b CDPC`p)l6��B�I�G �A(�J0� (D ABBJ� (A DBBF� (G DBBF�)(:��"A�M BI�)8:��(TN*P:��#L *l:���B�B�A �A(�D0O (A ABBAD (F ABBA@p*�;��eB�I�D �G�e CABGV CABl�*�;���X�H�A �F(�� ABEGu FBBIC CBBF�����F(����M����0$+h>��_M�A� AEP��H��XX+�?���B�J�E �H(�H0�Dp� 0F(A BBBJ� 0C(A BBBB,�+(C��~A�F�G R AAF(�+xC���B�A�H ��FRl,E��eB�G�A �D(�D@� (D ABBDDH]POHA@D (D DBBGF (D ABBI��,H��YB�B�E �B(�A0�A8�DP#XF`BhApRPJ 8A0A(B BBBELXS`FhHpQPnXQ`NhApIxA�RPt XF`BhApE~XF`BhApKPnXF`BhApMPGXF`BhApKPnXF`BhApKPP-�L��d-�L��DRh|-�L��B�I�B �B(�A0�D8�GPgXf`AhHpRPXX`hXAPjXL`OhFpKPnXH`HXAP] 8C0A(B BBBGcXU`AhHpKP}XO`nhHpKP@XO`NhMpKPxXH`NhEpVxH�KP]XO`QXBP_XM`IXBP|X]`OXAPbXG`YXAPPXL`UhApKPSXk`IXBP[XG`ZXBPLX]`OXBPRX]`PXBPQXk`IXBP_XN`MhApRPd XN`MhApBZXK`DhHp�.�S��)�.�S��)/�S��!H$/T���B�I�D �A(�D0\ (D ABBGm (D ABBJ@p/�T���A�D�D { NAMI AAEP KAL@�/U��5A�A�G ^ AAGq GHHf MFOD�/V��hX�E�A �A(�J0�(A ABBC����H0���� @0<W��+F�T �FCE�8d0HW��(B�E�A �A(�D@d (F ABBD<�0<Z���A�F�G } CAAD(n0H(A FAA,�0�Z��aH�RU B(A0IA DRH1�Z�� B�B�B �B(�A0�A8�G@ 8D0A(B BBBE@\1�`���B�A�A �D0e DABD� DABD(�1,e���W�D EYG�P��1f���A�D �C(�1�f���A�A�DPd CAB42�g��iB�K�D �_ DKIMDK$P2�g��5A�I�J IIJ4x2�g��zB�I�D �Z ABDFAB(�2,h���A�D�L v AAG�2�h��:A�n IA�2�h��P3�h��/B�L�B �A(�A0�G@EH\PIHA@% 0A(A BBBGLd3�n��<B�B�B �B(�A0�C8�GpY 8C0A(B BBBH8�3�u��B�B�D �C(�J0� (C ABBBH�3lv���B�B�B �E(�A0�C8�DPp 8D0A(B BBBH(<4w��WA�G�I w AAFTh44w��SB�I�J �A(�A0�G�(��(^�(E�(E�(K�(G 0D(A BBBDH�4<x���B�G�B �B(�A0�A8�O�r 8D0A(B BBBCd5�y��^B�E�B �B(�A0�A8�I���K�K�K�A�B�I�D 8C0A(B BBBBHt5�z���B�B�B �E(�F0�F8�DP� 8C0A(B BBBH`�5<{��3B�F�A �A(�D0P8A@T8A0U8H@Q8A0^ (C ABBGI 8G@Lt$6|��CT�B�B �B(�D0�A8�J@� 8D�0A�(B� B�B�B�ID 8C0A(B BBBH������8�6�~��B�G�D �A(�G��(D ABBL�6����B�E�B �B(�D0�D8�J�� 8A0A(B BBBAL(7$����B�B�A �A(�D0� (C ABBGU (C ABBKHx7����&B�B�B �B(�A0�A8�G�� 8D0A(B BBBF8�7�����B�A�F �n ABFt ABId8���� B�B�B �B(�A0�A8�DP� 8A0A(B BBBI� 8D0A(B BBBDLh8D���� B�B�B �B(�A0�A8�D�X 8A0A(B BBBH@�8�����J�A�G a AAK0CAD��H ��L�8 ����B�J�B �B(�I0�D8�M�C 8A0A(B BBBI8L9�����B�E�D �D(�D0H (A ABBOP�9���� B�I�B �B(�D0�D8�G� 8D0A(B BBBFL�9�����B�O�E �B(�A0�D8�G� � 8C0A(B BBBE<,:в���B�E�D �D(�D0 (A ABBH,l: ���bB�A�A �H FBD8�:`����B�B�A �A(�D0p (F ABBK@�:ij���A�A�G ^ CAEn CAFM CAG4;�����A�A�D X FAKK CAA(T;����SA�A�G d FADL�;,����B�E�D �D(�D0� (C ABBCe (F ABBH�;�����;�����;����)<ж��, <̶���J�M�D � FAI`��\P<�����P�L�B �D(�C0�x (A BBBDX(A BBBI�����H0�����@�<����L�A�D �s ABIWABF���H ����<����@A�~H=�����B�B�B �B(�A0�A8�D`� 8D0A(B BBBB8`=,����B�E�A �A(�M�} (A ABBGL�=����DB�G�B �B(�A0�A8�G� 8A0A(B BBBAL�=�����K�D�D �J�C AABDO FABH���H����L<>@���sI�H�A �A(�D0} (C ABBDD(F ABBA����H�>p���bB�B�B �E(�G0�A8�GP 8D0A(B BBBEl�>���&B�I�B �E(�A0�A8�Dp$xP�K�A�D�E�I�A�PpD 8A0A(B BBBGH?T��&L\?p��|B�E�B �B(�A0�A8�G�] 8A0A(B BBBA\�?��cB�B�B �B(�D0�A8�D���I�J�B�j 8A0A(B BBBC@���$@���348@���aB�B�D �D(�J0B(C ABBLp@��B�B�B �A(�A0�� (J EBBJ\ (A BBBE$�@���sA�F�G0`CAH�@D��B�B�B �J(�A0�A8�OPb 8D0A(B BBBHX4A��UB�I�A �D(�D@� (F ABBKg (C ABBAL(C ABBH�A���B�I�B �B(�A0�A8�G`� 8F0A(B BBBEH�A����B�E�D �D(�D@K (A ABBD^(C ABBp(BT���K�E�E �E(�D0�D8�D`� 8A0A(B BBBJa 8A0A(B BBBE�������,�B� ��fB�A�A �W ABAd�B� ���B�B�E �B(�A0�A8�GP9 8D0A(B BBBF�Xe`HXHPlXD`FXHP\4CH���m�E�B �B(�A0�G8�D@\8A0A(B BBBH������H@������x�C���]K�B�B �B(�D0�D8�DP 8A0A(B BBBFp������HP������k 8F0A(B BBBF<D���,B�B�B �A(�A0�� (A BBBKHPD���B�B�B �B(�A0�A8�Ip. 8C0A(B BBBCl�Dp1��FP�B�B �B(�A0�A8�G@` 8F0A(B BBBB� 8F0A(B BBBC������DEP5���B�B�B �B(�A0�A8�DP�8F0A(B BBBLTE�5��B�B�B �B(�A0�A8�DPV 8D0A(B BBBGH�E�7��0B�B�B �B(�A0�A8�Gp 8C0A(B BBBHH�E�9��]B�B�B �B(�A0�A8�D`� 8A0A(B BBBE\<F�=��VB�B�D �D(�G0{ (A ABBDk (A ABBGk (G DBBFd�F�>���c�B�B �E(�D0�D8�G�� 8A0A(B BBBD�������P�������G�A��CF�tF�H GB��hB�E�B �E(�D0�I8�D`� 8D0A(B BBBElG@C��DE I�GDC��=�GpC��8IUD O�G�C��9I[B L�G�C��L�G�C��fB�I�H �A(�D0p (F ABBEG(A ABB$DH�C��EA�A�G vDAHlHD���B�B�B �B(�A0�D8�J�c 8D0A(B BBBIL�H�K���B�F�E �E(�D0�D8�D� 8D0A(B BBBF\I4N���B�H�E �E(�D0�D8�G@GHKPMXE`BhBpI@] 8A0A(B BBBELhI�N���B�B�B �B(�A0�A8�D�� 8D0A(B BBBJ�IQ��3P�VJ�L�I8Q��NB�E�E �B(�D0�D8�D�W 8D0A(B BBBBx$J8T��BB�B�B �B(�D0�A8�DP� 8A0A(B BBBF^ 8F0A(B BBBC` 8F0A(B BBBA@�JV���B�A�D �p FBAY JBKPJB4�J�V��`B�I�G �Z CBG^GB8K�V��JB�E�E �D(�D0�j(A BBB(XK�V��kA�H�N0� AAEH�KY���B�B�E �B(�D0�A8�G`v 8A0A(B BBBIt�K�^��rB�B�E �B(�A0�A8�GP� 8A0A(B BBBBp 8F0A(B BBBAr8F0A(B BBBPHL�_��+B�A�D �G0y DABBg DAEG8j@F8A04�L�c��<B�A�A �` ABI ABF�L�d��6[�ZD�L�d���B�D�A �z DBI] ABHl AEF88M4f���B�B�D �D(�D0| (C ABBDtM�h��(A�f�Mi��X�MXi��'Db�Mpi�� A�^H�Mti��`B�B�A �A(�D0x (D ABBED(F ABBl$N�i���U�B�B �H(�D0�D8�K@G 8M�0D�(B� B�B�B�LD8C0A(B BBBH�������N�i��M�Nj��C�NPj��<8�N|j���Y�D�D �c ABIeABH���O�j��-4 O�j��V�D�A ��ABH���H ���dXO�k��!B�B�B �B(�A0�A8�Dp 8D0A(B BBBDo 8D0D(B BBBE�O�q��.4�O�q��B�A�A �q ABHi ABDP�r���A�M B,P0s��!d@PLs���B�B�B �B(�A0�A8�F�� 8A0A(B BBBF� 8D0A(B BBBAH�P�u��GB�E�B �B(�A0�A8�G�� 8D0A(B BBBE@�P�x��OB�A�A �y CBFv ABOv ABGx8Q�y��;K�B�B �D(�I0�J�b 0C(A BBBF� 0A(A BBBE� 0A(A BBBEP�����L�Q�{���B�B�B �E(�D0�D8�G� � 8C0A(B BBBC<R�~���B�E�D �A(�G0@ (A ABBGXDR(��sK�E�E �D(�C0�� (A BBBD� (C BBBBP�����L�RL����B�B�B �B(�A0�A8�G�< 8D0A(B BBBF$�R����fF�k GU CFJ�S���\A�w H[H8SD���B�D�E �B(�A0�A8�Ipo 8D0A(B BBBD$�S���_A�G�G MAA$�SP���^A�G�G LAA$�S�����A�F�D �CA8�S���?B�I�G �u ABFV CBE8T���28LT0����R�J�D �A(�G0{ (A ABBGL�T���]�B�A �A(�G0w (A ABBK~(F ABBG����,�Td����B�H�C �� ABHU����UЏ��WA�F IFH<U����B�B�B �B(�A0�D8�D@Z 8D0A(B BBBH�UT���7A�k DF0�Ut���S�D�A �� ABCx����U`���|(�Ȗ��}A�C�N ] AAGV ���30VL���UDV����MDU G@`V̒��@B�B�A �A(�J���F�z(A ABB0�Vȓ��[B�D�A �G�H AAB0�V�EA�C�D T CAHXCAW���$ W���>A�D�D oDA$HW$���@A�F�G TML$pW<���:A�F�G TJI$�WT���7A�F�G TJF�Wl����Wh��� $�Wd���sA�L�G \AA0X�����A�L�G � AAIKAA0DXH����A�L�G � AAHKAATxX�7K�B�B �B(�A0�A8�Dp� 8A0A(B BBBFa������T�Xܙ���Q�B�B �B(�A0�A8�D�� 8A0A(B BBBC�������8(Yd���DZ�J�A �A(�� ABBHx����HdYx����B�B�B �B(�A0�A8�D`K 8C0A(B BBBKd�Y�����J�M�E �B(�D0�C8�Ipi 8A0A(B BBBG�������Fp������\ZT����R�G�B �B(�A0�A8�Y������H8������ 0A(B BBBEDxZ�����B�I�B �A(�A0�_8G@W8A0A(A BBB4�Zܨ��fF�A�D x CAIDFAE��8�Z���sL�H�A �D(�G0m(G� D�D�D�H4[X����B�B�B �B(�A0�A8�DPS 8D0A(B BBBB�[ܫ��z0�[H����A�A�G0s AABDCA`�[����B�B�B �B(�A0�A8�D`� 8A0A(B BBBDD 8F0A(B BBBA<,\P���hL�I�D �xABD���H ���DAB8l\�����B�E�A �D(�L0J (A ABBAL�\���B�E�E �B(�D0�A8�J�Ip 8A0A(B BBBIH�\4����B�E�E �B(�A0�D8�G�[ 8A0A(B BBBAdD]���K�B�H �E(�D0�I8�GP 8A0D(B BBBFD8F0A(B BBBE������H�]`���B�E�B �B(�A0�G8�G`� 8D0A(B BBBAP�]$����B�E�D �A(�K0H (D ABBHD (F ABBAL^����`^|���`A�I FOH�^�����B�B�B �H(�A0�A8�D@J 8D0A(B BBBE4�^`����B�G�A �� ABGYAB_�����A�p GH$_h����B�B�B �E(�D0�I8�DP� 8A0A(B BBBH\p_���)B�B�B �B(�A0�D8�D�f�K�`�A�> 8A0A(B BBBA8�_��MB�E�E �A(�D0�q(D BBB�`���� B�B�B �B(�A0�A8�J���T�Y�A�p 8C0A(B BBBE��M�B�E�E�E�F�H�c�p�`,��RB�B�B �B(�A0�A8�G���W�D�A�P� 8C0A(B BBBFx�N�]�A�a��a��,a��@a��Ta��ha�� |a���a����a���a���a���a����a��b��b��0b��Db(��Xb4��lb@���b<��D�b8���B�B�E �B(�A0�A8�DPy8F0A(B BBB0�b���vA�A�D x FAK^FA0c���aA�A�D v IHKDCADc��%D`\c0��%D`tcH��A�\�cL��A�\�cP��A�\�cT��(A�f@�ch���A�K�D [ FAF^ FAC^ FAK@(d���EA�K�D [ FAF^ FAC{ FAF0ld���yB�D�D �D0w AABGH�d,���B�B�B �B(�A0�A8�FP