<dt><em>%s</em><pre>%s</pre> <em>%s</em>%s %ld %s <br>%s latest release (HEAD)(email)Can't open temporary file!2.8.9rel.1<h2>%s</h2> <dl compact>Name: </dl> lstat(%s) failed, errno=%d Full name:Unable to follow linkPoints to file:Name of owner:Group name:(bytes)File size:Creation date:Last modified:Last accessed:Access Permissions, read, write, searchOwner:Group:World: - HEADLinkname:Charset:(assumed)Server:Last Mod:Expires:Cache-Control:Content-Length:Language:Post Data:Post Content Type:NoneOwner(s):forms modenormal, safe, via internal link, no-cache, ISMAP script, bookmark filemode:Method:Action:(Form field)<dt> %s No Links on the current page<h2>%s</h2>Server Headers:<pre>%s</pre>Sun, 08 Jul 2018 06:46:06 -0400application/x-www-form-urlencodedInformation about the current document<h1>%s %s (%s) (<a href="%s">%s</a>)https://lynx.invisible-island.net/Directory that you are currently viewingFailed to obtain status of current link!Directory that you have currently selectedFile that you have currently selectedSymbolic link that you have currently selectedItem that you have currently selectedFile that you are currently viewing<dt><em>%s</em> <xmp>%.*s</xmp> Link that you currently have selectedemacs -treason unknownpico%s +%s%s %sLYEdit: %s show error warning:Error starting editor, %sEditor killed by signal%s~file://localhost/Could not access file.edit_current_file returns %d jedjmacsjoejovejstarnanoExtEditForm: system() returned %d (0x%x), %s Editor returned with error status %sError spawning editor, check your editor definition in the options menuedit_current_file(newfile=%s, cur=%d, lineno=%d) Lynx cannot currently (e)dit remote WWW files.ExtendEditor from %lu to %lu GETCH%d: Got %#x. Now recent_sizechange is %d KEY_MOUSE No link chosenkey %s %*d: %.*sLYRefreshEdit:%s LAC:Meta-KEYMAP(PA): in=%sKEYMAP(DEF) keysym=%#x lynxexec: lynxprog:LYFinishEdit:%s LYSetupEditLYStrings.c +%fLYscanFloat "%s" -> %f (%s) Tried to malloc %lu bytes SNACopySNACat.lynx-keymapsread_keymap_file %s [A# Arg%d = %s SUCCESSFAILLYOpenCmdScript(%s) %s LYSetConfigValue(%s, %s) LYsetRcValue(%s, %s) ?? set ignored %s LYReadCmdKey(%d) ->%s (%#x) got popup option number %d, curpage=%d new number=%d Enter a whereis query: Edit the current query: Edit the previous query: Edit a previous query: '%s' not found!LYgetstr(%s) recall sortedListLYgetstr(%s) LYE_ENTER LYgetstr LYE_ABORT LYgetstr LYE_STOP QuitHome pagePrevious documentBeginning of documentPage upHalf page upTwo lines upHelpDo nothing (refresh)Load againEdit Doc URL and loadEdit Link URL and loadShow infoPrintTwo lines downHalf page downPage downEnd of documentBookmarksCookie jarCache jarSearch indexSet OptionsActivate this linkDownloadunsetkeyOA[BOB[COC[DOD[1~[2~[3~[4~[5~[6~[7~[8~[11~[28~OP[OP[29~UPARROWDNARROWRTARROWLTARROWPGDOWNPGUPF1F2F4F5F6F7F8F9F10F11F12DO_KEYFIND_KEYSELECT_KEYINSERT_KEYREMOVE_KEYDO_NOTHINGBACKTAB_KEYnozap: Got EOF, curses %s, stdin is %p, LYNoZapKey reduced from %d to 0. Got EOF with EINTR, recent_sizechange so far is %d Unknown key sequence: %d:%d:%d Got KEY_RESIZE, recent_sizechange so far is %d Mouse error: no event available! UNMODIFIABLE choice list. Use return or arrow keys to review or leave.(Choice entry "%s") Use arrow keys and return to select option.(Choice list) Hit return and use arrow keys and return to select option.Left mouse button or return to select, arrow keys to scroll.STYLE.getstr: switching to <edit.%s>. Draw right-scroller offset (%d + %d) KEYMAP(SKIP) no key expansion found KEYMAP(SKIP) could unescape key KEYMAP(DEF) keysym=%#x, seq='%s' KEYMAP(SKIP) could not map to keysym KEYMAP(SKIP) junk after key description: '%s' KEYMAP(SKIP) no key description LYSetupEdit buffer %lu, display %d:%s Maximum length reached! Delete text or move off field.Error processing line %d of %s # Command logfile created by %s %s (%s) Select option (or page) number: rel='%c', c='%c', cur_choice=%d You are already at the beginning of this option list.You are already at the end of this option list.You are already at page %d of this option list.Option number %d already is current.You have entered an invalid option number.called LYgetBString hidden %d, recall %d h�X�H�8� �(�� ���� �� �� �� �� �� �� �� �� �� �� �� �� �� ��� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �X �H �� �8 �� �� �� �� ������ �� �� �( �� �� �� �`� ��� �`���x�� �� �� �� �� �� �`�� � ���� �� �� �� �� �� �� ��� �� �� �� �� �� �� �� �� �� �� �� �� � �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �h �������b�. � �| �| �| �| �| �| �| �| �| �| �p �� �� �� �| �| �| �| �| �| �| �| �� �| �| �d �| �| �| �| �| �| �| �| �| �| �;�| �| �| �| �| �| �| �| �| �| �| �| �| �| �| �'�� �| �| � �� �� � �� �d �� �� �p �a �>���8�>�>�>�>�>�>���>�>�������������������������>�>�������������>�>���������>�>�>�>���������>�>�����>���������������������������������������>�������������������������������������������������������>��,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,�,���,�����,�,�,�,�,�,�,���,�,�,���,��,��,�L�D�=�D�D�D�D�D�>�D�>�,D�C�lC�w>�B�B�B�\B�\B�A�dA�LA�4A�D�D�>�@��@�<@�D�D�D�?�t?�L?��B�TD��g��g�g�g�g�g�g�g�g�g�g��g��g�se�se�rk�Pk�k��j�l�/l� l�k��k��g��g�k�j�k�j�k�j�k�j��g��g��g�se��g��g��g��g��g��g��g��g��g��g��g�se��g��g��g��g��g�l��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�g�f�f��e��e��e��e��e��e��e��e��e�f�f�#d�#d�"j�j��i�xi�0k��j��j�j�xj�f�f�Oj�Ii�Oj�Ii�Oj�Ii�Oj�Ii�f�f�f�#d�f�f�f�f�f�f�f�f�f�f�f�#d�f�f�f�f�f�hk�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�e�z�z�z��v��z�Zz�@y�z�z�z�z�z�z�z�z�z�z�z�z�z�z�z�z�@y�z�z�z�z�z�y��y�z�z�z�z�z�z�z�AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz������������������������������������������������������������
��������������������������������������������������������������������������������QRSTUVWX Y Z[\^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~������������������������������������������������������������������������������������������������1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OP�Q�R�S�T�U�V�����������������������������������������������������������������������������
( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfog�����������������������������������������������������p�q���r�s�t�u�������v�w�����z�{���x�y�|�}��`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$�$!�A�"�B�#�C�$�D�%�E�&�F�'�G�(�H�)�I�*�J�+�K�,�L�-�M�.�N�/�O�0�P�1�Q�2�R�3�S�4�T�5�U�6�V�7�W�8�X�9�Y�:�Z��?�? A, extract_field(%s) = '%s' subject=extract_subject(%s) = '%s' No system mailer configuredpopen(%s) %s (null)mailto_address: "%s" mailto_subject: "%s" mailto_content: "%s" mailto_type: "%s" to=cc=keywords=mailto:%.63sCc: Mime-Version: 1.0 Content-Type: %s To: %s From: %s Cc: %s Subject: %s
Keywords: %s Sending form content...lynx-dev@mailmsg: No address in '%s'. mailmsg: '%s' failed. Subject: Lynx Error in %s X-URL: %s X-Mailer: %s, Version %s
The link %s :?: %s in the file "%s" called "%s" -- traverse.errors%s %s in %s .txtbody=%.78s extract_body(%s) = '%s' us-asciiX-URL: mailto:%s X-Mailer: %s, Version %s In-Reply-To: <%s>
With copies to:
With copy to: X-Personal_NameFrommailto:%sCc**header== %s Press RETURN to continue: Send this message?Send this comment?Append '%s'?Sending your message... Use Control-U to erase the default. Warning! Control codes in mail address replaced by ?Malformed mailto form submission! Cancelled!Mailto form submission Cancelled!!!Mailto form submission failed!was requested but was not available.Thought you might want to know.This message was automatically generated byUnable to open traversal errors output filereply_by_mail("%s", "%s", "%s", "%s") No email address is present in mailto URL!Unable to open temporary file for mailto URL!Content-Type: text/plain; charset=%s Content-Transfer-Encoding: 8bit You are sending a message with body to: You are sending a comment to:
Use Ctrl-G to cancel if you do not want to send a message
Please enter your name, or leave it blank to remain anonymous
Please enter a mail address or some other means to contact you, if you desire a response.
Please enter a subject line.
Enter a mail address for a CC of your message. (Leave blank if you don't want a copy.) Spawning your selected editor to edit mail message Please review the message body:
Please enter your message below. When you are done, press enter and put a single period (.) on a line and press enter again.Do you wish to include the preparsed source?Do you wish to include the original message?% 2ld%c%ld%c% 2ld sec%.2gmeter = %d %d%% Read %s of %s of dataRead %s of data, %s/sec (stalled for %s), ETA %s (Press 'z' to abort), cancelledYESConfirm: %s (%c/%c) Confirm: %s (%c) - NO, not interactive. Confirm: %s- %s%s. Resubmit POST content to %s ?LYNXIMGMAP:Password: lynx: Password required!!!WWWuserUsername: URL: %.*sP)roceed, or C)ancel %d %.*sLocation: Alert!: %s
Alert!: %s%s %s! Info message: %s Info message: User message: %s User message: YNAVY/N/A/VLooking for %c in %s ...testing %c/%c Rejecting this cookie.Allowing this cookie.rateBAR: bytes: %ld, total: %ld List from document with POST data. Reload %s ?Document from Form with POST content. Resubmit?lynx: Username and Password required!!!Server asked for %d redirection of POST content toP)roceed, use G)ET or C)ancel Redirection of POST content. P)roceed, see U)RL, use G)ET or C)ancelRedirection of POST content. P)roceed, see U)RL, or C)ancel%s cookie: %.*s=%.*s Allow? (Y/N/Always/neVer)'A'lways allowing from domain '%s'.ne'V'er allowing from domain '%s'.P?��.A�������?@�B�@convert_to_base64GridText.c; name="%s"text/plainrbCan't open file for uploadingHText_EditTextAreaNot enough memory for file! nottext entry fieldpassword entry fieldcheckboxradio buttonreset buttonscript buttonpopup menuhidden form fieldtext entry arearange entry fieldfile entry fieldtext-submit fieldimage-submit buttonkeygen fieldunknown form fieldline->next != NULL (l%d of %d) (p%d of %d)line != NULLThe Cache Jar is empty.LYNXCACHE:/%dLYNXCACHE number is %d Cache Jar, help on Lynx_users_guide.html#Cache(No title.)LYNXCACHE:Size: %ld Lines: %d Cache-Control: %s Content-Type: %s Content-Language: %s Content-Encoding: %s Content-Location: %s Content-Disposition: %s Content-MD5: %s Message-ID: %s Subject: %s Owner: <a href=%s>%s</a> Date: %s Expires: %s Last-Modified: %s ETag: %s Server: <em>%s</em> <br /></body></html>shift_jisx-sjisx-shift-jisx-eucx-euc-euc-kriso-2022-krcn-big5euc-cngb2312cn-gbiso-2022-cncancelStbl: ignored. cancelStbl: ok, will do. startStblTABLE: started. startStblTABLE: failed. unknown field or linkon_screen a=%p, l=%p, curanchor=%d .tgztext != NULLcountHTLines %u allocAnchorIndexline %d.%d %d %s->%s(%s) skipping wrap %d:%d, offset %d dump %d:%s From compare %d to [%d..%d] byte_count %d, byte_num %d field will wrap: %d THE_URL:%s THE_TITLE:%s UNKNOWNEnter a database query: Getting %s do_www_search: newfile: %s with POST dataunknown anchorHTcan_reparse_document -> %d CLICKABLE_IMAGESPSEUDO_INLINE_ALTSVERBOSE_IMGRAW_MODEHISTORICAL_COMMENTSMINIMAL_COMMENTSSOFT_DQUOTESOLD_DTDKEYPAD_MODEHText_setTabID Accept-charset: Enctype: Title:mailto:pgetmultipart/form-dataHText_beginForm<NULL><UNKNOWN>not current linkno field nameFAILEDUNKNOWN-8BIT%0d%0aSubmitForm: no action given xnyLAaB03XHText_SubmitFormiso-8859-1; charset=%smy_data != NULLSubmitForm[%d/%d]: reset I will submit "%s" (from %s) skipping submit field with values are differentfield "%s" %d %s -> %d %s %s field "%s" %d %s OK
Content-Type: %sname "%s" %d %s -> %d %s %s name "%s" %d %s OK What type is %d? nonprintable %d:%#x will encode as base64 LYNX; boundary=%s --%s %s%s%s%s%s%s.x=0%s%s.y=0%s; filename="%s" --%s-- Query %d{Submitting %sSubmitting form...GridText - post_data set: %s HText_NewGridText: start HText_new GridText: Auto-uncaching ALLOC_IN_POOLsplit_line_2split_line_3split_line_4GridText: Change to style %s *** MEMORY EXHAUSTED *** LAST_ORDER(ignored)HText_setLastOptionValue val_cs=%d "%s"[%d]->[%d](%d,%d,%d,%d) endStblTABLE: ignored. endStblTABLE: ok, will try. endStblTABLE: ncols = %d. changing offsets %d:%d %d:done NOHText_beginAnchoranchor text: '%s' found anchor at end of line in HText_trimHightextOPTION_LISTCHECKBOXHText_beginInputRADIOhiddenradiosubmitimageresettextarearangeok, got a file uploader keygenResetBUTTON[IMAGE]-Submitincrement_tagged_htlineinsert_new_textarea_anchorResetting form...succeeded Content type is "%s" Cannot read file %s Loading incomplete.Reparse file %s Reparse memory %s lp != NULLask for confirmation:end_anchor != NULLanchor_ptr != NULLFile insert cancelled!!!Can't open file for reading.HText_InsertFileLYNXCACHEsource-cache-mem(Unstyled)( )(*)[ ][X]Content-Disposition: form-data Content-Transfer-Encoding: base64Ok, about to convert "%s" to mime/thingy GridText: entered HText_EditTextArea() SourceCache: file-cache%s found SourceCache: memory-cache%s found HTdocument_settings_changed: %s setting has changed (was %d, now %d)
Error accessing document! No data available!
Error drawing page! Bad HText structure! GridText: display_page: unexpected typed link to %s!
GridText: Not showing link, hightext=%s Maximum links per page exceeded! Use half-page or two-line scrolling. display_page: MAXLINKS reached. D)elete cached document or C)ancel? (d,c): Sorry, no known way of converting %s to %s.<html> <head> <title>%s</title> </head> <body> <h1>%s (%s)%s<a href="%s%s">%s</a></h1> <p><em>%d.</em> Title: <a href="%s%d">%s</a><br />URL: <a href="%s">%s</a><br />File-Cache: <a href="file://%s">%s</a> Source-Cache-File: <a href="file://%s">%s</a>*** SPAN=%d is too large, ignored! HTGetRelLinkNum(%d,%d,%d) -- HTMainText=%p scrtop=%d, curline=%d, curanchor=%d, display_lines=%d, %s curanchor=%d at line %d on screen a->line_num=%d, a->number=%d HTGetLinkInfo: unexpected typed link to %s! FindPound: searching for "%s" FindPound: Selecting anchor [%d] at line %d HText: No such anchor in this text! HText: Selecting anchor [%d] at line %d skip field since last %d < %d size %d, offset %d, length %d line %d %d/%d [%d..%d] map %d %04X->%04X Warning: Cannot transcode form data to charset %s!Use Control-R to resubmit the current query. HTuncache.. freeing document for '%s'%s HTuncache.. HTMainText already is NULL! HTdocument_settings_changed: Screen size has changed (was %dx%d, now %dx%d) *** COLSPAN=%d is too large, ignored! *** ROWSPAN=%d is too large, ignored! BeginForm: action:%s Method:%d%s%s%s%s%s%s endForm: HTCurrentForm is missing! endForm: HText is missing! HText_beginSelect: name=%s type=%d size=%s HText_beginSelect: name_cs=%d "%s" HText_getOptionNum: Got number '%d'. SubmitForm link_name=%s link_value=%s SubmitForm: form %d not in HTMainText's list! SubmitForm: failed sanity check, %d!=%d ! application/sgml-form-urlencodedname "%s" for link_name "%s", %s. name "%s" for link_name "%s", %s! processing [%d:%d] name=%s(first:%d, value=%s, data=%p) %s"%s.x"
0 --%s %s"%s.y"
0 BUG *** Emergency freeing document %d/%d for '%s'%s! Memory exhausted, display interrupted!Memory exhausted, will interrupt transfer!GridText: Freeing off cached doc. *** split_line: split==%u greater than last_line->size==%d ! split adjusted to %u. BUG: styles improperly nested. BUG: style overflow before split_line. BUG: style overflow after split_line. BUG: justification: shouldn't happen - new line is not empty! '%.*s' TH_JP_AUTO_DETECT: This document's kcode seems SJIS. TH_JP_AUTO_DETECT: This document's kcode seems EUC. TH_JP_AUTO_DETECT: This document's kcode seems mixed! TH_JP_AUTO_DETECT: This document's kcode is unexpected! This character (%X:%X) doesn't seem Japanese HText_setLastOptionValue: invalid call! value:%s! Entering HText_setLastOptionValue: value:"%s", checked:%s HText_setLastOptionValue: last input_field not F_OPTION_LIST_TYPE (%d) but %d, ignoring! HText_setLastOptionValue:%s value="%s" (submit_val_cs %d "%s") submit_value%s="%s" GridText:HText_endAnchor0: number:%d link_type:%d BUG: HText_endAnchor0: internal error: last anchor was input field! HText_endAnchor0: hidden (line,pos,ext,BlankExtent):(%d,%d,%d,%d)HText_endAnchor0: blanks (line,pos,ext,BlankExtent):(%d,%d,%d,%d)line %d first to adjust -- newpos:line %d true/max width:%d/%d oldpos: NONE line %d true/max width:%d/%d oldpos:BUG: insertBlanks: resulting table too wide by %d positions! endStblTABLE: changed %d lines, done. endStblTABLE: have%s enclosing table (%p) GridText: Entering HText_trimHightext (final) GridText: Entering HText_trimHightext (partial: 0..%d/%d) GridText: Anchor found on line:%d col:%d [%05d:%d] ext:%d found anchor at end of line, leaving it there GridText: add link on line %d col %d [%d] %s GridText: Entering HText_endAppend GridText: Removing bottom blank line: `%s' GridText: New bottom line: `%s' GridText: HText_pageDisplay at line %d started GridText: HText_pageDisplay finished GridText: Entering HText_beginInput type=%s GridText: No name present in input field; not displaying beginInput: HTCurrentForm is missing! Input link: name=%s value=%s size=%d Input link: name_cs=%d "%s" (from %d "%s") value_cs=%d "%s" (from %d "%s") GridText: adjusting struct's to add %d new line(s) Hang Detect: TextAnchor struct corrupted - suggest aborting!GridText: TextAnchor and HTLine struct's adjusted HTreparse_document returns FALSE SourceCache: Reparsing file %s Reloading document. Any form entries will be lost!SourceCache: `%s' has been accessed, partial content. SourceCache: Reparsing from memory chunk %p GridText: TEXTAREA name=|%s| dumped to tempfile GridText: invoking editor (%s) on tempfile GridText: returned from editor (%s) Wrap lines to fit displayed area?end_anchor->input_field != NULLGridText: edited text inserted into lynx struct's GridText: exiting HText_EditTextArea() GridText: entered HText_EditTextField() GridText: text field |%s| dumped to tempfile GridText: exiting HText_EditTextField() GridText: entered HText_ExpandTextarea() GridText: %d blank line(s) added to TEXTAREA name=|%s| GridText: exiting HText_ExpandTextarea() GridText: entered HText_InsertFile() GridText: file insert cancelled - no filename provided File name may not begin with a dot.Nothing to insert - file is 0-length.GridText: file insert aborted - file=|%s|- was 0-length BUG: could not find anchor for TEXTAREA. Very long lines have been truncated!GridText: file inserted into lynx struct's GridText: exiting HText_InsertFile() ���8��P��h�����ȥ������(��@��X��p�� �������������5��/��/��/��/�(5�4��/��/��/�5�p1�(5�(5�p<�P7�P7�P7�P7�<�p<�P7�P7�@:�p<��:�<�<�~1�I1�I1�86�86��5�~1�I1�I1�P6�~1�;1��5��5�P5�@/�@/�@/�@/�P6�P4�@/�@/�@/�P5��0�P6�P6�|�Xw�tw� z��y�hz�z�w�<w�Xw�z�y�Lz�lz�finish_ExtEditFormABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/HText_SubmitFormHText_selectdisplay_page�new_trustLYGetFile.ctelnet_proxytn3270_proxygopher_proxygetfile: getting %s
URL has a bad port field.URL is not in starting realm!getfile: dropping post_data! Unsupported URL scheme!News posting is disabled!Mail access is disabled!Re:Re: Telnet access is disabled!telnet:tn3270:rlogin:Rlogin access is disabled!rlogin_proxy%09Ftp access is disabled!hGET%20/http://getfile: URL '%s' 70/ftp_proxyfix_httplike_urls: URL '%s' changed to '%s' ftp:%s//%s%sbibp1.0/resolve?citehost=&usin=bibp1.0/resolve?usin=Location URL is not absolute.Illegal URL: %sUsing %swww/presentBadly formed address %s temp=%s, *num=%d, rel='%c' _-:./@~$&+= _-:./@~$+= comparing source '%s' '%s' getfile: resetting LYCancelDownload to FALSE Port 19 not permitted in URLs.Port 25 not permitted in URLs.Port %lu not permitted in URLs.Not an http URL or form ACTION!POST not supported for this URL - ignoring POST data!Unsupported data: URL! Use SHOWINFO, for now.USENET news access is disabled!File management support is disabled!Execution capabilities are not compiled into this version.Only files and servers on the local host can be accessed.Telnet port specifications are disabled.Illegal redirection URL received from server!getfile: Adding fragment '%s' to redirection URL. follow_link_number(%d,%d,...) Follow link (or goto link or page) number: curline=%d, LYlines=%d, display too small! nlines=%d, npages=%d, curline=%d, curpage=%d Executable link rejected due to malformed request.Executable link rejected due to relative path string ('../').Executable link rejected due to `%c' character.comparing command '%s' '%s' Executable link rejected due to location or path.defaultwww/downloadwww/dump SSL-MM%s1.4.1 %s%sinitially...data: %s ...mark: %s get_data:%s
%s
List of Options:%s%s (%s)lynxUSAGE: %s [options] [file] Options are: %.3fNONOPTIONparse_arg startfile:%s parse_arg lookup(%s) ...arg:%s ...skip (mask %u/%d) truefalse%s: Invalid Option: %s /usr/share/localeLYNX_LOCALEDIR%s Version %s (%s)libwww-FM %s,(wide)Built on %s%s. (Apr 18 2022 17:01:01)Lynx.traceLYNX_TRACELYNX_TRACE_FILE%d %-16.16t %a %KKiBhttp://scout.wisc.edu//etc/mailcap~/.mailcap/etc/mime.types~/.mime.types-t -oi libwww-FM/LYNX_VERSION=LYNX_TEMP_SPACETMPDIR$USERNo such directorylocaldomainwww..com,.edu,.net,.orgdisplay %s &http://usin.org/http://bibhost/processing stdin arguments ...StdinArg:%s ...complete:%s ...done with stdin arguments Jump to (use '?' for list): LYNX_CFGlynx_cfg/etc/lynx.cfgPWD.lynxsigLYNX_SIG_FILE set to '%s' main programSSL_CLIENT_KEY_FILESSL_CLIENT_CERT_FILEWWW_HOMELynxHomeprocessing stdin startfile ...done stdin startfile .lynx_cookies/dev/nullLYNX_HELPFILELYNX_SAVE_SPACEWarning:STARTFILEHOMEPAGELYMain: User in Local domain ProFTPD 1.2.5broken_ftp_retrspftp/(Version wu-2.6.2-12)broken_ftp_epsvlynx_bookmarks%sdumping %d:%d %s Not enough memory!.rcUnable to save Options!mergelistonlyrestricts all options.bookmark_execchange_exec_permschdircompileopts_infodired_supportdisk_savedisallow editingdisable execution scriptsexec_frozenexternalsfile_urlgotoinside_ftpinside_newsinside_rlogininside_telnetjumplynxcfg_infolynxcfg_xinfodisallow mailmultibooknews_postdisallow USENET News posting.option_saveoutside_ftpoutside_newsoutside_rloginoutside_telnetdisallow most print optionsshellsuspendtelnet_portaccept_all_cookiesanonymousassume_charsetassume_local_charsetassume_unrec_charsetbaseburied_newschildchild_relaxedcmd_logcmd_scriptcollapse_br_tagstoggles collapsing of BR tagsconnect_timeoutconvert_tocookie_filecookie_save_filecrawlcurses_padsdebug_partialdelaydisplaydisplay_charsetdont_wrap_preemacskeysenable_scrollbackerror_fileforce_empty_hrefless_aforce_htmlforce_secureforms_optionsfromdisable ftp accessget_dataheadsend a HEAD requesthelpprint this usage messagehiddenlinkshistoricalhomepagehtml5_charsetsimage_linksismapjustifydo justification of textlist_inlinemime_headerminimalnewschunksizenewsmaxchunknobolddisable bold video-attributenobrowsedisable directory browsingnoccnocolorturn off color supportnofilereferernolistnolognomarginsnomorenonrestarting_sigwinchnonumbersnopausenoprintnoredirnoreferernoreversenostatusnotitlenounderlinenozapnumber_fieldsnumber_linksforce numbering of linkspartial_threspassive_ftppauthpopuppost_datapreparsedprettysrcpseudo_inlinesrawrealmread_timeoutrestrictionsdisable rloginstoggles showing scrollbarscrollbar_arrowselectivesessioninsessionoutshort_urlshow_cfgShow `LYNX.CFG' settingshow_cursorshow_ratesoft_dquotesstack_dumpstartfile_okstderrstdintagsoupdisable telnetstnaturns on Lynx trace modetrace_maskcustomize Lynx trace modetraversaltrim_blank_linestrim_input_fieldsunderline_linksunderscoreunique_urlsuse_mouseturn on mouse supportvalidateverbosevikeysenable vi-like key movementwith_backspacesxhtml_parsingenable XHTML 1.0 parsingapplication/octet-streamassume_charset_fun %s ->%d ->%s Lynx: ignoring unrecognized charset=%s
A Fatal error has occurred in %s Ver. %s
Please notify your system administrator to confirm a bug, and if confirmed, to notify the lynx-dev list. Bug reports should have concise descriptions of the command and/or URL which causes the problem, the operating system name with version number, the TCPIP implementation, and any other relevant information. Memory exhausted! Program aborted! Do NOT mail the core file if one was generated.
Lynx now exiting with signal: %d
USAGE: lynx -restrictions=[option][,option][,option] ? when used alone, list restrictions in effect.Other restrictions (see the user's guide):receive options and arguments from stdinparse_arg(arg_name=%s, mask=%u, count=%d) Copyrights held by the Lynx Developers Group,the University of Kansas, CERN, and other contributors.Distributed under the GNU General Public License (Version 2).See https://lynx.invisible-island.net/ and the online help for more information.See http://www.openssl.org/ for information about OpenSSL. %p %4l %-8.8o %-8.8g %7s %-12.12d %ahttps://lynx.invisible-island.net/lynx_help/lynx_help_main.html Configuration file "%s" is not available.
Lynx character sets not declared.
LYNX_SIG_FILE '%s' is bad. Ignoring. HTGetSSLHandle: client keyfile is set to %s by SSL_CLIENT_KEY_FILE HTGetSSLHandle: client certfile is set to %s by SSL_CLIENT_CERT_FILE Ignored %d characters from standard input. Use "-stdin" or "-" to tell how to handle piped input. User-Agent string does not contain "Lynx" or "L_y_n_x"The '-head' switch is for http HEAD requests and cannot be used for '%s'. The '-mime_header' switch is for http URLs and cannot be used for '%s'. The '-traversal' switch is for http URLs and cannot be used for '%s'. LYMain: User in REMOTE domain persistent cookies state will be changed in next session only.cookie file can be changed in next session only, restored. cookie save file can be changed in next session only, restored. disallow changing the location of the bookmark filedisallow execution links via the bookmark filedisallow changing the eXecute permission on files (but still allow it for directories) when local file management is enabled.disallow changing the working directory of lynx, e.g., to affect the behavior of download commanddisable info on options used to compile the binarysame as commandline option -anonymous. Sets the default service restrictions for anonymous users. Set to all restricted, except for: inside_telnet, outside_telnet, inside_ftp, outside_ftp, inside_rlogin, outside_rlogin, inside_news, outside_news, telnet_port, jump, mail, print, exec, and goto. The settings for these, as well as additional goto restrictions for specific URL schemes that are also applied, are derived from definitions within userdefs.h.disallow local file managementdisallow saving to disk in the download and print menusdisallow access to, or creation of, hidden (dot) filesdisallow some downloaders in the download menudisallow the user from changing the execution link optiondisable passing URLs to some external programsdisallow using G)oto, served links or bookmarks for file: URL'sdisable the 'g' (goto) commanddisallow ftps coming from inside your domaindisallow USENET news reading and posting coming from inside your domaindisallow rlogins coming from inside your domaindisallow telnets coming from inside your domaindisable the 'j' (jump) commanddisable viewing of lynx.cfg configuration file infodisable extended lynx.cfg viewing and reloadingdisallow execution of Lynx CGI URLsdisallow multiple bookmark filesdisallow saving options in .lynxrcdisallow ftp coming from outside your domaindisallow USENET news reading and posting coming from outside your domaindisallow rlogins coming from outside your domaindisallow telnets coming from outside your domaindisallow shell escapes, and lynxexec, lynxprog or lynxcgi G)oto'sdisallow Control-Z suspends with escape to shelldisallow specifying a port in telnet G)oto'sdisallow modifications of the User-Agent header accept cookies without prompting if Set-Cookie handling is onapply restrictions for anonymous account, see also -restrictions=MIMEname charset for documents that don't specify it=MIMEname charset assumed for local files=MIMEname use this instead of unrecognized charsets=id:pw authentication information for protected documentsprepend a request URL comment and BASE tag to text/html outputs for -source dumps=URL local bibp server (default http://bibhost/)use the bookmark page as the startfiletoggles scanning of news articles for buried references=NUMBER NUMBER of documents cached in memoryenable case sensitive user searchingtoggle center alignment in HTML TABLE=FILENAME specifies a lynx.cfg file other than the defaultexit on left-arrow in startfile, and disable save to diskexit on left-arrow in startfile (allows save to disk)=FILENAME log keystroke commands to the given file=FILENAME read keystroke commands from the given file (see -cmd_log)=N set the N-second connection timeout=FORMAT convert input, FORMAT is in MIME type notation (experimental)=FILENAME specifies a file to use to read cookies=FILENAME specifies a file to use to store cookiestoggles handling of Set-Cookie headerstoggles forced core dumps on fatal errorswith -traversal, output each page to a file with -dump, format output as with -traversal, but to stdoutuses curses pad feature to support left/right shiftingincremental display stages with MessageSecs delayuse terminal default foreground/background colors=NNN set NNN-second delay at statusline message=DISPLAY set the display variable for X exec'ed programs=MIMEname charset for the terminal outputinhibit wrapping of text in <pre> when -dump'ing and -crawl'ing, mark wrapped lines in interactive sessiondump the first file to stdout and exit=EDITOR enable edit mode with specified editorenable emacs-like key movement toggles compatibility with comm programs' scrollback keys (may be incompatible with some curses packages)=FILE write the HTTP status code here force HREF-less 'A' elements to be empty (close them as soon as they are seen)forces the first document to be interpreted as HTMLtoggles forcing of the secure flag for SSL cookiestoggles forms-based vs old-style options menutoggle transmission of From headersuser data for get forms, read from stdin, terminated by '---' on a line=[option] hidden links: options are merge, listonly, or ignoretoggles use of '>' or '-->' as terminator for comments=URL set homepage separate from start pagetoggles use of HTML5 charset replacementstoggles inclusion of links for all images=URL set the default index file to URLtoggles inclusion of ISMAP links when client-side MAPs are present=NUMBER starting count for lnk#.dat files produced by -crawlwith -dump, forces it to show links inline with textwith -dump, forces it to show only the list of linksdisable URLs that point to remote hosts=FILENAME specifies a lynx.lss file other than the defaultinclude mime headers and force source dumptoggles minimal versus valid comment parsing=NUMBER number of articles in chunked news listings=NUMBER maximum news articles in listings before chunkingdisable Cc: prompts for self copies of mailingsdisable transmission of Referer headers for file URLsdisable the link list feature in dumpsdisable mailing of error messages to document ownersdisable the right/left margins in the default style-sheetdisable -more- string in statusline messages make window size change handler non-restartingdisable the link/form numbering feature in dumpsdisable forced pauses for statusline messagesdisable some print functions, like -restrictions=printdon't follow Location: redirectiondisable transmission of Referer headersdisable reverse video-attributedisable the miscellaneous information messagesdisable the title at the top of each pagedisable underline video-attribute=DURATION ("initially" or "full") disable checks for 'z' keyforce numbering of links as well as form input fieldstoggles display partial pages while downloading[=NUMBER] number of lines to render before repainting display with partial-display logictoggles passive ftp connection=id:pw authentication information for protected proxy servertoggles handling of single-choice SELECT options via popup windows or as lists of radio buttonsuser data for post forms, read from stdin, terminated by '---' on a lineshow parsed text/html with -source and in source view to visualize how lynx behaves with invalid HTMLdo syntax highlighting and hyperlink handling in source viewenable print functions (DEFAULT), opposite of -noprinttoggles pseudo-ALTs for inlines with no ALT stringtoggles default setting of 8-bit character translations or CJK mode for the startup character setrestricts access to URLs in the starting realm=N set the N-second read-timeoutflushes the cache on a proxy server (only the first document affected)=[options] use -restrictions to see listtoggles forced resubmissions (no-cache) of forms with method POST when the documents they returned are sought with the PREV_DOC command or from the History Listtoggles showing arrows at ends of the scrollbarrequire .www_browsable files to browse directories=FILENAME resumes from specified file on startup and saves session to that file on exit=FILENAME resumes session from specified file=FILENAME saves session to specified fileenables examination of beginning and end of long URL in status linetoggles hiding of the cursor in the lower right cornertoggles display of transfer ratetoggles emulation of the old Netscape and Mosaic bug which treated '>' as a co-terminator for double-quotes and tagsdump the source of the first file to stdout and exitdisable SIGINT cleanup handlerallow non-http startfile and homepage with -validatewrite warning messages to standard error when -dump or -source is usedread startfile from standard inputuse TagSoup rather than SortaSGML parser=TERM set terminal type to TERMtoggles use of a Lynx Trace Log for the current sessionturn on "Textfields Need Activation" modetraverse all http links derived from startfile toggle trimming of leading/trailing/collapsed-br blank lines trim input text/textarea fields in formstoggles use of underline/bold attribute for linkstoggles use of _underline_ format in dumpstoggles use of unique-urls setting for -dump and -listonly options=Name set alternate Lynx User-Agent headeraccept only http URLs (meant for validation) implies more restrictions than -anonymous, but goto is allowed for http and httpstoggles [LINK], [IMAGE] and [INLINE] comments with filenames of these imagesprint Lynx version information=NUMBER screen width for formatting of dumps (default is 80)emit backspaces in output if -dumping or -crawling (like 'man' does)lynx.lss;blue-background.lss;bright-blue.lss;midnight.lss;mild-colors.lss;opaque.lssx��C��C��C��C��C��C��C��C��h��C��C��C��C��C��C��C��C��C��C��C��C��C��C��C��C��C��C��C��C��C��C��h��C��C��C��C��C��C��C��C��C��C����C���C��C��C��C��C��C��C��C��C��C��C��C�� ��C��C�� ��@�@zDCan't Accesslynx: Can't access startfile%s %s %s Exiting...%s %s %s check_JUMP_param: %s Prompt for query param%d: %s Query parameter %d: urlencodeLYMainLoop.c:/?#[]@!$&'()*+,;=0123456789ABCDEF reply: %s coded: %s subst: %s LYNXIMGMAP:httplynxcgi:MakeFormActionLYNXDIRED:Edit the current link's URL: LYNXOPTIONS:/Up to LYNXOPTIONS:LYNXCOOKIE:You cannot download cookies./SugFile=LYNXHIST:data:LYNXDOWNLOAD:LYNXPRINT:LYNXCOMPILEOPTS:Nothing to download.Edit the current Goto URL: Edit the previous Goto URL: Edit a previous Goto URL: Address List PageDiscarding POST data...LYNXMESSAGES:Turning TRACE back on.
-index--more-%.*s %%.%dslastline = %s file: ACTIONs are disallowed!//PERMIT_LOCATIONLYNXEDITMAP:LYNXKEYMAP:LYMainLoop: Rejected '%s' History Pagepreferred top %d mailto:WebMaster@No owner is defined. Use %s?Cannot save form fields/linksLynx Trace Log %s (%s)
"all" restrictions are set. Trace ON!Trace OFF!cd to:changing directory to '%s' Could not access directory.failed to change directoryA URL specified by the userDone!HTAddGotoURL %s http:https:www/sourceEntry into main screenBookmark fileUsing bookmarks=%s %s %s in %s %s %s Reloading as bookmarks=%s 8bitStarting realm is '%s'
Traversal host is '%s'
top_of_screen %d lnk%08d.datDoTraversal(%d:%d) -> %s Handling key as %s Unknown or ambiguous commandLYK_COMMAND(%s.%s) = %d TABLE center enable.TABLE center disable.Soft double-quote parsing ON!Excellent!!!Current URL is empty.Copy to clipboard failed.Link URL put to clipboard.
No URL in the clipboard.LYNXCOOKIE:/LYNXCACHE:/Skipping %sNo next document presentEdit the form's submit-URL: Edit this document's URL: URL to open: Help ScreenSystem IndexNo editor is defined!Access to local files denied.Printing OptionsVisited Links Page%s#%sFile Management OptionsUpload OptionsCurrent Edit-Key MapCurrent Key MapAuthorization info cleared.Linewrap ON!Linewrap OFF!Try to fit screen widthNo line wrap in columnsWrap columns at screen widthcso:finger:gopher:wais:bibp:nntp:snews:LYNXCFG:lynx: Start file could not be found or is not text/html or text/plainSend HEAD request for D)ocument or L)ink, or C)ancel? (d,l,c): Sorry, the document is not an http URL.Document from POST action, HEAD may not be understood. Proceed?Sorry, the link is not an http URL.Sorry, the ACTION for this form is disabled.Sorry, the ACTION for this form is not an http URL.Form submit action is POST, HEAD may not be understood. Proceed?Send HEAD request for D)ocument, or C)ancel? (d,c): Internal error: Invalid mouse link %d!Goto a random URL is disallowed!You are not on a form submission button or normal link.** Bad HTML!! No form action defined. **You cannot edit File Management URLsDocument will not be reloaded!The 'd'ownload command is currently disabled.Form has a mailto action! Cannot download.This special URL cannot be downloaded!You cannot download an input field.You cannot download a printing option.You cannot download an upload option.You cannot download an permit option.You cannot download a mailto: link.Trace Log open failed. Trace off!There are no links above this line of the document.You are already at the end of this document.The current link is not in a FORMYou are already at the beginning of this document. Enter text into the field by typing on the keyboard Ctrl-U to delete all text in field, [Backspace] to delete a character Ctrl-U to delete text in field, [Backspace] to delete a character %s to delete all text in field, [Backspace] to delete a character %s to delete text in field, [Backspace] to delete a character Link number %d already is current.You are already at page %d of this document.You have entered an invalid link number.Currently viewing document source. Press '\' to return to rendered version.(NORMAL LINK) Use right-arrow or <return> to activate.--More-- This is a searchable index. Use %s to search.This is a searchable index. Use %s to search.-- press space for next page ---- press space for more, use arrow keys to move, '?' for help, 'q' to quit.Commands: Use arrow keys to move, '?' for help, 'q' to quit, '<-' to go back.Mail disallowed! Cannot submit.This special URL cannot be a form ACTION!file: URLs via served links are disallowed!file: URLs via bookmarks are disallowed!This special URL is not allowed in external documents! Turning off TRACE for fetch of log. original anchor %d, topline %d, link %d, offset %d old anchor %d -> new anchor %d adjusted anchor %d, topline %d, link %d, offset %d No owner is defined for this file so you cannot send a commentMail is disallowed so you cannot send a commentDo you wish to send a comment?Bookmark features are currently disabled.Save D)ocument or L)ink to bookmark file or C)ancel? (d,l,c): Reproduce L)ink in this bookmark file or C)ancel? (l,c): Documents from forms with POST content cannot be saved as bookmarks.Save L)ink to bookmark file or C)ancel? (l,c): There are no links in this bookmark file!Save D)ocument to bookmark file or C)ancel? (d,c): History, showinfo, menu and list files cannot be saved as bookmarks.Validate and some anonymous restrictions are set. Validate restrictions set, restriction "default" was given. Validate restrictions set, additional anonymous restrictions ignored. Validate restrictions are set. Anonymous restrictions set, restriction "all" was given. Anonymous restrictions are set. Restrictions "all" and "default" were given. Restriction "default" was given. Changing working-directory is currently disabled.A component of path is not a directoryYou are not allowed to goto "%s" URLsGoto a non-http URL is disallowed!Entering mainloop, startfile=%s Bookmark files cannot be traversed (only http URLs).Unable to open bookmark file, use 'a' to save a link firstReparsing document under current settings...goto_line(%d) -> link %d -> %d Fatal error - could not open output file %s Historical comment parsing ON (Minimal is overridden)!Historical comment parsing OFF (Minimal is in effect)!Historical comment parsing ON (Valid is overridden)!Historical comment parsing OFF (Valid is in effect)!Minimal comment parsing ON (and in effect)!Minimal comment parsing OFF (Valid is in effect)!Minimal comment parsing ON (but Historical is in effect)!Minimal comment parsing OFF (Historical is in effect)!Soft double-quote parsing OFF!Now using TagSoup parsing of HTML.Now using SortaSGML parsing of HTML!Are you sure you want to quit?Copy D)ocument's or L)ink's URL to clipboard or C)ancel?Document URL put to clipboard.There are no links below this line of the document.You are already at the first documentCurrent document has POST data.No index is currently available.Do you really want to go to the Main screen?You are already at main screen!A URL specified by redirectionNot a searchable indexed document -- press '/' to search for a text stringThis field cannot be (e)dited with an external editor.External editing is currently disabled.The 'e'dit command is currently disabled.System error - failure to get status.Do you really want to delete this link from your bookmark file?Not in a TEXTAREA; cannot use external editor.Not in a TEXTAREA; cannot use command.The 'p'rint command is currently disabled.No previously visited links available!Document has no Toolbar links or Banner.Spawning your default shell. Use 'exit' to return to Lynx. Spawning is currently disabled.No trace log has been started for this session.Links will be included for all images! Reloading...Standard image handling restored! Reloading...Pseudo_ALTs will be inserted for inlines without ALT strings! Reloading...Inlines without an ALT string specified will be ignored! Reloading...charset for this document specified explicitly, sorry...Raw 8-bit or CJK mode toggled OFF! Reloading...Raw 8-bit or CJK mode toggled ON! Reloading...Clear all authorization info for this session?Shifting is disabled while line-wrap is in effectEntering handle_LYK_LINEWRAP_TOGGLE ...setting LYwideLines %d, LYtableCols %d (have %d and %d) Jumping to a shortcut URL is disallowed!No jump file is currently available.Wrap columns at 3/4 screen widthWrap columns at 2/3 screen widthWrap columns at 1/2 screen widthWrap columns at 1/3 screen widthWrap columns at 1/4 screen width����"��������������������A��^����ދ���|��d��<��������~����������ҙ��B���i����D����_��������ѵ�Ƕ��C����Д�Z��V���� �� �� ����{���]��E���`����ݧ����P��Q��:��Z�����ޢ���G����a�����h�������Y��ӽ����8���"��������E����h���������/��g�����h�����q�����C��� CSS:LYAttrset (A_NORMAL) lynx_map_color(%d) ........... %s (0x%x) %s CACHED: <%s> @(%d,%d) undefined, trimming at %p ok (%d) LYgetTableString(%d) ->%s lynx_setup_colors LYnoVideo(%d) Cannot open tty input Screen size: %s() Screen size is now %d x %d using curses-pads color_cfg[%u] = %d/%d start_curses: done. TERM=%.106s
%s
Enter a terminal type: %s [vt100] networkdialupdumbswitchethernetvt100TERMINAL TYPE IS SET TOsunstop_curses: done. standoutblinkdimCSS:LYAttrset color %#x -> (%s) CSS:LYAttrset mono %#x -> (%s) CSS(SET): <%s> hash=%d, ca=%#x, ma=%#x CSS.CS:Style %d not configured CSS.CS:<%s%s> style %d color %#x in LynxChangeStyle(curses_w_style)attribute cache FULL, dropping lastCSSTRIM:trying to set [%s] style - %#x -> %#x (mono %#x pair %d) fg=%d, bg=%d lynx_chg_color(color=%d, fg=%d, bg=%d) Terminal reinitialisation failed - unknown terminal type?Terminal initialisation failed - unknown terminal type?initializing default colors %d/%d lynx_init_colors (default %d/%d) Your Terminal type is unknown!Unable to create popup window![%2d,%2d] LYwaddnstr(%.*s, %u) ABCDEFGHIJKLMNOPQRSTUVWXYZ<ol><LI><a href=fflush(nfp): %srename(): %srenaming the fileBookmark deletion failed.Screen too small! (8x35 min)' previous, 'next screen Select Bookmarkncsa-xmosaic-hotlist-format-1Converted Mosaic Hotlist%s
Unable to open bookmark file for deletion of link.Unable to open scratch file for deletion of link.Unable to reopen temporary file for deletion of link.Link is not by itself all on one line in bookmark file.remove_bookmark_link: skipping link %d remove_bookmark_link: files: %s %s Unable to copy temporary file for deletion of link.Error renaming temporary file.File may be recoverable from %s during this sessionBookmark file is not defined. Use %s to see options. Select Bookmark (screen %d of %d)Select destination or ^G to Cancel: Select subbookmark, '=' for menu, or ^G to cancel: get_bookmark_filename: SEEKING %s AS %s
Unable to open tempfile for X Mosaic hotlist conversion.<head> <title>%s</title> </head> This file is an HTML representation of the X Mosaic hotlist file. Outdated or invalid links may be removed by using the remove bookmark command, it is usually the 'R' key but may have been remapped by you or your system administrator.ERROR - unable to open bookmark file.Note: if you edit this file manually you should not change the format within the lines or add other HTML markup. Make sure any bookmark link is saved as a single line. This file also may be edited with a standard text editor to delete outdated or invalid links, or to change their order. You can delete links using the remove bookmark command. It is usually the 'R' key but may have been remapped by you or your system administrator.%s<br> %s
<!-- %s -->
<p> <ol>
save_bookmark_link: SEEKING %s AS %s
%s %s %sABCDEFGHIJKLMNOPQRSTUVWXYZLYmktime: Parsing '%s' LYmktime: clock=%ld, ctime=%swais://gopher://cso://ftp://finger://nntp://ftp.gopher.wais.cso.ph.finger.news.nntp.guess_scheme(%s) -> '%s' Too many tempfilesL%u-%uTMP%sError in LYToggleSigDfl: %s statuslineLYUtils.cfound %d, x_offset=%d. not found, assume <a>. found %d. /dev/tty *** Set simulated 'Z', %d pending *** Unset simulated 'Z'snewspost:snewsreply:afs:prospero:Forcing curses on to %s Cannot write to file.Enter a new filename: /dev//var/run/utmpfile://localhost%s%ufile://localhost/%s%utemp%.*sunknown restriction%s: %.*s No restrictions set. Restrictions set: goto_*** You have new mail. ****** You have mail. ***!--#lynxCSI <p align="center">URL: </p>
ERRCheckDir(%s) %s /tmpCannot find HOME directory/error%s/%.*s%.*s%s%sIsOurSymlink(%s -> %s) IsOurFile(%s) %d wbcannot remove %s LYOpenTemp(,%s,%s) %s @%d: BUG lynxXXXXXXXXXXmade subdirectory %s LYOpenTemp... LYOpenTemp(%s) LYOpenScratchLYOpenScratch(%s) , closedLYCloseTemp(%s) ...LYCloseTemp(%s)%s , still open!LYOpenTempRewrite(%s,%s,%s) ...used before%s is NOT our file....%s%s is our file.exists and is writable, LYCloseTempFP ...LYCloseTempFP(%s) LYRemoveTemp(%s) ...LYRemoveTemp done(%d)%s bibp1.0/bibpicon.jpgLYValidateOutput '%s' File exists. Overwrite?Save request cancelled!!!<html> <head> <base href="%s"> Version <h1>%s (%s%s%s)</h1> </body> </html>LYCleanupTemp removing %s file://localhostLYTildeExpand %s expanded path %s /etcLYNX_CFG_PATHLYSystem(%s) command: %s exec $SHELLDISPLAYDISPLAY=%sRL_PASTE_CMDRL_CLCOPY_CMD *** Got simulated 'Z' *** resolvedtimed outConverted '%s' to '%s' Can't stat() or fopen() '%s' Looking up %s '%s'%s , guessing...%s '%s'%s Trying: '%s' /*%s%s'%s' is not a URL goto_bibpgoto_configinfogoto_csogoto_filegoto_fingergoto_ftpgoto_gophergoto_httpgoto_httpsgoto_lynxcgigoto_lynxexecgoto_lynxproggoto_mailtogoto_newsgoto_nntpgoto_rlogingoto_snewsgoto_telnetgoto_tn3270goto_wais O)ther cmds H)elp K)eymap G)oto P)rint M)ain screen o)ptions Q)uit O)ther cmds B)ack E)dit D)ownload ^R)eload ^W)ipe screen search doc: / O)ther cmds C)omment History: <backspace> Bookmarks: V)iew, A)dd, R)emove LYhighlight cur %d (bug workaround) LYhighlight at(%2d,%2d) %s %d [%d]:%s STYLE.highlight.off: cached style @(%d,%d): STYLE.highlight.off: can't use cache. STYLE.highlight.on: @(%d,%d). STYLE.highlight.off: NOFIX branch @(%d,%d). STYLE.highlight.line2: @(%d,%d), style=%d. Arrow keys: Up and Down to move. Right to follow a link; Left to go back. C)reate D)ownload E)dit F)ull menu M)odify R)emove T)ag U)pload H)elp O)ptions P)rint G)o M)ain screen Q)uit /=search [delete]=history list LYReopenInput open(%s) returned %d. LYReopenInput freopen(%s,"r",stdin) returned %p, stdin is now %p with fd %d. Unexpected access protocol for this URL scheme.Could not get ttyname (returned %s) or open UTMP file %s Window size changed from (%d,%d) to (%d,%d) lynx_temp_space is not our directory %s owner %d mode %03o lynx_temp_space is not a directory %s ... LYOpenTemp(%s) failed: %s ... truncate(%s,0) failed: %s ... LYOpenTempRewrite(%s), %s LYRenamedTemp(old=%s, new=%s) <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN"> <title>%s</title> </head> <body> <h1>%s (%s%s%s), <a href="%s%s">help</a></h1> builtin copy ->%d source=%s target=%s Download document URL put to clipboard.LYExpandHostForURL: Ignoring interrupt because '%s' resolved. LYExpandHostForURL: Interrupted while '%s' failed to resolve. LYExpandHostForURL: Ignoring interrupt because '%s' %s. �9��:���9��:��09��:��:��:��:��:�� 7���6��p6��:��:��:��:��6��:��:��:��:��:��:��:��:��:��:��:��:��:��:���9��:���9��:��09��:��:��:��:��:�� 7���6��p6��:��:��:��:��6���;���5��h;���5���5���5���:��}:���5���5���5���5���5���5���5��W:���5��1:���5���9���5���5���9���5���5���5���5���5���5���5���5���5���;���5��h;���5���5���5���:��}:���5���5���5���5���5���5���5��W:���5��1:���5���9���5���5���9��Ɗ���������������Ɖ�����������_���_���_���_���_���_�������C���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_���_������������@F0�?Value accepted! -- WARNING: Lynx is configured for XWINDOWS!Value accepted! -- WARNING: Lynx is NOT configured for XWINDOWS!Failed to set DISPLAY variable!Failed to clear DISPLAY variable!Hit any key to change value; RETURN to accept.Editing Bookmark DESCRIPTION and FILEPATH (%d of 2) Editing Bookmark DESCRIPTION and FILEPATHHit RETURN to accept entered data.Use a filepath off your home directory!Screen height must be at least 23 lines for the Options menu!(E)ditor : (D)ISPLAY variable : (F)TP sort criteria : (P)ersonal mail address : (S)earching type : display (C)haracter set : preferred document lan(G)uage: preferred document c(H)arset : (^A)ssume charset if unknown : Raw 8-bit or CJK m(O)de : popups for selec(T) fields : li(N)e edit style : Ke(Y)board layout : l(I)st directory style : (U)ser mode : user (A)gent : You are not allowed to change which editor to use!Multiple bookmark support is not available.You are not allowed to change the bookmark file!That key requires Advanced User mode.Access to dot files is disabled!Your '%s' terminal does not support color.Terminal does not support colorHit RETURN to accept entered data. Delete data to invoke the default.Use "L_y_n_x" or "Lynx" in User-Agent, or it looks like intentional deception!Changing of the User-Agent string is disabled! '>' to save, or 'r' to return to Lynx Links and form fields are numbered(K)eypad mode : Links are numbered Form fields are numbered Numbers act as arrows Random URL is disallowed! Use a shortcut.<form action="%s" method="post"> <input name="%s" type="hidden" value="%s"> <input type="submit" value="%s"> - <input type="reset" value="%s"> - <input type="checkbox" name="%s"> (options marked with (!) will not be saved)<input size=%d type="text" name="%s" value="%s" %s> Use locale-based character setUse HTML5 charset replacementsAssumed document character setHeaders Transferred to Remote ServersPreferred document character set<input type="checkbox" name="%s" %s %s>
%s<a href="%s">lynx.cfg</a>. Use %s to invoke the Options menu!default_colors changed, updating colors...
Value accepted!<option value="%s" %s>%s (!)L_y_n_xl_y_n_x| to save, or ^G to return to Lynx.Letter: Saving Options...Options saved! 'r' to return to Lynx NONEBy FilenameBy Size By Type By Date CASE SENSITIVE CASE INSENSITIVEON Mixed style Directories firstNovice IntermediateAdvanced Options Menu (mu(L)ti-bookmarks: review/edit (B)ookmarks files(B)ookmark file: show color (&) : NEVER Always tryALWAYS (V)I keys: e(M)acs keys: sho(W) dot files: show cursor (@) : verbose images (!) : Select capital letter of option line,Command: review/edit B)ookmarks filesLYOptions.cOFF ON Files first build_lss_enumvisited_links<select name="%s" %s> </select> TRUEFALSEbreak_data %s break_data(calloc)...item[%d] tag=%s, value=%s break_data(realloc)Options Menu<p align=center> Accept ChangesReset ChangesLeft Arrow cancels changes%s - HELP!keystrokes/option_help.html<a href="%s%s">%s</a> Save options to disk<p align=center>%s: save_optionsGeneral Preferencesfile_editorType of Searchcase_sensitive_searchingSecurity and Privacy %s<em>%s</em> set_cookiesask useraccept allInvalid-Cookie Promptingforce_cookie_promptSSL Promptingforce_ssl_promptSSL client certificate filessl_client_cert_fileSSL client key filessl_client_key_fileKeyboard InputKeypad modeEmacs keysemacs_keysVI keysvi_keysLine edit stylelineedit_modeKeyboard layoutkblayoutDisplay and Character Setlocale_charsetDisplay character setcharacter_setCJK moderaw_modeRaw 8-bitX DisplayDocument AppearanceShow colorshow_colorColor stylecolor_styleDefault colorsShow cursorUnderline linksShow scrollbarPopups for select fieldsHTML error recoveryBad HTML messagesbad_htmlShow imagesas labelsas linksVerbose imagesverbose_imagesCollapse BR tagsTrim blank linesPersonal mail addresspersonal_mail_addressPersonal name for mailpersonal_mail_namePassword for anonymous ftpanonftp_passwordPreferred content typepreferred_content_typePreferred media typepreferred_media_typesPreferred encodingpreferred_encodingpreferred_charsetPreferred document languagepreferred_languageHTTP protocolhttp_protocolSend User-Agent headersend_useragentListing and Accessing FilesUse Passive FTPftp_passiveFTP sort criteriafile_sorting_methodLocal directory sort criteriadir_list_styleLocal directory sort orderdir_list_orderShow dot filesshow_dotfilesPause when showing messageno_pauseShow transfer rateshow_kb_rateSpecial Files and ScreensMulti-bookmarksmulti_bookmarkReview/edit Bookmarks filesGoto multi-bookmark menuLYNXOPTIONS://MBM_MENUBookmarks fileAuto Sessionauto_sessionSession filesession_fileVisited PagesView the file </pre> </form> Unexpected way of accessingEditorUser modemake_pseudo_alts_for_inlinesmake_links_for_all_imagesNoviceAdvancedFiles firstMixed styleNumbers act as arrowsLinks are numberedCASE SENSITIVEBy TypeBy SizeBy DateOFF STANDARDADVANCEDHTTP 1.0HTTP_1_0HTTP 1.1HTTP_1_1encoding_noneencoding_gzipencoding_deflateencoding_compressencoding_bzip2Allencoding_allAccept lynx's internal typesmedia_opt1Also accept lynx.cfg's typesmedia_opt2Also accept user's typesmedia_opt3Also accept system's typesmedia_opt4Accept all typesmedia_allDo not show raterate_offShow %s/sec raterate_bytesrate_kbShow %s/sec, ETArate_eta_bytesrate_eta_kbShow %s/sec (2-digits), ETArate_eta_bytes2rate_eta_kb2Show progressbarrate_barBy Nameftp_by_nameftp_by_typeftp_by_sizeftp_by_datedired_by_namedired_by_typedired_by_sizedired_by_dateBy Modedired_by_modeBy Userdired_by_userBy Groupdired_by_groupdired_dirdired_filesdired_mixedtrim-linescollapseshow filenameIgnoreAdd to trace-fileAdd to LYNXMESSAGESWarn, point to trace-filewarnrelaxed (TagSoup mode)strict (SortaSGML mode)sortasgmlBy First Visitfirst_visitedBy First Visit Reversedfirst_visited_reversedAs Visit Treevisit_treeBy Last Visitlast_visitedBy Last Visit Reversedlast_visited_reversedCase insensitivecase_insensitiveCase sensitivecase_sensitivenumber_arrowslinks_numberedlinks_and_formsForm fields are numberedforms_numbered����������������������������������������������������������������������`���P��� �������������������������������������������.���*���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���ٴ��.���.���.���.������.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���.���/���.�����������������������������ݷ������.���\�������J���ڱ������|���.���-���(���P���ү��S������.�������force no-responseforce yes-responseprompt normallyALWAYSNEVEROFFONdisabledselectedNON_XWINDOWSNO_BUILTINPRECEDENCE_HEREPRECEDENCE_OTHERInvalid SUFFIX_ORDER:%s binaryInvalid SUFFIX:%s ignored. what?(no name)blackbrown%16s %16s %16s %16s Offending line:%s COLOR:%s HTMLSRC_%sBad syntax in TAGSPEC %s:%s LANG=%sDIRED :#TOGGLE_HELPPASS!JUMPFILE:%sFailed to register %s display charsetassumed doc charset - EMPTY STRING - all unhidden - %d matches - OK, %d matches - NOT recognised lynx_lss_file_fun '%s' read_cfgLYReadCFG.cparse_list_string(%s) '%s' parse_list_bool(%s) '%d' parse_list_int(%s) '%d' SENDcheck_color(%s,%d) => default %d => %d => ERR_COLOR opening config file %s LYSetConfigValue%s=%sLoading cfg file '%s'. included from '%s'. ### %s %s, at %sLYReadCFG: missing ':' %s LYReadCFG %s:%s LYReadCFG: ignored %s:%s %s is not allowed in the %s %s:<a href="%s">%s</a>
#<begin %s> unknown option name %s in %s * %s #<end of %s>
LYNXCFG://reloadLynx.cfg InformationPlease read the distribution<em>%s %s <a href="%s">lynx.cfg</a> for more comments. </em>lynx.cfg<em> See also%s</pre><ul><li>compile time options<a href="%s">%s</a>color-style configuration</ul><pre> RELOAD THE CHANGESYour primary configuration<em>%s</em>
%s<br> <em>lynx_cfg.h</em> BZIP2_PATH"/usr/bin/bzip2"CAN_SET_ERRNOCJK_EXCOLOR_CURSESDIRED_SUPPORTDISP_PARTIALENABLE_IPV6ENABLE_NLSEXP_JAPANESEUTF8_SUPPORTEXP_KEYBOARD_LAYOUTFANCY_CURSESGCC_NORETURN__attribute__((noreturn))GCC_PRINTFGCC_UNUSED__attribute__((unused))GETGROUPS_Tgid_tGZIP_PATH"/usr/bin/gzip"HAVE_ALLOCAHAVE_ALLOCA_HHAVE_ARGZ_HHAVE_ARPA_INET_HHAVE_ASSUME_DEFAULT_COLORSHAVE_ATOLLHAVE_CBREAKHAVE_CTERMIDHAVE_CURSES_VERSIONHAVE_CUSERIDHAVE_DCGETTEXTHAVE_DEFINE_KEYHAVE_DELSCREENHAVE_DIRENT_HHAVE_FCNTL_HHAVE_FTIMEHAVE_GAI_STRERRORHAVE_GETADDRINFOHAVE_GETATTRSHAVE_GETBEGXHAVE_GETBEGYHAVE_GETBKGDHAVE_GETCWDHAVE_GETGROUPSHAVE_GETTEXTHAVE_GETTIMEOFDAYHAVE_GETUIDHAVE_ICONVHAVE_INET_ATONHAVE_INTTYPES_HHAVE_KEYPADHAVE_LANGINFO_CODESETHAVE_LC_MESSAGESHAVE_LIBINTL_HHAVE_LIMITS_HHAVE_LOCALE_HHAVE_LONG_LONGHAVE_LSTATHAVE_LYHELP_HHAVE_MALLOC_HHAVE_MBSTATE_THAVE_MKDTEMPHAVE_MKTEMPHAVE_MMAPHAVE_MUNMAPHAVE_NAPMSHAVE_NCURSESW_TERM_HHAVE_NEWPADHAVE_NEWTERMHAVE_NL_TYPES_HHAVE_PNOUTREFRESHHAVE_POPENHAVE_PUTENVHAVE_READDIRHAVE_RESIZETERMHAVE_SETENVHAVE_SETLOCALEHAVE_SETUIDHAVE_SIGACTIONHAVE_SIZECHANGEHAVE_SLEEPHAVE_STDLIB_HHAVE_STPCPYHAVE_STRCASECMPHAVE_STRCHRHAVE_STRERRORHAVE_STRING_HHAVE_SYSLOG_HHAVE_SYS_FCNTL_HHAVE_SYS_IOCTL_HHAVE_SYS_PARAM_HHAVE_SYS_TIMEB_HHAVE_SYS_TIME_HHAVE_SYS_WAIT_HHAVE_TERMIOS_HHAVE_TERMIO_HHAVE_TERM_HHAVE_TOUCHLINEHAVE_TOUCHWINHAVE_TRUNCATEHAVE_TTYNAMEHAVE_TTYTYPEHAVE_TYPE_CHTYPEHAVE_UNISTD_HHAVE_UNSETENVHAVE_USE_DEFAULT_COLORSHAVE_USE_LEGACY_CODINGHAVE_USLEEPHAVE_UTMPHAVE_UTMP_UT_HOSTHAVE_UTMP_UT_SESSIONHAVE_UTMP_UT_XSTATUSHAVE_UTMP_UT_XTIMEHAVE_VASPRINTFHAVE_WAITPIDHAVE_WATTR_GETHAVE_WBORDERHAVE_WREDRAWLNHAVE_WRESIZEHAVE_ZERRORHAVE__NC_FREEALLHAVE__NC_FREE_AND_EXITHAVE___ARGZ_COUNTHAVE___ARGZ_NEXTHAVE___ARGZ_STRINGIFYHOMEPAGE_URLICONV_CONSTINSTALL_ARGS"-c"INSTALL_PATH"/usr/bin/install"LONG_LISTLYNXCGI_LINKSLYNX_CFG_FILE"/etc/lynx.cfg"LYNX_CFG_H"/etc"LYNX_LSS_FILE"/etc/lynx.lss"LYNX_RAND_MAXINT_MAXMIME_LIBDIR"/etc/"MV_PATH"/usr/bin/mv"NCURSESNLS_TEXTDOMAIN"lynx"NSL_FORKOK_GZIPOK_OVERRIDEOK_PERMITOK_TAROK_UUDECODEOK_ZIPRLOGIN_PATH"/usr/bin/rlogin"RM_PATH"/usr/bin/rm"SIZEOF_INTSIZEOF_LONGSIZEOF_OFF_TSIZEOF_TIME_TSTDC_HEADERSSYSTEM_MAIL"unknown"SYSTEM_MAIL_FLAGS"-t -oi"SYSTEM_NAME"linux-gnu"TAR_DOWN_OPTIONS"-xf"TAR_FILE_OPTIONSTAR_PATH"/usr/bin/tar"TAR_PIPE_OPTIONS"-"TAR_UP_OPTIONS"-cf"TELNET_PATH"/usr/bin/telnet"TERMIO_AND_CURSESTIME_WITH_SYS_TIMETRACK_INTERNAL_LINKSUNCOMPRESS_PATH"/usr/bin/gunzip"UNDERLINE_LINKSUNIXUNZIP_PATH"/usr/bin/unzip"USE_ADDRLIST_PAGEUSE_ALT_BINDINGSUSE_ASCII_CTYPESUSE_CACHEJARUSE_CHARSET_CHOICEUSE_COLOR_STYLEUSE_EXTERNALSUSE_FILE_UPLOADUSE_JUSTIFY_ELTSUSE_LOCALE_CHARSETUSE_OPENSSL_INCLUSE_PERSISTENT_COOKIESUSE_PRETTYSRCUSE_PROGRESSBARUSE_READPROGRESSUSE_SCROLLBARUSE_SESSIONSUSE_SOURCE_CACHEUSE_SSLUSE_SYSV_UTMPUSE_X509_SUPPORTUSE_ZLIBWIDEC_CURSESZCAT_PATH"/usr/bin/zcat""/usr/bin/zip"lynx_randlynx_srandsrandomut_exit.e_exitalt_char_setansi_cc-DCC_HAS_PROTOSar_flags-curvUbaddef_removebool_defsbuildx86_64-redhat-linux-gnubuild_aliasc_compiler_gnuc_inlinechtype_declchtype_typescalarcolor_cursescurses_dirdcl_errnodcl_sys_errlistdcl_sys_nerrdefault_sourcedefine_sigwinchenv_CC_setenv_CC_valueenv_CFLAGS_setenv_CFLAGS_valueenv_CPPFLAGS_setenv_CPPFLAGS_valueenv_CPP_setenv_CPP_valueenv_LDFLAGS_setenv_LDFLAGS_valueenv_build_alias_setenv_build_alias_valueenv_host_alias_setenv_host_alias_valueenv_target_alias_setenv_target_alias_valuefancy_cursesfind_linkage_iconvfind_linkage_idnfind_linkage_intlfind_linkage_sslfind_linkage_zfionbioioctlforce_use_gnu_gettextfunc___argz_countfunc___argz_nextfunc___argz_stringifyfunc__nc_free_and_exitfunc__nc_freeallfunc_alloca_worksfunc_assume_default_colorsfunc_atollfunc_cbreakfunc_ctermidfunc_curses_versionfunc_cuseridfunc_dcgettextfunc_decl_getgrgidfunc_decl_getgrnamfunc_decl_sleepfunc_decl_strstrfunc_define_keyfunc_delscreenfunc_feof_unlockedfunc_fgets_unlockedfunc_forkfunc_fork_worksfunc_fseekofunc_ftimefunc_getattrsfunc_getbegxfunc_getbegyfunc_getcwdfunc_getegidfunc_geteuidfunc_getgidfunc_getgroupsfunc_gethostbynamefunc_gethostnamefunc_getpagesizefunc_gettextfunc_gettimeofdayfunc_getuidfunc_iconvfunc_inet_ntoafunc_keypadfunc_lstatfunc_mempcpyfunc_mkdtempfunc_mktempfunc_mktimefunc_mmap_fixed_mappedfunc_munmapfunc_napmsfunc_newpadfunc_newtermfunc_pnoutrefreshfunc_popenfunc_putenvfunc_readdirfunc_resizetermfunc_setenvfunc_setlocalefunc_setuidfunc_sigactionfunc_sleepfunc_socketfunc_stpcpyfunc_strcasecmpfunc_strchrfunc_strdupfunc_strerrorfunc_strstrfunc_strtoulfunc_touchlinefunc_touchwinfunc_truncatefunc_tsearchfunc_ttynamefunc_unsetenvfunc_use_default_colorsfunc_use_legacy_codingfunc_usleepfunc_vasprintffunc_vforkfunc_vfork_worksfunc_waitpidfunc_wattr_getfunc_wborderfunc_wredrawlnfunc_wresizefunc_zErrorgnu_library_2_1gnu_sourcegnutls_compathave_errnohave_h_errnohave_inet_atonhave_sslhave_sys_errlisthave_sys_nerrhave_ttytypehave_utmphave_utmp_ut_hosthave_utmp_ut_namehave_utmp_ut_sessionhave_utmp_ut_syslenhave_utmp_ut_xstatushave_utmp_ut_xtimeheader_argz_hheader_arpa_inet_hheader_dirent_dirent_hheader_fcntl_hheader_intlheader_inttypes_hheader_lastlog_hheader_libgtheader_libintl_hheader_limits_hheader_locale_hheader_malloc_hheader_memory_hheader_ncursesw_term_hheader_nl_types_hheader_path_iconv/usr/includeheader_path_idn/usr/lib64/../includeheader_path_intlheader_path_ssl/usr/include/opensslheader_path_zheader_paths_hheader_stdcheader_stddef_hheader_stdint_hheader_stdlib_hheader_string_hheader_strings_hheader_sys_fcntl_hheader_sys_filio_hheader_sys_ioctl_hheader_sys_param_hheader_sys_stat_hheader_sys_time_hheader_sys_timeb_hheader_sys_types_hheader_sys_wait_hheader_syslog_hheader_term_hheader_termio_hheader_termios_hheader_timeheader_unistd_hheader_vfork_hipv6typelinux-glibclanginfo_codesetlib_dir_opendirlib_dl_dlsymlib_inet_mainlibrary_file_z-lzlibrary_path_iconv/usr/liblibrary_path_idnlibrary_path_intllibrary_path_ssllibrary_path_zmakeflagsmixedcasencurses_brokenneed_xopen_extensionnetlibsngroupsobjextpath_BZIP2/usr/bin/bzip2path_GMSGFMT/usr/bin/msgfmtpath_GZIP/usr/bin/gzippath_INSTALL'/usr/bin/install -c'path_MSGFMTpath_MSGINIT/usr/bin/msginitpath_MV/usr/bin/mvpath_PKG_CONFIGpath_RLOGIN/usr/bin/rloginpath_RM/usr/bin/rmpath_TAR/usr/bin/tarpath_TELNET/usr/bin/telnetpath_UNCOMPRESS/usr/bin/gunzippath_UNZIP/usr/bin/unzippath_XGETTEXT/usr/bin/xgettextpath_ZCAT/usr/bin/zcatpath_ZIP/usr/bin/zippath_ac_pt_WINDRESpath_installpath_lastlog_PATH_LASTLOGpkg_config_sslprog_CPP'gcc -E'prog_MAKE_LOWER_TAGSprog_MAKE_UPPER_TAGSprog_RANLIBranlibprog_ac_ct_ARprog_ac_ct_CCgccprog_ac_ct_RANLIBprog_cc_gprog_cc_stdcprog_cpp_commentsprog_make_make_setproto_iconv_arg1proto_iconv_constrand_maxncurseswset_errnosizechangesizeofsizeof_intsizeof_longsizeof_off_tsizeof_time_tsrand_funcsrandom/randomstruct_dirent64sys_file_offset_bitssys_large_filessys_largefile_CCsys_largefile_sourcesystem_mail_flags'-t -oi'system_namesysv_utmptargettarget_aliasterm_headerterm.htermio_and_cursestermio_and_termiostm_gmtofftype_getgroupstype_inttype_intptr_ttype_longtype_long_longtype_mode_ttype_off_ttype_pid_ttype_size_ttype_socklen_ttype_ssize_ttype_time_ttype_uid_ttype_unionwaitunctrl_headerunctrl.huse_libgnutlsuse_libnss_compatuse_libsocks5use_libsocksuse_libssl/usr/lib64utf8_libval_LC_MESSAGESwidec_curseswidec_mbstateworking_alloca_hcommalertsecsalways_resubmit_postsassumed_colorassumed_doc_charset_choiceauto_uncache_dirlistsbibp_bibhostbibp_globalserverblock_multi_bookmarksbold_h1bold_headersbold_name_anchorsbzip2_pathcase_sensitive_always_oncheckmailchmod_pathcopy_pathconv_jisx0201kanacookie_accept_domainscookie_loose_invalid_domainscookie_query_invalid_domainscookie_reject_domainscookie_strict_invalid_domainscso_proxydelaysecsdefault_bookmark_filedefault_cache_sizedefault_editordefault_index_filedefault_keypad_modedefault_user_modedired_menudisplay_charset_choicedownloaderemacs_keys_always_onenable_lynxrcexternal_menufinger_proxyforce_8bit_toupperforce_ssl_cookies_secureftp_formatglobal_extension_mapglobal_mailcapgotobuffergzip_pathguess_schemehelpfilehidden_link_markerhistorical_commentshtmlsrc_attrname_xformhtmlsrc_tagname_xformhttp_proxyhttps_proxyinflate_pathinfosecsinstall_pathjump_promptjumpbufferjumpfilejustify_max_void_percentkeyboard_layoutleftarrow_in_textfield_promptlist_formatlist_news_dateslist_news_numberslocal_domainlocalhost_aliaslynx_host_namelynx_sig_filelynxcgi_document_rootlynxcgi_environmentmail_system_error_loggingmax_cookies_buffermax_cookies_domainmax_cookies_globalmax_uri_sizemessagesecsmessage_languageminimal_commentsmkdir_pathmulti_bookmark_supportmv_pathncr_in_bookmarksnews_chunk_sizenews_max_chunknews_postingnntp_proxynntpservernumber_fields_on_leftnumber_links_on_leftno_dot_filesno_file_refererno_forced_core_dumpno_from_headerno_ismap_if_usemapno_marginsno_proxyno_referer_headerno_table_centerno_titleoutgoing_mail_charsetpersistent_cookiespersonal_extension_mappersonal_mailcappositionable_editorprepend_base_to_sourceprepend_charset_to_sourceprettysrc_specprinterquit_default_yesreferer_with_queryreplaysecsreuse_tempfilesrlogin_pathrmdir_pathrm_pathrulesfilesave_spacescan_for_buried_news_refsseek_frag_area_in_curseek_frag_map_in_cursession_limitshow_kb_namesnews_proxysnewspost_proxysnewsreply_proxysource_cachesource_cache_for_abortedssl_cert_filestatus_buffer_sizestrip_dotdot_urlssubstitute_underscoressuffixsuffix_ordersystem_editorsystem_mailtar_pathtelnet_pathtextfields_need_activationtn3270_pathtouch_pathtrack_internal_linkstrusted_lynxcgiuncompress_pathunzip_pathuploaderurl_domain_prefixesurl_domain_suffixesuse_select_popupsuudecode_pathvi_keys_always_onviewerwais_proxywait_viewer_terminationxloadimage_commandzcat_pathKEEPDROPMEMORYlightgraybrightredbrightgreenyellowbrightbluebrightmagentabrightcyanwhiteInvalid q=%s for SUFFIX:%s, using -1.0 SUFFIX:%s without MIME type for %s Lynx: cannot start, CERN rules file %s is not available Syntax Error parsing COLOR in configuration file: The line must be of the form: COLOR:INTEGER:FOREGROUND:BACKGROUND
Here FOREGROUND and BACKGROUND must be one of: The special strings 'nocolor' or 'default', or key remapping of %s to %s for %s failed key remapping of %s to %s failed invalid line-editor selection %s for key %s, selecting all setting of line-editor binding for key %s (0x%x) to 0x%x for %s failed setting of line-editor binding for key %s (0x%x) for %s failed parsing charset choice for %s:"%s"ignoring incomplete list_item '%s' bad format of PRETTYSRC_SPEC setting value, ignored %s bad format of PRETTYSRC_SPEC setting value, ignored %s:%s LYReadCFG - parsing tagspec '%s:%s' for option '%s' Failed to set keyboard layout %s bad value for htmlsrc_tagname_xform (ignored - must be one of 0,1,2): %d bad value for htmlsrc_tagname_xform (ignored): %s bad value for htmlsrc_attrname_xform (ignored - must be one of 0,1,2): %d bad value for htmlsrc_attrname_xform (ignored): %s ...ignored since DEFAULT_COLORS:off More than %d nested lynx.cfg includes -- perhaps there is a loop?!? Last attempted include was '%s', No filename following -cfg switch! lynx.cfg file not found as '%s' Options allowed in this file: The following is read from your lynx.cfg file. <a href="%s//reload">%s</a>
#<em>%s <a href="%s">%s</a></em> The following data were derived during the automatic configuration/build process of this copy of Lynx. When reporting a bug, please include a copy of this page. %s<br> <em>config.cache</em> The following data were used as automatically-configured compile-time definitions when this copy of Lynx was built."https://lynx.invisible-island.net/"'-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protection''-Wl,-z,relro -Wl,-z,now -specs=/usr/lib/rpm/redhat/redhat-hardened-ld'/usr/bin/x86_64-redhat-linux-gnu-pkg-configdefault_keypad_mode_is_numbers_as_arrowsprettysrc_view_no_anchor_numbering� �����������,��\��������������� ��l ��� ��<��@http-equiv="content-type"<li value=%d> <em>%s</em> </ol> </body> </html> (No messages yet)<p>%s </body> </html> HISTORY %s %d/%d (%d extra) LYpop_num(%d) link %d line %d title %s address %s LYAddVisitedLinkLYHistory.cFile Permission Options...clean_extra_historyLYAllocHistory...LYAllocHistory %d vs %d LYpush: just move the cursorbut didn't check out!...LYhist_prev...LYhist_prev_registerkeystrokes/history_help.htmlYou selected:(no address) (internal) (was internal)<tab to=t%d>%s (From History)<A NAME=current></A>keystrokes/visited_help.html<P> #current<META %s content="text/html;charset=%s"> Your recent statusline messages LYpush: pushed as internal link, OK
LYpush: push as internal link requested, %s
LYpush[%d]: address:%s title:%s LYpop[%d]: address:%s title:%s <p align=right> <a href="%s">[%s]</a> %s<em>%d</em>. <tab id=t%d><a href="%s%d">%s</a> <input type="submit" value="Accept Changes"> You visited (POSTs, bookmark, menu and list files excluded):%-*s%s<em>%d</em>. <tab id=t%d><a href="%s">%s</a> %-*s%s<em>%d</em>. <tab id=t%d><em>%s</em> UNMODIFIABLE form password. Use UP or DOWN arrows or tab to move off.(Password entry field) Inactive. Press <return> to activate.(Password entry field) Enter text. Use UP or DOWN arrows or tab to move off.UNMODIFIABLE option list. Use return or arrow keys to review or leave.(Option list "%s") Hit return to select option.(Option list) Hit return and use arrow keys and return to select option.UNMODIFIABLE form checkbox. Use UP or DOWN arrows or tab to move off.(Checkbox "%s") Use right-arrow or <return> to toggle.(Checkbox Field) Use right-arrow or <return> to toggle.UNMODIFIABLE form radio button. Use UP or DOWN arrows or tab to move off.(Radio Button "%s") Use right-arrow or <return> to toggle.(Radio Button) Use right-arrow or <return> to toggle.UNMODIFIABLE form field. Use UP or DOWN arrows or tab to move off.(mailto form field) Mail is disallowed so you cannot submit.(mailto form field) Inactive. Press <return> to change.(mailto form field) Enter text. Use <return> to submit, arrows to move off.(Form field) Inactive. Press <return> to edit, press <return> twice to submit.(Form field) Enter text. Use <return> to submit, arrows or tab to move off.(Form field) Inactive. Use <return> to edit (%s to submit with no cache).(Form field) Enter text. Use <return> to submit (%s for no cache).(Form field) Inactive. Use <return> to edit.(Form field) Enter text. Use <return> to submit.DISABLED form submit button. Use UP or DOWN arrows or tab to move off.(mailto form submit button) Mail is disallowed so you cannot submit.(mailto form submit button) Use right-arrow or <return> to submit.(Form submit button) Use right-arrow or <return> to submit.(Form submit button) Use right-arrow or <return> to submit ('x' for no cache).DISABLED form reset button. Use UP or DOWN arrows or tab to move off.(Form reset button) Use right-arrow or <return> to reset form to defaults.DISABLED Script button. Use UP or DOWN arrows or tab to move off.(Script button "%s") Use UP or DOWN arrows or tab to move off.(Script button) Use UP or DOWN arrows or tab to move off.UNMODIFIABLE file entry field. Use UP or DOWN arrows or tab to move off.(File entry field) Enter filename. Use UP or DOWN arrows or tab to move off.UNMODIFIABLE form text field. Use UP or DOWN arrows or tab to move off.(Textfield "%s") Inactive. Press <return> to activate.(Textfield "%s") Enter text. Use UP or DOWN arrows or tab to move off.(Text entry field) Inactive. Press <return> to activate.(Textarea "%s") Inactive. Press <return> to activate (%s for editor).(Textarea "%s") Enter text. Use UP/DOWN arrows or TAB to move off (%s for editor).(Textarea) Inactive. Press <return> to activate (%s for editor).(Textarea) Enter text. Use UP/DOWN arrows or TAB to move off (%s for editor).(Textarea "%s") Inactive. Press <return> to activate.(Textarea "%s") Enter text. Use UP/DOWN arrows or TAB to move off.(Textarea) Inactive. Press <return> to activate.(Textarea) Enter text. Use UP/DOWN arrows or TAB to move off.Form field value exceeds buffer length! Trim the tail.Enter Lynx keystroke command: Enter text. Use arrows or tab to move off of field.Clipboard empty or Not text data.Do you want to go back to the previous document?Use arrows or tab to move off of field.Modified tail combined with head of form field value.Bad HTML!! Unable to create popup window!One radio button must be checked at all times!Submit mailto form to Submit to Submit ('x' for no cache) to options_listLYForms.c�=�� >��p>���>���?��P?��@@��?���=��0=���=���?���@��P?���=���=���S���T���T���T��U��hU���S���U���S���T���S���T���S��hU��... format %s identity7bit... result %s Enter a filename: Edit the previous filename: Edit a previous filename: Ok...Print request cancelled!!!suggest %s lines=LOCAL_FILETO_SCREENLPANSIMAIL_FILEPRINTERnumber=pagelen=LYPrint: errno is %d <!-- X-URL: %s --> <!-- Date: %s --> Thu, 01 Jan 1970 00:00:01 GMT<!-- Last-Modified: %s --> <BASE HREF="%s"> Mail request cancelled!!!HEAD ERROR - Unable to mail fileContent-Type: text/htmlContent-Base: %s Content-Location: %s To: %s Subject: %s X-URL: %s
[5i [4iPress <return> to finish:
%sPress <return> to begin: ; charset=%s No Name Givenkeystrokes/print_help.html(approximately)pagesNumber of pages:Number of lines:Document: <em>%s</em> Standard print options:Print options:Save to a local fileSave to disk disabledMail the filePrint to the screenLocal additions:File does not exist.File is not readable.LYNX_PRINT_TITLELYNX_PRINT_URLLYNX_PRINT_DATELYNX_PRINT_LASTMODFile is %d screens long. Are you sure you want to print?LYPrint: filename is %s, action is `%c' <META HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=%s">
Viewing preparsed source. Are you sure you want to mail it?Please enter a valid internet mail address: <!-- X-URL: %s --> <BASE HREF="%s">
File is %d pages long. Are you sure you want to print?ERROR - Unable to allocate file space!!!ERROR! - printer is misconfigured!Printing file. Please wait...Be sure your printer is on-line. Press <return> to start printing: <em>%s</em> %s <em>%s</em> %d <em>%s</em> %d %s %s Some print functions have been disabled! <a href="%s//LOCAL_FILE/lines=%d">%s</a> <a href="%s//MAIL_FILE/lines=%d">%s</a> <a href="%s//TO_SCREEN/lines=%d">%s</a> Print out on a printer attached to your vt100 terminal <a href="%s//LPANSI/lines=%d">%s</a> <a href="%s//PRINTER/number=%d/pagelen=%d/lines=%d">File does not exist - reenter or cancel:File is not readable - reenter or cancel:# %s %s=%s
# LYrcFile %s:%s LYrcFile: ignored %s=%s multi_bookmark%c.lynxrcread_rc opened %s LYrcFile: missing '=' %s Lynx User Defaults File
# %s # %s=%d
multi_bookmark%c=,%ssub_bookmarksFIRST_REVERSEDTREELAST_REVERSEDLASTINTERMEDIATENOVICEKBBYTESKB,ETABYTES,ETAKB2,ETABYTES2,ETAMETERneveralwaysINTERNALCONFIGFILESYSTEMLINKS_AND_FIELDS_ARE_NUMBEREDLINKS_ARE_NUMBEREDLINKS_ARE_NOT_NUMBEREDNUMBERS_AS_ARROWSBY_FILENAMEORDER_BY_NAMEORDER_BY_TYPEORDER_BY_SIZEORDER_BY_DATEORDER_BY_MODEORDER_BY_USERORDER_BY_GROUPFILES_FIRSTDIRECTORIES_FIRSTMIXED_STYLEHz��y���y��py���y���x���x���w��hx�����D���������l��,����|~����read_rc used passed-in stream This file contains options saved from the Lynx Options Screen (normally with the 'o' key). To save options with that screen, you must select the checkbox: You must then save the settings using the link on the line above the checkbox: You may also use the command-line option "-forms_options", which displays the simpler Options Menu instead. Save options with that using the '>' key.
There is normally no need to edit this file manually, since the defaults here can be controlled from the Options Screen, and the next time options are saved from the Options Screen this file will be completely rewritten. You have been warned...
If you are looking for the general configuration file - it is normally called "lynx.cfg". It has different content and a different format. It is not this file. If keypad_mode is set to "NUMBERS_AS_ARROWS", then the numbers on your keypad when the numlock is on will act as arrow keys: 8 = Up Arrow 4 = Left Arrow 6 = Right Arrow 2 = Down Arrow and the corresponding keyboard numbers will act as arrow keys, regardless of whether numlock is on. If keypad_mode is set to "LINKS_ARE_NUMBERED", then numbers will appear next to each link and numbers are used to select links. If keypad_mode is set to "LINKS_AND_FORM_FIELDS_ARE_NUMBERED", then numbers will appear next to each link and visible form input field. Numbers are used to select links, or to move the "current link" to a form input field or button. In addition, options in popup menus are indexed so that the user may type an option number to select an option in a popup menu, even if the option isn't visible on the screen. Reference lists and output from the list command also enumerate form inputs. NOTE: Some fixed format documents may look disfigured when "LINKS_ARE_NUMBERED" or "LINKS_AND_FORM_FIELDS_ARE_NUMBERED" are enabled. accept_all_cookies allows the user to tell Lynx to automatically accept all cookies if desired. The default is "FALSE" which will prompt for each cookie. Set accept_all_cookies to "TRUE" to accept all cookies. Normally disabled. See ENABLE_LYNXRC in lynx.cfg anonftp_password allows the user to tell Lynx to use the personal email address as the password for anonymous ftp. If no value is given, Lynx will use the personal email address. Set anonftp_password to a different value if you choose. bookmark_file specifies the name and location of the default bookmark file into which the user can paste links for easy access at a later date. If case_sensitive_searching is "on" then when the user invokes a search using the 's' or '/' keys, the search performed will be case sensitive instead of case INsensitive. The default is usually "off". The character_set definition controls the representation of 8 bit characters for your terminal. If 8 bit characters do not show up correctly on your screen you may try changing to a different 8 bit set or using the 7 bit character approximations. Current valid characters sets are: cookie_accept_domains and cookie_reject_domains are comma-delimited lists of domains from which Lynx should automatically accept or reject all cookies. If a domain is specified in both options, rejection will take precedence. The accept_all_cookies parameter will override any settings made here. cookie_file specifies the file from which to read persistent cookies. The default is ~/.lynx_cookies. cookie_loose_invalid_domains, cookie_strict_invalid_domains, and cookie_query_invalid_domains are comma-delimited lists of which domains should be subjected to varying degrees of validity checking. If a domain is set to strict checking, strict conformance to RFC2109 will be applied. A domain with loose checking will be allowed to set cookies with an invalid path or domain attribute. All domains will default to querying the user for an invalid path or domain. dir_list_order specifies the directory list order under DIRED_SUPPORT (if implemented). The default is "ORDER_BY_NAME" dir_list_styles specifies the directory list style under DIRED_SUPPORT (if implemented). The default is "MIXED_STYLE", which sorts both files and directories together. "FILES_FIRST" lists files first and "DIRECTORIES_FIRST" lists directories first. If emacs_keys is to "on" then the normal EMACS movement keys: ^N = down ^P = up ^B = left ^F = right will be enabled. file_editor specifies the editor to be invoked when editing local files or sending mail. If no editor is specified, then file editing is disabled unless it is activated from the command line, and the built-in line editor will be used for sending mail. The file_sorting_method specifies which value to sort on when viewing file lists such as FTP directories. The options are: BY_FILENAME -- sorts on the name of the file BY_TYPE -- sorts on the type of the file BY_SIZE -- sorts on the size of the file BY_DATE -- sorts on the date of the file lineedit_mode specifies the key binding used for inputting strings in prompts and forms. If lineedit_mode is set to "Default Binding" then the following control characters are used for moving and deleting:
Prev Next Enter = Accept input Move char: <- -> ^G = Cancel input Move word: ^P ^N ^U = Erase line Delete char: ^H ^R ^A = Beginning of line Delete word: ^B ^F ^E = End of line
Current lineedit modes are: The following allow you to define sub-bookmark files and descriptions. The format is multi_bookmark<capital_letter>=<filename>,<description> Up to 26 bookmark files (for the English capital letters) are allowed. We start with "multi_bookmarkB" since 'A' is the default (see above). personal_mail_address specifies your personal mail address. The address will be sent during HTTP file transfers for authorization and logging purposes, and for mailed comments. If you do not want this information given out, set the NO_FROM_HEADER to TRUE in lynx.cfg, or use the -nofrom command line switch. You also could leave this field blank, but then you won't have it included in your mailed comments. personal_mail_name specifies your personal name, for mail. The name is sent for mailed comments. Lynx will prompt for this, showing the configured value as a default when sending mail. This is not necessarily the same as a name provided as part of the personal_mail_address. Lynx does not save your changes to that default value as a side-effect of sending email. To update the default value, you must use the options menu, or modify this file directly. preferred_charset specifies the character set in MIME notation (e.g., ISO-8859-2, ISO-8859-5) which Lynx will indicate you prefer in requests to http servers using an Accept-Charset header. The value should NOT include ISO-8859-1 or US-ASCII, since those values are always assumed by default. May be a comma-separated list. If a file in that character set is available, the server will send it. If no Accept-Charset header is present, the default is that any character set is acceptable. If an Accept-Charset header is present, and if the server cannot send a response which is acceptable according to the Accept-Charset header, then the server SHOULD send an error response, though the sending of an unacceptable response is also allowed. preferred_language specifies the language in MIME notation (e.g., en, fr, may be a comma-separated list in decreasing preference) which Lynx will indicate you prefer in requests to http servers. If a file in that language is available, the server will send it. Otherwise, the server will send the file in its default language. select_popups specifies whether the OPTIONs in a SELECT block which lacks a MULTIPLE attribute are presented as a vertical list of radio buttons or via a popup menu. Note that if the MULTIPLE attribute is present in the SELECT start tag, Lynx always will create a vertical list of checkboxes for the OPTIONs. A value of "on" will set popup menus as the default while a value of "off" will set use of radio boxes. The default can be overridden via the -popup command line toggle. show_color specifies how to set the color mode at startup. A value of "never" will force color mode off (treat the terminal as monochrome) at startup even if the terminal appears to be color capable. A value of "always" will force color mode on even if the terminal appears to be monochrome, if this is supported by the library used to build lynx. A value of "default" will yield the behavior of assuming a monochrome terminal unless color capability is inferred at startup based on the terminal type, or the -color command line switch is used, or the COLORTERM environment variable is set. The default behavior always is used in anonymous accounts or if the "option_save" restriction is set. The effect of the saved value can be overridden via the -color and -nocolor command line switches. The mode set at startup can be changed via the "show color" option in the 'o'ptions menu. If the option settings are saved, the "on" and "off" "show color" settings will be treated as "default". show_cursor specifies whether to 'hide' the cursor to the right (and bottom, if possible) of the screen, or to place it to the left of the current link in documents, or current option in select popup windows. Positioning the cursor to the left of the current link or option is helpful for speech or braille interfaces, and when the terminal is one which does not distinguish the current link based on highlighting or color. A value of "on" will set positioning to the left as the default while a value of "off" will set 'hiding' of the cursor. The default can be overridden via the -show_cursor command line toggle. show_dotfiles specifies that the directory listing should include "hidden" (dot) files/directories. If set "on", this will be honored only if enabled via userdefs.h and/or lynx.cfg, and not restricted via a command line switch. If display of hidden files is disabled, creation of such files via Lynx also is disabled. If sub_bookmarks is not turned "off", and multiple bookmarks have been defined (see below), then all bookmark operations will first prompt the user to select an active sub-bookmark file. If the default Lynx bookmark_file is defined (see above), it will be used as the default selection. When this option is set to "advanced", and the user mode is advanced, the 'v'iew bookmark command will invoke a statusline prompt instead of the menu seen in novice and intermediate user modes. When this option is set to "standard", the menu will be presented regardless of user mode. user_mode specifies the users level of knowledge with Lynx. The default is "NOVICE" which displays two extra lines of help at the bottom of the screen to aid the user in learning the basic Lynx commands. Set user_mode to "INTERMEDIATE" to turn off the extra info. Use "ADVANCED" to see the URL of the currently selected link at the bottom of the screen. If verbose_images is "on", lynx will print the name of the image source file in place of [INLINE], [LINK] or [IMAGE] See also VERBOSE_IMAGES in lynx.cfg If vi_keys is set to "on", then the normal VI movement keys: j = down k = up h = left l = right will be enabled. These keys are only lower case. Capital 'H', 'J' and 'K will still activate help, jump shortcuts, and the keymap display, respectively. The visited_links setting controls how Lynx organizes the information in the Visited Links Page. LINKS_AND_FORM_FIELDS_ARE_NUMBERED/File=Method=LYDownload: filename is %s Saving...Unable to download file.Cancelling!Download OptionsDownloaded link:Suggested file name:Standard download options:Download options:Save to diskView temporary file <a href="%s">%s</a> Save to disk disabled.ERROR! - download command is misconfigured.Lynx_users_guide.html#RemoteSource <a href="%s//Method=-1/File=%s/SugFile=%s%s">%s</a> <a href="%s//Method=%d/File=%s/SugFile=%s">;ref=You will be posting to:From: %.*sNews Post Cancelled!!!Organization: NEWS_ORGANIZATION/etc/organizationReferences: %s Message has no original text!Post this message?Posting to newsgroup(s)...
Please provide your mail address for the From: header
Please provide or edit the Subject: header
Please provide or edit the Organization: header Newsgroups: %s Summary: Keywords:
Spawning your selected editor to edit news messageFailed to open file %s for reading!
Please enter your message below.^%ckey-0x%x"><&%-*s %-13s %s </pre> </body> </html> <tab>0xkey-'%sLYinitKeymap LYNXKEYMAP<return><space><delete>Up ArrowDown ArrowRight ArrowLeft ArrowPage DownPage UpEndDo keyFind keySelect keyInsert keyRemove key(DO_NOTHING)Back Tabmouse pseudo keyUNMAPPEDCOMMANDprompt for, execute a commandSOURCERELOADreload the current documentQUITquit the browserABORTNEXT_PAGEPREV_PAGEUP_TWODOWN_TWOUP_HALFDOWN_HALFFIRST_LINKLAST_LINKmake the next link currentLPOS_PREV_LINKLPOS_NEXT_LINKFASTBACKW_LINKFASTFORW_LINKUP_LINKDOWN_LINKRIGHT_LINKmove right to another linkLEFT_LINKmove left to a previous linkHISTORYPREV_DOCNEXT_DOCACTIVATEMOUSE_SUBMITprompt and submit formreset fields on current formECGOTODWIMHELPNOCACHEINTERRUPTMAIN_MENUINDEX_SEARCHallow searching of an indexWHEREISPREVCOMMENTPRINTADD_BOOKMARKDEL_BOOKMARKVIEW_BOOKMARKVLINKSDOWNLOADTRACE_TOGGLETRACE_LOGIMAGE_TOGGLEINLINE_TOGGLEJUMPdisplay the current key mapTOOLBARHISTORICALMINIMALRAW_TOGGLECOOKIE_JARexamine the Cookie JarF_LINK_NUMCLEAR_AUTHSWITCH_DTDELGOTOCHANGE_LINKDWIMEDITEDITTEXTAREAGROWTEXTAREAINSERTFILEADDRLISTEXTERN_LINKEXTERN_PAGEDIRED_MENUCREATEREMOVEremove a file or directoryMODIFYTAG_LINKCHANGE_CENTERchange current directoryprint current directorySHIFT_LEFTshift the screen leftSHIFT_RIGHTshift the screen rightLINEWRAP_TOGGLEtoggle linewrap on/offPASTE_URLGoto the URL in the clipboardTO_CLIPBOARDlink's URL to Clip BoardCACHE_JARROT13'd keyboard layout0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyztoggle source/presentation for current documentquit the browser unconditionallyview the next page of the documentview the previous page of the documentgo back two lines in the documentgo forward two lines in the documentgo back half a page in the documentgo forward half a page in the documentrefresh the screen to clear garbled textgo to the beginning of the current documentgo to the end of the current documentmake the first link on the line currentmake the last link on the line currentmake the previous link currentmake previous link current, same column for inputmake next link current, same column for inputprevious link or text area, only stops on linksnext link or text area, only stops on linksmove up the page to a previous linkmove down the page to another linkdisplay stack of currently-suspended documentsgo back to the previous documentundo going back to the previous documentgo to the document given by the current linkDO NOT MAP: follow current link, submitgo to a document given as a URLedit the current document's URL and go to itdisplay help on using the browserdisplay help page that may depend on contextdisplay an index of potentially useful documentsforce submission of form or link with no-cacheinterrupt network connection or transmissionreturn to the first screen (home page)display and change option settingssearch within the current documentsearch for the previous occurrencesearch for the next occurrencesend a comment to the author of the current documentedit the current document or a form's textareadisplay information on the current document and linkdisplay choices for printing the current documentadd to your personal bookmark listdelete from your personal bookmark listview your personal bookmark listlist links visited during the current Lynx sessionescape from the browser to the systemdownload the current link to your computertoggle tracing of browser operationsview trace log if started in the current sessiontoggle handling of all images as linkstoggle pseudo-ALTs for inlines with no ALT stringsend a HEAD request for the current document or linkshow other commands in the novice help menugo directly to a target document or actiondisplay the current edit-key maplist the references (links) in the current documentgo to Toolbar or Banner in the current documenttoggle historical vs. valid/minimal comment parsingtoggle minimal vs. valid comment parsingtoggle valid vs. soft double-quote parsingtoggle raw 8-bit translations or CJK mode ON or OFFinvoke the 'Follow link (or page) number:' promptclear all authorization info for this sessionswitch between two ways of parsing HTMLedit the current link's URL or ACTION and go to itforce reset of the current link on the pageuse external editor for context-dependent purposeuse an external editor to edit a form's textareaadd 5 new blank lines to the bottom of a textareainsert file into a textarea (just above cursorline)like LIST command, but always shows the links' URLsrun external program with current linkrun external program with current pagedisplay a full menu of file operationscreate a new file or directorymodify the name or location of a file or directorytag a file or directory for later actionupload from your computer to the current directoryinstall file or tagged files into a system areaexamine list of cached documentsJCUKEN Cyrillic, for AT 101-key kbdYAWERTY Cyrillic, for DEC LK201 kbd&/cDgG_NbSaUcVdd`g_nbsaucvdG������G $ 'R 'fmB&Un!"@#P$M%(N)*+D,-^./]051S23456789 : ;<C= >:?!@-AQB\CDgEAFVG_H,I-J/KILKMLN2O6P3Q;RS=T4UcV%W?Y0[1\E]^F_`TaOb<cd8eAf9g_h+i-j/kIlKmLn2o7p3q;r s=t4ucv%w>y0{1|i}k~j�$'% . ' GG�W������start CacheThru_new CacheThru_newHTML.caddClassName[LINK](OBJECT)[INLINE](IMAGE)[IMAGE]me->tag_charset: %d -> %dCSS.elt:<%s> .type.file://*HTML_BASE: final href=`%s' madeownerauthorHTML: DOC OWNER '%s' found ToCContentsGlossaryCopyrightBannerTopOriginNavigatorDisclaimerAuthorPublisherTrademarkBeginFirstLastDocumentationBiblioentryBibliographyStartAppendixNextPreviousPrevChildSiblingParentMetaURCPointerTranslationDefinitionAlternateSectionSubsectionChapterRelTitle: citehostHTML: citehost '%s' found link.%s.%sSTYLE.link: using style <%s> IFRAME:Underline Level is %d Beginning underline [DEL:[INS:CAUTIONWARNINGPLAIN%2d.FOOTNOTE:/foo/..USEMAPISMAPimage/[OVERLAY][APPLET][BGSOUND][EMBED]CREDIT:CAPTION:found button for a script HTML: Ignoring TYPE="range" [BUTTON Input] (not implemented)3.Ok, we're trying type=[%s] normal field type: %s 4.Ok, we're trying type=[%s] (_)[_]I.%s, %d (%d)Limited I.size to %d, was %d *invalid tag*special tagSpecial OBJECT handlingleaving on stackSpecial OBJECT->FIG handlingtreating as end FIG<H2><EM>Description:</EM> (none)<BR><EM> Filepath:(unknown)</H2>HTML: STYLE content = %s HTML: SCRIPT content = %s :DEL]:INS]<!--<OBJECT<PARAM</OBJECT<MAP</MAP%s: %s </OBJECT>HTML:OBJECT content: %s <FIG ISOBJECT IMAGEMAP ID=" SRC="</FIG><IMG ISOBJECT TITLE="" ALT=" USEMAP="" ISMAP><OBJECT>< -<A HREF="</A> [MATH::MATH][FIGURE]HTML_free: Ending underline HTML_free: Ending HTML_A HTML_new/* */ PassThruCacheLynx_HTML_HandlerLynxPseudoToolbarSourceCacheWriter: Removing previous file %s SourceCacheWriter: Removing previous memory chunk %p SourceCacheWriter: Committing file %s for URL %s to anchor Source cache error - disk full?SourceCacheWriter: memory chunk %p had errors. Source cache error - not enough memory!SourceCacheWriter: Committing memory chunk %p for URL %s to anchor SourceCacheWriter: Removing active file %s SourceCacheWriter: Removing active memory chunk %p SourceCacheWriter: Protocol is "%s"; not cached SourceCacheWriter: If successful, will replace source cache file %s SourceCacheWriter: Cannot open source cache file for URL %s SourceCacheWriter: Caching source for URL %s in file %s SourceCacheWriter: If successful, will replace memory chunk %p SourceCacheWriter: Caching source for URL %s in memory chunk %p BUG: appending chunk to itself: `%.*s' ** Bad HTML!! Use -trace to diagnose. ** (me->UCLYhndl: %d, tag_charset: %d) STYLE.start_element: <%s> (class <%s> not configured), hcode=%d. STYLE.start_element: <%s>.<%s>, hcode=%d. STYLE.start_element: <%s>, hcode=%d. STYLE.start_element: type <%s> not configured. STYLE.start_element: <%s>.type.<%s>, hcode=%d. *HTML_BASE: initial href=`%s' HTML: BASE '%s' is not an absolute URL. HREF in BASE tag is not an absolute URL.HTML: LINK with REL="%s" ignored. HTML: LINK with REL="%s" and no HREF ignored. HTML: ****** Maximum nesting of %d divisions exceeded! HTML: TAB tag has no attributes. Ignored. HTML: ALIGN not 'left'. Using space instead of TAB. HTML: Not HT_LEFT. Using space instead of TAB. HTML: Column out of bounds. Using space instead of TAB. HTML: Found invalid HREF="%s" TYPE="%s"! HTML: '%s' is an ISMAP script HTML: Designating '%s' as an ISMAP script HTML IMG: USEMAP=%d ISMAP=%d ANCHOR=%d PARA=%d HTML: Missing FORM end tag. Faking it! Bad HTML: Missing TEXTAREA end tag. HTML: Missing SELECT end tag, faking it... 2.Ok, we're trying type=[%s] (present=%p) I.%s have %d chars, or something Limited me->textarea_cols to %d, was %d Bad HTML: SELECT start tag in SELECT element. Faking SELECT end tag. ***** Bad HTML: OPTION tag not within SELECT tag HTML: ****** Maximum nesting of %d divisions/tables exceeded! HTML:begin_element: internal call (level %d), leaving on stack - `%s' Maximum nesting of HTML elements exceeded.HTML: ****** Maximum nesting of %d tags exceeded! HTML:begin_element[%d]: adding style to stack - %s (%s) STYLE.begin_element:ending "EMPTY" element style Limited me->textarea_rows to %d, was %d HTML: end of element %s when expecting end of %s HTML:end_element: Internal call (level %d), leaving on stack - %s HTML:end_element[%d]: %s (level %d), %s - %s HTML:end_element[%d]: Popped style off stack - %s Stack underflow error! Tried to pop off more styles than exist in stack Bad HTML: Missing TEXTAREA end tag Bad HTML: %s%s%s%s%s not closed before HTML end tag ***** Bad HTML: %s%s%s%s%s not closed before BODY end tag ***** HTML_end_element: Reducing List Nesting Level to %d Bad HTML: Unmatched OBJECT start and end tags. Discarding content: %s HTML: Nested OBJECT tags. Recycling incomplete contentsHTML: Nested OBJECT tags. Recycling. HTML: DECLAREd OBJECT. Ignoring! HTML: NAMEd OBJECT. Ignoring! HTML: Recycling nested OBJECT%s. Bad HTML: Unmatched OBJECT start and end tags. Discarding content. HTML: OBJECT has SHAPES. Converting to FIG. HTML: OBJECT has USEMAP. Converting to IMG. HTML: MAP found, recycling object contents. HTML: MAP and nested OBJECT tags. Recycling partsBad HTML: Unmatched FORM end tag Bad HTML: Open SELECT at FORM end. Faking SELECT end tag. ***** Bad HTML: Unmatched TEXTAREA end tag Bad HTML: Unmatched SELECT end tag ***** Bad HTML: SELECT end tag not within FORM element ***** *** LYNX ERROR *** Unparsed data: STYLE.end_element: ending non-"EMPTY" style <%s...> HTML_abort: SELECT or OPTION not ended properly ***** HTML_abort: ***** leftover option data: %s HTML_abort: TEXTAREA not used properly ***** HTML_abort: ***** leftover textarea data: %s Bad HTML: SELECT or OPTION not ended properly ***** HTML_free: ***** leftover option data: %s Bad HTML: TEXTAREA not used properly ***** HTML_free: ***** leftover textarea data: %s Document has only hidden links. Use the 'l'ist command.start HTML_new(parent %s, format %s)
** Internal error: can't parse HTML to %s HTMLToPlain calling CacheThru_new HTMLParsedPresent calling CacheThru_new HTMLToC calling CacheThru_new HTMLPresent calling CacheThru_new �_��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`��$`���_��$`��$`��$`��$`��$`��$`���_��$`���_��$`��$`��$`��$`��$`��$`��$`��$`��`��$`���_��$`��$`��$`��$`��$`��$`��`��$`��$`��$`��$`��$`��$`���_��$`��$`��$`��$`���_���a���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���a���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���a���a���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b���b��pb���b���b���b���b���b���b���a��0`��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa��pa�� `��pa��pa��pa��@a��pa��pa��pa��pa��pa��pa��`a��pa��Pa��pa��pa��pa�� `�� `��pa��pa��pa��0a��pa��Pa��pa��pa��pa��pa��pa��pa�� a��pa��pa��pa��pa��pa��pa��a��pa��pa��pa��pa���`��pa��pa��pa��pa��pa��pa�� `������@x��@x�������x������������@x��@x��8����w��P����r��@������@x��8���p���Ȉ��0���p���`���xz��X������8���@x���������r�����Ё��~��@x��p~������~�����p���8�������8����������P���������@��� ����r��@���@���@���@���@���@����r�����p����r������8������б���e��X���@���@x�����ȩ��h�������p���0���gx�����0����w������p~��������r��(���X������0���أ����������r��gx��`x������~��@x��������Я������@x�����P���~��8�������0���p���������@���@q�������@���@q��@�����������@x��8��� ���@x������gx��)���������������;���,��|*��|*��+��|+��4'��4'��4'��|*��|*��.��+��4'��4'��|*��4'��|*��.��+���)��4'��+��4'��|*���1���1��.��|*��4'���2��4'��,1��|*���4��|*��D5���1��D5��4'��|*��.��4'���(��D4��4'��t4���4��4'���2��4'��4'��t3��t3��t3��t3��t3��t3��8��4'��4'���5��4'��.���(��4'��4'��l6��4'��|*��4'��|*���(��|*��|*��4'���*��4'��<-��+��T,��D5��4'��4'��4'���(��t4��S8���+��4'��|*���-��4'���*���*��d-���4��|*���-��4'���6��4'��|*��|*��4'���4��.��3��,4��|*��4'���0��|*��|5���1��4'��|*��|5��|*��t.��,6��|*��.��D5��|*��4'���*��HTFWriter_abort called Error deleting file%.60s '%.400s': %.60s.tmp.gzdecompressing '%s' ...opened '%s' ...decompress %ld to %ld application/x-gzipwww/compressedHTFWriter_write%.60s: %.60s: %.60sHTFWriter_newHTFWriter.c.binHTSaveToFile%s D)ownload, or C)ancelCancelling file.text/application/Content-type: %sapplication/postscriptapplication/x-RUNOFF-MANUAL<BASE HREF="%s">
HTSaveAndExecute( %s( %s ) < %s -d --no-name %sapplication/x-HTCompressedHTDumpToStdoutFileWriterHTFWriter: Aborting: file not executed or saved. Error uncompressing temporary file!This file cannot be displayed on this terminal.This file cannot be displayed on this terminal: D)ownload, or C)ancelCan't open output file! Cancelling!Retrieving file. - PLEASE WAIT -Lynx: %s ISO-8859-1BuildCommand no value for %s setting suffix '%s' to '%s'. HTPreparsedFormatInit PassesTest: Test failed! PassesTest: Test passed! needsterminalcopiousoutputtestlabeltextualnewlinesmxbnotestest "$DISPLAY"test "$DISPLAY" != ""test -n "$DISPLAY"test -z "$DISPLAY"test -n "$LYNX_VERSION"test -z "$LYNX_VERSION"RememberTestResultHTInit.cHTFormatInit ghostview %s&image/gifimage/x-xbmimage/x-xbitmapimage/x-pngimage/pngimage/x-rgbimage/x-tiffimage/tiffimage/jpegmpeg_play %s &video/mpegmessage/x-http-redirectionwww/debugwww/mimetext/x-capplication/htmlapplication/xmlapplication/x-wais-sourcetext/csstext/sgmltext/x-sgmlapplication/xhtml+xmltext/xml*.*application/x-Binary.saveme.dumpapplication/x-Compressed.arcapplication/x-Executable.alpha-exe.alpha_exe.AXP-exe.AXP_exe.VAX-exe.VAX_exe.exeUNIX Compressedapplication/x-compress.exe.ZUNIX Compr. Tarapplication/x-tar.tar_Z.tar.ZGNU Compressed-gz_gzGNU Compr. Tar.tar.gzWAIS-source.wsrcZip Fileapplication/zip.zipapplication/x-deflate.zzapplication/deflateapplication/x-bzip2.bz2application/bzip2UUencodedapplication/x-uuencoded.uuMac BinHexapplication/mac-binhex40.hqxProg. Object.oProg. Library.aShared Lib.soODAapplication/oda.odaPDFapplication/pdf.pdfPostscript.eps.ai.psRTFapplication/rtf.rtfDVIapplication/x-dvi.dviHDFapplication/x-hdf.hdfapplication/x-netcdf.cdf.ncLaTeXapplication/x-latex.latextext/x-tex.texTexinfoapplication/x-texinfo.texinfo.texiTroffapplication/x-troff.t.tr.roffMan Pageapplication/x-troff-man.manTroff meapplication/x-troff-meTroff msapplication/x-troff-ms.msapplication/x-Zoo File.zooBackup.bakVMS BAK File.bkp.bckVMS Help Libr..hlbVMS Obj. Libr..olbVMS Text Libr..tlb.objDEC BookReader.decw$booktext/x-runoff-manual.memapplication/visio.vsdlha Fileapplication/x-lha.lhalzh Fileapplication/x-lzh.lzhsea Fileapplication/x-sea.seaStuffItapplication/x-stuffit.sitdms Fileapplication/x-dms.dmsiff Fileapplication/x-iff.iffapplication/x-bcpio.bcpioapplication/x-cpio.cpioapplication/x-shar.sharapplication/x-share.shareapplication/x-sv4cpio.sv4cpioapplication/x-sv4crc.sv4crcTar File.tarapplication/x-ustar.ustaraudio/basic.snd.auaudio/x-aiff.aifc.aif.aiffaudio/x-wav.wavaudio/midi.midiaudio/mod.mod.gifimage/ief.ief.jfif.jfif-tbnl.jpe.jpeg.tif.tiffimage/ham.hamimage/x-cmu-rast.rasimage/x-portable-anymap.pnmimage/x-portable-bitmap.pbmimage/x-portable-graymap.pgmimage/x-portable-pixmap.ppm.png.rgb.xbmimage/x-xpixmap.xpmimage/x-xwindowdump.xwdtext/richtext.rtxtext/tab-separated-values.tsvtext/x-setext.etx.mpg.mpe.mpegvideo/quicktime.mov.qtvideo/x-msvideo.avivideo/x-sgi-movie.movie.mvmessage/rfc822.mime.cc.c++.css.pl.text.php.php3.html3.ht3.phtml.shtml.sht.htmlx.htmBuildCommand: Bad mailcap "test" clause: %s BuildCommand: Ignoring unrecognized format code in mailcap file '%%%c'. HTLoadExtensionsConfigFile: Loading file '%s'. HTLoadExtensionsConfigFile: Could not open '%s'. PassesTest: Deferring test command: %s PassesTest: Executing test command: %s ProcessMailcapFile: Loading file '%s'. ProcessMailcapFile: Could not open '%s'. ProcessMailcapEntry: Ignoring invalid mailcap entry: %s ProcessMailcapEntry: Ignoring mailcap entry: %s ProcessMailcapEntry: Found testcommand:%s ProcessMailcapEntry: Ignoring mailcap flag '%s'. PassesTest: Testing for XWINDOWS environment. PassesTest: Testing for NON_XWINDOWS environment. PassesTest: Testing for LYNX environment. PassesTest: Testing for non-LYNX environment. ProcessMailcapEntry Setting up conversion %s : %s HTFileInit: Loading default (HTInit) extension maps. HTFileInit: Skipping all default (HTInit) extension maps! "()<>@,;:\/[]?.=����MbP?@default.styleHeadingRightHRIGHTHeadingLeftHLEFTHeadingCenterHCENTERHeading6H6Heading5H5Heading4H4Heading3H3Heading2H2Heading1H1NoteNOTEAddressADDRESSListingLISTINGPreformattedPREExampleXMPGlossaryCompact6DLCGlossaryCompact5GlossaryCompact4GlossaryCompact3GlossaryCompact2GlossaryCompact1GlossaryCompactGlossary6Glossary5Glossary4Glossary3Glossary2Glossary1Menu6Menu5Menu4Menu3Menu2Menu1List6List5List4List3List2List1FootnoteBqBQBlockquoteBLOCKQUOTEBANNERDivRightDRIGHTDivLeftDLEFTDivCenterDCENTERNormal (08@HPX`hpx�������TO=UPLOAD=LYUpload: filename is %scd %s ; Unable to upload file.Lynx_users_guide.html#DirEdUpload To: <em>%s</em> %s Upload options: <NONE> ERROR! - upload command is misconfiguredIllegal redirection "../" found! Request ignored.Illegal character "/" found! Request ignored.Illegal redirection using "~" found! Request ignored. <a href="LYNXDIRED://UPLOAD=%d/TO=%s">(LY)atexit: Too many functions, ignoring one! Memory exhausted! Aborting...
%s %s: %s LYJumpInitLYJump.cRead Jumpfile %s Cannot locate jump file!Cannot open jump file!Error reading jump file!<dl><dd>Edit the current shortcut: Edit the previous shortcut: Edit a previous shortcut: Unknown target '%s'Out of memory reading jump file!Out of memory reading jump table!Read jumpfile[%u] key='%s', url='%s' Key '%c' is not mapped to a jump file! - TYPE="internal link"ol continuekeystrokes/follow_help.htmlthis document:References in %s%s<p> <%s compact> Visible links:<lh><em>%s</em>
</%s>
<p> Hidden links:<li><a href="%s">%s</a>
</%s> References %s
%4d. form field = %s %4d. %s %s There are only hidden links from this document.There are no references from this document.<li><a id=%d href="#%d">form field</a> = <em>%s</em> <li><a href="%s"%s>%s%s%s%s%s</a> LYCgiLYCgi.cDo you want to execute "%s"?Bad request!lynxcgi://localhostLYNXCGI: %s: %s stat() of pgm_buff failedUnable to access cgi scriptstat() failedUnable to set up connection.pipe() failedREMOTE_HOST=localhostREMOTE_ADDR=127.0.0.1SERVER_SOFTWARE=%s/%sLYNXCGI: Writing: write() of POST data failedread() of CGI output failedLYNXCGI: Rx: %.*s HTTP_ACCEPT_LANGUAGE=%sHTTP_ACCEPT_CHARSET=REQUEST_METHOD=POSTCONTENT_TYPE=CONTENT_LENGTH=%dREQUEST_METHOD=HEADREQUEST_METHOD=SEARCHREQUEST_METHOD=GETQUERY_STRING=DOCUMENT_ROOT=PATH_INFO=PATH_TRANSLATED=execve failedContent-Type: text/plain
exec of %s failed: %s. Unable to make connectionfork() failedstrrchr(pgm_buff, '/') returned NULLLYNXCGI: stat() of %s succeeded, path_info="%s". %s is not a file and %s not an executable, giving up. %s is not an executable file, passing the buck. cgi support has been disabled.Execution via bookmarks is disabled.HTTP_USER_AGENT=%s/%s libwww/%sLYNXCGI: Doing post, content-type '%s' ---------------------------------- LYNXCGI: Wrote %d bytes of POST data. LYNXCGI: %d bytes remain unwritten! traverse.dattraverse2.dat%s %s TRAVERSAL WAS INTERRUPTED
%s
%s
add_to_reject_list(%s) reject.datUnable to open reject file.lookup_reject(%s) -> %d Unable to open traversal file.Unable to open traversal found file.here is a list of the history stack so that you may rebuild <a href="%s">%s</a>
%-*s %-*s - %s
%-*sLYNXEDITMAPkeystrokes/edit_help.htmlkeystrokes/alt_edit_help.htmlDefault BindingAlternate BindingsBash-like BindingsModifier BindingNOPDo NothingInsert printable charInput complete, return charInput complete, return TABSTOPInput deactivatedInput cancelledPASSFields only: input completeDELBLDelete back to BOLDELELDelete thru EOLDELNDelete next/curr charDELPDelete prev charDELNWDelete next wordDELPWDelete prev wordERASEErase the lineGo to begin of lineGo to end of lineFORWCursor forwardsFORW_RLCursor forwards or right linkBACKCursor backwardsBACK_LLCursor backwards or left linkFORWWWord forwardBACKWWord backLOWERLower case the lineUPPERUpper case the lineLKCMDInvoke command promptSWMAPSwitch input keymapC1CHARInsert C1 char if printableSETM1Set modifier 1 flagSETM2Set modifier 2 flagUNMODTPOSTranspose charactersSETMARKemacs-like set-mark-commandXPMARKKILLREGemacs-like kill-regionYANKemacs-like yankPASTEClipBoard to LynxAIXHex 97These are the current edit-bindings:keystrokes/bashlike_edit_help.htmlFall back to no-modifier commandemacs-like exchange-point-and-mark! � � $ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ��������������������������������������������������������������������������������������������������������������������������������
#" !"#$%&'()*+,-./0123456789:;<=>?@ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ `a bcd eYfgZhi[jklmnopuz{|}~������������������������������������������������������������������������������������������������. 57������ISO Latin 1UCGetLYhndl_byAnyName(%s) gcedilcpwindowsAEligAacgrAacuteAbreveAcircAgrAgraveAlphaAmacrAogonAringAtildeAumlBarwedBcyBetaBgrCacuteCapCcaronCcedilCcircCdotChiCupDJcyDScyDZcyDaggerDcaronDgrDotDotDstrokEEacgrEEgrENGETHEacuteEcaronEcircEdotEgraveEmacrEogonEpsilonEtaEumlFcyGJcyGbreveGcedilGcircGcyGdotGgGgrGtHARDcyHcircHstrokIEcyIJligIOcyIacgrIacuteIcircIdigrIdotIgrIgraveImacrIogonIotaItildeIukcyIumlJcircJsercyJukcyKHcyKHgrKJcyKappaKcedilKcyKgrLJcyLacuteLarrLcaronLcedilLcyLgrLlLmidotLstrokLtMcyMgrNJcyNacuteNcaronNcedilNcyNgrNtildeOEligOHacgrOHgrOacgrOacuteOcircOdblacOgrOgraveOmacrOmicronOslashOtildeOumlPHgrPSgrPcyPgrPrimeRacuteRarrRcaronRcedilRcyRgrRhoSHCHcySOFTcySacuteScaronScedilScircSubSupTHORNTHgrTSHcyTScyTauTcaronTcedilTgrTstrokUacgrUacuteUbrcyUbreveUcircUdblacUdigrUgrUgraveUmacrUogonUpsilonUringUtildeUumlVcyVerbarVvdashWcircXgrYAcyYIcyYUcyYacuteYcircYcyYumlZHcyZacuteZcaronZdotZetaZgraacgraacuteabreveacircaeligagravealefsymalephamacrampang90angmsdangsphangstaogonaringasympatildeaumlb.Deltab.Gammab.Lambdab.Omegab.Phib.Pib.Psib.Sigmab.Thetab.Upsib.Xib.alphab.betab.chib.deltab.epsib.epsisb.epsivb.etab.gammab.gammadb.iotab.kappab.kappavb.lambdab.mub.nub.omegab.phisb.phivb.pib.pivb.psib.rhob.rhovb.sigmab.sigmavb.taub.thetasb.thetavb.upsib.xib.zetabarwedbcongbcybdquobecausbepsibernoubethbgrblankblk12blk14blk34blockbottombowtieboxDLboxDRboxDlboxDrboxHboxHDboxHUboxHdboxHuboxULboxURboxUlboxUrboxVboxVHboxVLboxVRboxVhboxVlboxVrboxdLboxdRboxdlboxdrboxhboxhDboxhUboxhdboxhuboxuLboxuRboxulboxurboxvboxvHboxvLboxvRboxvhboxvlboxvrbprimebrkbarbrvbarbsimbsimebumpbumpecacutecaretccaronccedilccirccdotcheckcireclubscolonecommacommatcompcompfnconintcoprodcopycopysrcrarrcrosscueprcuesccularrcuprecurarrcurrencuveecuweddArrdaggerdalethdarrdarr2dashvdcarondegdgrdharldharrdiamdiamsdiedividedivonxdjcydlarrdlcorndlcropdrarrdrcorndrcropdscydstrokdtrifdzcyeDoteacuteecaronecirecircecolonedoteeacgreegrefDotegraveegsemacremdashemptyemspemsp13emsp14endashengenspeogonepsilonerDotesdoteumleurofcyfemaleffiligffligfflligflatfnofforallfrac12frac13frac14frac15frac16frac18frac23frac25frac34frac35frac38frac45frac56frac58frac78fraslgEgacutegbrevegcircgcygdotgelggrgimelgjcyglgnEgnegnsimgsdotgsimgvnEhairsphalfhamilthardcyharrwhcircheartshelliphibarhorbarhstrokhybullhypheniacgriacuteicircidiagridigriecyiexcligraveijligimacrincareinfininodotintcaliocyiogoniquestisinitildeiukcyiumljcircjsercyjukcykcedilkgrkgreenkhcykhgrkjcylAarrlElacutelagranlanglaquolarrhklarrlplarrtllcaronlcedillceillcublcyldotldquoldquorleglfloorlgrlhardlharulhblkljcylmidotlnElnelnsimlowastlowbarlozlozflparlrarr2lrhar2lrmlsaquolshlsimlsqblsquolsquorlstroklthreeltimesltriflvnEmaltmcymgrmicromiddotminusbmldrmnplusmodelsmumapnVDashnVdashnablanacutenapnaposnaturnbspncaronncedilncongncynearrnequivnexistngrngtnhArrnharrnjcynlArrnlarrnldrnlenlesnltnltrinltrienmidnotinnparnprnprenrArrnrarrnrtrinrtrienscnscensimensparnsubnsubEnsubensupnsupEnsupentildenumeronumspnvDashnvdashnwarroSoacgroacuteoastocirocircodashodblacoeligogrograveohacgrohgrohmolarrolineomacromicronominusoplusorarrordfordmoslashosolotildeotimesoumlparapcypercntperiodpermilperppgrphgrphiphmmatphoneplanckplusbplusdoplusmnpoundprnsimprsimpsgrpuncspquotrAarrracuteradicrangraquorarrhkrarrlprarrtlrarrwrcaronrcedilrceilrcubrdquordquorrealregrfloorrgrrhardrharurlarr2rlhar2rlmrparrsaquorshrsqbrsquorsquorrthreertimesrtrifrxsacutesamalgsbquosbsolscaronsccuescedilscircscnsimscsimsdotbsectsemisextsfgrsfrownsharpshchcyshysigmafsoftcyspadessqcapsqcupsqsubsqsubesqsupsqsupesqusquaresqufssetmnssmilesstarfsungsup1sup2sup3szligtcarontcediltdottelrectgrthere4thetathetasymthgrthinspthkapthksimthorntimesbtoptprimetradetscytshcytstroktwixtuArruacgruacuteuarruarr2ubrcyubreveucircudblacudiagrudigrugrugraveuharluharruhblkulcornulcropumacruogonuplusupsihupsilonurcornurcropuringutildeutrifuumlvArrvarrvcyveebarvellipverbarvltrivprimevpropvrtrivsubnEvsubnevsupnEvsupnewcircwedgeqweierpwreathxcircxdtrixgrxhArrxharrxlArrxrArrxutriyacuteyacyycircycyyenyicyyucyyumlzacutezcaronzdotzgrzhcyzwjzwnjISO Latin 2iso-8859-2WinLatin1 (cp1252)windows-1252DEC Multinationaldec-mcsMacintosh (8 bit)macintoshNeXT character setKOI8-R Cyrillickoi8-rChineseJapanese (EUC)Japanese (SJIS)KoreanTaipei (Big5)Vietnamese (VISCII)viscii7 bit approximationsTransparentx-transparentDosLatinUS (cp437)cp437IBM PC character setDosLatin1 (cp850)cp850IBM PC codepage 850DosLatin2 (cp852)cp852PC Latin2 CP 852DosCyrillic (cp866)cp866DosArabic (cp864)cp864DosGreek (cp737)cp737DosBaltRim (cp775)cp775DosGreek2 (cp869)cp869DosHebrew (cp862)cp862WinLatin2 (cp1250)windows-1250WinCyrillic (cp1251)windows-1251WinGreek (cp1253)windows-1253WinHebrew (cp1255)windows-1255WinArabic (cp1256)windows-1256WinBaltRim (cp1257)windows-1257ISO Latin 3iso-8859-3ISO Latin 4iso-8859-4ISO 8859-5 Cyrilliciso-8859-5ISO 8859-6 Arabiciso-8859-6ISO 8859-7 Greekiso-8859-7ISO 8859-8 Hebrewiso-8859-8ISO-8859-8-IISO-8859-8-EISO 8859-9 (Latin 5)iso-8859-9ISO 8859-10iso-8859-10UNICODE UTF 8RFC 1345 w/o Intromnemonic+ascii+0RFC 1345 MnemonicmnemonicWestern (ISO-8859-1)AeDjOeUe-c-(c)CURDEG 1/2 1/4 3/4`i-L-(R)^1^2^3(TM)YEN�����������������������������HTMLSetCharacterHandling: LYRawMode changed %s -> %s HTMLSetCharacterHandling: UCLYhndl_for_unspec changed %d -> %d 7 bit approximations (US-ASCII):&������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������� �� � & ! �0 `9 R��}���� " �"!a: S��~x<&>LYEntifyLYCharUtils.cfile:///file:/ %c.%c%c%c.CMXCXLIV.VI.VII.VIII.IX.cmcdxcxliv.vi.vii.viii.ix.%1BU%.2lXContent-Typeiso-8859-cp12cp-12windows-PragmaCache-Controlmax-ageExpiresRefreshRefresh URL is not absolute.REFRESH( sec):Content-DispositionSet-CookieISO-8859!--X-Message-Id: --!--X-Subject: LYformTitleLYUCFullyTranslateString: Ignoring '%lX'. LYParseRefreshURL content: %s seconds: %s address: %s LYLegitimizeHREF: Bad value '%s' for http%s URL. Stripping lead dots. Bad partial reference! Stripping lead dots.LYHandleMETA: HTTP-EQUIV="%s" NAME="%s" CONTENT="%s" CHARSET="%s" LYHandleMETA: New charset: %s LYHandleSELECT: Ignoring SIZE="%s" for SELECT. Bad HTML: Unmatched SELECT end tag
LYformTitle: kanji_code is an unexpected value.������}��`��C��&�� �����������������n��Q��4�������������������i�����<�<�4�����,���t�<�����4�������������������[USEMAP]<title>%s</title> </head> <body> <h1><em>%s</em></h1> <li><a href="</%s> </body> </html>
>LYAddImageMapLYMap.c%4d. %sLYNXIMGMAPMisdirected client-side image MAP request!Image map from POST response not available!Client-side image MAP is not accessible!No client-side image MAPs are available!Client-side image MAP is not available!<h2><em>MAP:</em> %s</h2> Out of memory in LYAddMapElementLYAddMapElement map %s address %s title %s) ...test_domain_entry(%s) ->(%s) bv:%u, invcheck_bv:%u find_domain_entry(%s) bv:%d, invcheck_bv:%d LYStoreCookies: save cookies to %s on exit D)elete domain, set allow A)lways/P)rompt/neV)er, or C)ancel? D)elete domain's cookies, set allow A)lways/P)rompt/neV)er, or C)ancel? All cookies in the domain have been eaten!'P'rompting to allow from domain '%s'.Delete all cookies in this domain?All of the cookies in the jar have been eaten!Activate links to gobble up cookies or entire domains,or to change a domain's 'allow' setting.<dt>%s<dd><a href="%s//%s/"><em>Domain:</em> %s</a> <dd><a href="%s//%s/%s"><em>%s</em>=%s</a> <dd><em>Path:</em> %s <dd><em>Port:</em> %d <em>Secure:</em> %s <em>Discard:</em> %s <dd><em>CommentURL:</em> <a href="%s">%s</a> LYProcessSetCookies: Rejecting commentURL value '%s' LYProcessSetCookies: Adding lead dot for domain value '%s' BUG: comparing empty value in domain_matches BUG: comparing empty domain in domain_matches store_cookie: Rejecting because '%s' is not a prefix of '%s'. store_cookie: Rejecting because '%s' has no dot. store_cookie: Rejecting domain '%s'. store_cookie: Rejecting domain '%s' for host '%s'. Accept invalid cookie domain=%s for '%s'?Accept invalid cookie path=%s as a prefix of '%s'?store_cookie: Domain's cookie limit exceeded! Rejecting cookie. store_cookie: Total cookie limit exceeded! Rejecting cookie. store_cookie: Value is NULL! Not storing cookie. due to excessive length! due to invalid port! discarding params "%s" in request URI discarding "%s" from request URI LYSetCookie called with host '%s', path '%s', Ignoring this Set-Cookie/Set-Cookie2 request. LYProcessSetCookies: Using Set-Cookie2 header. LYProcessSetCookies: Rejecting Set-Cookie2: %s=%s due to excessive %s%s%s LYProcessSetCookies: Using Set-Cookie header. LYProcessSetCookies: Rejecting Set-Cookie: %s=%s LYProcessSetCookie: attr=value pair: '%s=%s' expires: %ld, %s Forced the 'secure' flag on. LYCookie: Searching for '%s:%d', '%s'. LYLoadCookies: reading cookies from %s *** wrong format: not enough tokens, ignoring line! not stored - no expiration time cookie_domain_flag_set error, aborting programcookie_domain_flag_set (%s, bv=%u, invcheck_bv=%u) The Cookie Jar is empty.Delete this cookie?Delete this empty domain?The domain has been eaten!The cookie has been eaten!Lynx_users_guide.html#Cookies<div><em>Note:</em> %s %s</div> <dl compact> </dl> </body> </html> (Cookies always allowed.)(Cookies never allowed.)(Cookies allowed via prompt.)(No name.)(No value.)(from a previous session)<dd><em>PortList:</em> "%s" <dd><em>Comment:</em> %s Maximum Gobble Date:<dd><em>%s</em> %s%s(End of session.)SetCookieDomain(%s) parse_attribute %.*s discardcommentURLLYSetCookie: expires %ld, %sexpiresLYProcessSetCookiesLYCookie.cMemAllocCopystore_cookienewCookie[no value][no name]number! length and and Set-Cookie: '%s' and Set-Cookie2: '%s' (no value) secure(no domain)Checking cookie %p %s=%s %s %s %d %s %s %d%s $Version="%d"; ; $Path="%s"; $Port="%s"; $Domain="%s"LYLoadCookies: tokenising %s %d:[%03d]:[%s] expires: %s LYStoreCookies: %ld %s %ld not stored - DISCARD not stored - EXPIRED %s %s %s %s %ld %s %s%s%s STORED %s LYConfigCookies Internalcookie_domain_flag_setLYNXCOOKIE�1��=1��a1���0��=1��=1��=1��=1��=1��=1��=1��=1��=1��=1��=1���.��=1��=1��=1��=1��=1���/���m���m���m��m��pm��`m���l��alinkscroll.barscroll.backscroll.arrowscroll.noarrowCSS(CURPAIR):%d usedparse_style(%s) CSSPARSE:%s => %d %s new_bucketLYStyle.c<NOSTYLE>LSS:%s ?!? empty ?!?!?! empty !?!.ignore/etc/lynx.lssinclude:HStyle_addStyle(%s) default:READCSS.default%s:%s READCSS:%s ;%.*ssuccess. update_color_style %p clear_lss_list() add_to_lss_list("%s", "%s") add_to_lss_listLYNX_LSSlynx_lssinit_color_styles(%s) candywhereisedit.active.padedit.active.arrowedit.active.markededit.activeedit.currentedit.prompt.padedit.prompt.arrowedit.prompt.markededit.promptforwbackw.arrowhot.pastemenu.framemenu.bgmenu.nmenu.entrymenu.activemenu.sbcitedelstrikestronginputspan.htmlsrc_commentspan.htmlsrc_tagspan.htmlsrc_attribspan.htmlsrc_attrvalspan.htmlsrc_abracketspan.htmlsrc_entityspan.htmlsrc_hrefspan.htmlsrc_entirespan.htmlsrc_badseqspan.htmlsrc_badtagspan.htmlsrc_badattrspan.htmlsrc_sgmlspecialCSS(PA):style d=%d / h=%d, e=%s CSS(DEF):default_fg=%d, default_bg=%d parse_attributes %d/%d %d/%d %#x CSS(NC): maximum of %d colorpairs exhausted Syntax Error parsing style in lss file: [%s] The line must be of the form: OBJECT:MONO:COLOR (ie em:bold:brightblue:white) where OBJECT is one of EM,STRONG,B,I,U,BLINK etc.
initialise_default_stylesheet CSS:Reading styles from file: %s CSS:Can't open style file '%s', using defaults STYLE.fast-trim: [%s] from [%s]: init_color_styles: overridden/empty
Lynx file "%s" is not available.
LYHashLYHash.cStyle hash: %5d names allocated %5d buckets used %5d hash collisions internal error: previous check didn't find bad HTML tag %sparse-error while caching %s tagspec of lexeme %d Use -trace -trace-mask=8 to see details in log. no name starting at column %d: %s dot after '!' at column %d: %s unexpected char '%c' after tagname at column %d: %s expected text after dot at column %d: %s HTMLSRC_init_caches(%d tagspecs) span.htmlsrc_sgmlspecial:!spanappend_close_tagLYPrettySrc.csecond '!' at column %d: %s tag index(%s) = %d parsing lexeme %d: %s 1st2ndspan.htmlsrc_comment:!spanspan.htmlsrc_tag:!spanspan.htmlsrc_attrib:!spanspan.htmlsrc_attrval:!spanspan.htmlsrc_abracket:!spanspan.htmlsrc_entity:!spanspan.htmlsrc_href:!spanspan.htmlsrc_entire:!spanspan.htmlsrc_badseq:!spanspan.htmlsrc_badtag:!spanspan.htmlsrc_badattr:!spanCS__cbcCS__newCS__0newCS__0ebCS__ebCS__0cbCS__cbCS__0efCS__efCS__0cfCS__cfCS__ebcCS_invalidTRST:Stbl_finishRowInTable() TRST:Stbl_free() TRST:Stbl_finishColGroup() TRST:Stbl_addRowGroup() TRST:Stbl_cancelRowSpans()TRST:Stbl_finishTABLE() p�����������������������В�����������P���`���j���~�������.���.�������ա�����:������������]�����������U���j�����������-���أ��أ��أ����b������n������<���X���J���������ҟ����������8���K���8������%��������������=�������=������ҳ����=������ҳ��=���ҳ��TRST:Stbl_reserveCellsInRow(icell=%d, colspan=%d) growby=%d TRST:Stbl_startTABLE(align=%d) TRST:Stbl_addRowToTable(alignment=%d, lineno=%d) TRST:Stbl_finishCellInTable(lineno=%d, pos=%d, off=%d, end_td=%d) TRST:Stbl_finishCellInRow line=%d pos=%d end_td=%d ncells=%d pnd_len=%d => prev_state=%s, state=%s, return=%d [lines: lastCell=%d state=%d multi=%d] empty=%d (prev)state=(%s) %s TRST:Stbl_addCellToTable(lineno=%d, pos=%d, isheader=%d, cs=%d, rs=%d, al=%d) TRST:get_remaining_colspan; colspan = %d TRST:Stbl_addCellToRow, line=%d, pos=%d, colspan=%d ncells=%d, stateLine=%d, pending_len=%d, pstate=%s, state=%s => prev_state=%s, state=%s, ret=%d TRST:*** COLSPAN=%d is too large, ignored! TRST:*** ROWSPAN=%d is too large, ignored! TRST:Stbl_reserveCellsInTable(icell=%d, colspan=%d, rowspan=%d) TRST:Stbl_addColInfo(cs=%d, al=%d, isgroup=%d) TRST:Stbl_finishTABLE, l=%d, offset=%d, ended=%u. januarygmtyearutccutwetbstndtedtcstcdtmstmdtpstpdtystydtakstakdthsthasthadtcestmezmeztcetmetmewtmestmeszmszmetdsteetmskwadthktcctjstcastcadteasteadtnzstnzdtmonthweekhourminuteminsecondfebruarymarchaprilmayjunejulyaugustseptemberoctobernovemberdecembersundaymondaytuesdaywednesdaythursdayfridaysaturday���������������������N��|������������4������)��<��V�������"��$��$��6��^�����I��I��]��]��'����������������������:/,#-: #2, 2/:: ���������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������� �� ��������������+"-") &,7 !"%6#$.'*/01234589:("""""""""�,�% ��������������� �!��"�����$�)�&�'�(�*����+�,� #!
��UC_MapGN: Using %d <- %d (%s) UC_con_set_trans: Invalid charset handle %d. UC_NoUctb_Register_with_LYCharSets: Too many. Ignoring %s/%s.UC_con_set_unimap: Invalid charset handle %d. Warning: Cannot transcode form charset %s to %s! It seems to be a JIS X 0201 code(%lX). Not supported. UCGetLYhndl_byMIME: NULL argument instead of MIME name. iso-8859-1-windows-3.1-latin-1iso-8859-1-windows-3.0-latin-1UCGetLYhndl_byMIME: unrecognized MIME name "%s" UC_Charset_Setup: Too many. Ignoring %s/%s.UC_Register_with_LYCharSets: Too many. Ignoring %s/%s.registered charset %d mime "%s" lynx "%s" Eastern European (windows-1250)safeUCGetLYhndl_byMIME: ISO-8859-1 assumed. ...prefer existing charset to ASCII Cannot find a handle for MIME name "%s" Cannot find a MIME name for locale NORMAL SUBGROUP OF OR EQUAL TO CONTAINS AS NORMAL SUBGROUP OR EQUAL TO %s//TRANSLITUTF-16BEShift_JISEUC-JPunicode-1-1-utf-8utf8isoiso-iso-8859-8-iiso-8859-8-ex-euc-jpeucjppckx-mac-romanx-nextx-nextstepcp1252cp-1252ibm1252ansi-1251iso-8859-2-windows-latin-2cp1250cp-1250ibm1250ibmcp-koi-8ANSI_X3.4-1968Western (ISO-8859-15)iso-8859-15Western (cp850)Western (windows-1252)IBM PC US codepage (cp437)HP Roman8hp-roman8Japanese (EUC-JP)Japanese (Shift_JIS)Eastern European (ISO-8859-2)Eastern European (cp852)Latin 3 (ISO-8859-3)Latin 4 (ISO-8859-4)Baltic Rim (ISO-8859-13)iso-8859-13Baltic Rim (cp775)Baltic Rim (windows-1257)Cyrillic (ISO-8859-5)Cyrillic (windows-1251)Cyrillic (KOI8-R)Arabic (ISO-8859-6)Arabic (windows-1256)Celtic (ISO-8859-14)iso-8859-14Greek (ISO-8859-7)Greek (windows-1253)Hebrew (ISO-8859-8)Hebrew (windows-1255)Turkish (ISO-8859-9)Turkish (cp857)cp857North European (ISO-8859-10)UNICODE (UTF-8)Ukrainian Cyrillic (cp866u)cp866uUkrainian Cyrillic (KOI8-U)koi8-uCyrillic-Asian (PT154)ptcp154LYFindLocaleCharset(%d) Found name "%s" -> %d ...prior LocaleCharset '%s' ...already assumed-charset ...using LocaleCharset '%s' x-dec-graphics^Z�~A(?A(~Y~SPs1c2f2K2k2U:-u:-U:'u:'U:<u:<U:!u:!AA'aa'AE'ae'O/'o/'A!!a!!A)E!!e!!I!!i!!O!!o!!O)R!!r!!U!!u!!1>1-1!1??%'*b3hHzjA-0a-0B-.b-.C,'c,'D-.d-.D->d->E-!e-!E-'e-'E->e->E-?e-?E,(e,(H-.h-.H-(h-(I-?i-?I:'i:'K-.k-.L-.l-.L--.l--.L->l->M-.m-.N-.n-.N->n->O?'o?'O?:o?:O-!o-!O-'o-'R-.r-.R--.r--.S-.s-.S'.S<.s<.S.-.s.-.T-.t-.T->t->U--:u--:U-?u-?U->u->U?'u?'U-:u-:V-.v-.W-.w-.Z-.z-.A-.a-.A>'a>'A>!a>!A>2a>2A>?a>?A>-.a>-.A('a('A(!a(!A(2a(2a(?A(-.a(-.E-.e-.E>'e>'E>!e>!E>2e>2E>?e>?E>-.e>-.I-.i-.O-.o-.O>'o>'O>!o>!O>2o>2O>?o>?O>-.o>-.O9'o9'O9!o9!O92o92O9?o9?O9-.o9-.U-.u-.U9'u9'U9!u9!U92u92U9?u9?U9-.u9-.Y-.y-.,,?*!*;;LR!*2Ff50R100R500R1000R50r100r500r1000r1000RCD5000R10000R<!!//>!!><//UD->V.+8810-o11-o12-o13-o14-o15-o16-o17-o18-o19-o20-o(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)10.11.12.13.14.15.16.17.18.19.20.(a)(b)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)A-oB-oC-oD-oE-oF-oG-oH-oI-oJ-oK-oL-oM-oN-oO-oP-oQ-oR-oS-oT-oU-oV-oW-oX-oY-oZ-oa-ob-oc-od-oe-of-og-oh-oi-oj-ok-ol-om-on-oo-op-oq-or-os-ot-ou-ov-ow-ox-oy-oz-oHH-VV-dR-Dr-DR-dL-Dl-LD-uR-Ur-UR-uL-Ul-UL-vR-UdruDrVr-UdRuDRVR-vL-UdluDlVl-UdLuDLVL-dH-Dh-DH-uLrulRuH-Uh-ULrUlRUH-vLrvlRvH-UdhuDhVh-UdLrUdlRuDLruDlRUdHuDHVLrVlRVH-CiTELtelcS-cH-cD-cC-M16=T:)eh4(JU)10cKSCffifflSt3+;aM.aH.ah.a+-a+.b+-b+.b+,b+;tm-tm.t+-t+.t+,t+;tk-tk.tk,tk;g+-g+.g+,g+;hk-hk.hk,hk;x+-x+.x+,x+;d+-d+.dk-dk.r+-r+.z+-z+.s+-s+.s+,s+;sn-sn.sn,sn;c+-c+.c+,c+;dd-dd.dd,dd;tj-tj.tj,tj;zH-zH.zH,zH;e+-e+.e+,e+;i+-i+.i+,i+;f+-f+.f+,f+;q+-q+.q+,q+;k+-k+.k+,k+;l+-l+.l+,l+;m+-m+.m+,m+;n+-n+.n+,n+;h+-h+.h+,h+;w+-w+.j+-j+.y+-y+.y+,y+;lM-lM.lH-lH.lh-lh.la-la.&Nb&DO&&&At&<(&//&)>&'>&'!&(!&!!&!)&'?&NS&!I&Ct&Pd&Cu&Ye&BB&SE&':&Co&-a&<<&NO&--&Rg&'m&DG&+-&2S&3S&''&My&PI&.M&',&1S&-o&>>&14&12&34&?I&A!&A'&A>&A?&A:&AA&AE&C,&E!&E'&E>&E:&I!&I'&I>&I:&D-&N?&O!&O'&O>&O?&O:&*X&O/&U!&U'&U>&U:&Y'&TH&ss&a!&a'&a>&a?&a:&aa&ae&c,&e!&e'&e>&e:&i!&i'&i>&i:&d-&n?&o!&o'&o>&o?&o:&-:&o/&u!&u'&u>&u:&y'&th&y:&A-&a-&A(&a(&A;&a;&C'&c'&C>&c>&C.&c.&C<&c<&D<&d<&D/&d/&E-&e-&E(&e(&E.&e.&E;&e;&E<&e<&G>&g>&G(&g(&G.&g.&G,&g,&H>&h>&H/&h/&I?&i?&I-&i-&I(&i(&I;&i;&I.&i.&IJ&ij&J>&j>&K,&k,&kk&L'&l'&L,&l,&L<&l<&L.&l.&L/&l/&N'&n'&N,&n,&N<&n<&'n&NG&ng&O-&o-&O(&o(&O"&o"&OE&oe&R'&r'&R,&r,&R<&r<&S'&s'&S>&s>&S,&s,&S<&s<&T,&t,&T<&t<&T/&t/&U?&u?&U-&u-&U(&u(&U0&u0&U"&u"&U;&u;&W>&w>&Y>&y>&Y:&Z'&z'&Z.&z.&Z<&z<&O9&o9&OI&oi&yr&U9&u9&Z/&z/&ED&A<&a<&I<&i<&O<&o<&U<&u<&_U:-_&_u:-_&_U:'_&_u:'_&_U:<_&_u:<_&_U:!_&_u:!_&A1&a1&A7&a7&A3&a3&G/&g/&G<&g<&K<&k<&O;&o;&O1&o1&EZ&ez&j<&G'&g'&_AA'_&_aa'_&_AE'_&_ae'_&_O/'_&_o/'_&;S&'<&'(&'.&'0&';&'"&A%&E%&Y%&I%&O%&U%&W%&i3&A*&B*&G*&D*&E*&Z*&Y*&H*&I*&K*&L*&M*&N*&C*&O*&P*&R*&S*&T*&U*&F*&X*&Q*&W*&J*&V*&a%&e%&y%&i%&u3&a*&b*&g*&d*&e*&z*&y*&h*&i*&k*&l*&m*&n*&c*&o*&p*&r*&*s&s*&t*&u*&f*&x*&q*&w*&j*&v*&o%&u%&w%&'G&,G&T3&t3&M3&m3&K3&k3&P3&p3&'%&j3&IO&D%&G%&IE&DS&II&YI&J%&LJ&NJ&Ts&KJ&V%&DZ&A=&B=&V=&G=&D=&E=&Z%&Z=&I=&J=&K=&L=&M=&N=&O=&P=&R=&S=&T=&U=&F=&H=&C=&C%&S%&Sc&="&Y=&%"&JE&JU&JA&a=&b=&v=&g=&d=&e=&z%&z=&i=&j=&k=&l=&m=&n=&o=&p=&r=&s=&t=&u=&f=&h=&c=&c%&s%&sc&='&y=&%'&je&ju&ja&io&d%&g%&ie&ds&ii&yi&j%&lj&nj&ts&kj&v%&dz&Y3&y3&O3&o3&F3&f3&V3&v3&C3&c3&G3&g3&A+&B+&G+&D+&H+&W+&Z+&X+&Tj&J+&K%&K+&L+&M%&M+&N%&N+&S+&E+&P%&P+&Zj&ZJ&Q+&R+&Sh&T+&,+&;+&?+&H'&aM&aH&wH&ah&yH&a+&b+&tm&t+&tk&g+&hk&x+&d+&dk&r+&z+&s+&sn&c+&dd&tj&zH&e+&i+&++&f+&q+&k+&l+&m+&n+&h+&w+&j+&y+&:+&"+&=+&/+&'+&1+&3+&0+&aS&p+&v+&gf&0a&1a&2a&3a&4a&5a&6a&7a&8a&9a&_A-0_&_a-0_&B.&b.&_B-._&_b-._&B_&b_&_C,'_&_c,'_&D.&d.&_D-._&_d-._&D_&d_&D,&d,&_D->_&_d->_&_E-!_&_e-!_&_E-'_&_e-'_&_E->_&_e->_&_E-?_&_e-?_&_E,(_&_e,(_&F.&f.&G-&g-&H.&h.&_H-._&_h-._&H:&h:&H,&h,&_H-(_&_h-(_&_I-?_&_i-?_&_I:'_&_i:'_&K'&k'&_K-._&_k-._&K_&k_&_L-._&_l-._&_L--._&_l--._&L_&l_&_L->_&_l->_&M'&m'&M.&m.&_M-._&_m-._&N.&n.&_N-._&_n-._&N_&n_&_N->_&_O?'_&_o?'_&_O?:_&_o?:_&_O-!_&_o-!_&_O-'_&_o-'_&P'&p'&P.&p.&R.&r.&_R-._&_r-._&_R--._&_r--._&R_&r_&S.&s.&_S-._&_s-._&_S'._&_s'._&_S<._&_s<._&_S.-._&T.&t.&_T-._&_t-._&T_&t_&_T->_&_t->_&_U--:_&_u--:_&_U-?_&_u-?_&_U->_&_u->_&_U?'_&_u?'_&_U-:_&_u-:_&V?&v?&_V-._&_v-._&W!&w!&W'&w'&W:&w:&W.&w.&_W-._&_w-._&X.&x.&X:&x:&Y.&y.&Z>&z>&_Z-._&_z-._&Z_&z_&h_&t:&w0&y0&_A-._&_a-._&A2&a2&_A>'_&_a>'_&_A>!_&_a>!_&_A>2_&_a>2_&_A>?_&_a>?_&_A>-._&_a>-._&_A('_&_a('_&_A(!_&_a(!_&_A(2_&_a(2_&_A(?_&_a(?_&_A(-._&_a(-._&_E-._&_e-._&E2&e2&E?&e?&_E>'_&_e>'_&_E>!_&_e>!_&_E>2_&_e>2_&_E>?_&_e>?_&_E>-._&_e>-._&I2&i2&_I-._&_i-._&_O-._&_o-._&O2&o2&_O>'_&_o>'_&_O>!_&_o>!_&_O>2_&_o>2_&_O>?_&_o>?_&_O>-._&_o>-._&_O9'_&_o9'_&_O9!_&_o9!_&_O92_&_o92_&_O9?_&_o9?_&_O9-._&_o9-._&_U-._&_u-._&U2&u2&_U9'_&_u9'_&_U9!_&_u9!_&_U92_&_u92_&_U9?_&_u9?_&_U9-._&_u9-._&Y!&y!&_Y-._&_y-._&Y2&y2&Y?&y?&;'&,'&;!&,!&?;&?,&!:&?:&1N&1M&3M&4M&6M&1T&1H&-1&-N&-M&-3&!2&=2&'6&'9&.9&9'&"6&"9&:9&9"&/-&/=&..&%0&1'&2'&3'&1"&2"&3"&Ca&<1&>1&:X&_!*2_&'-&/f&0S&4S&5S&6S&7S&8S&9S&+S&-S&=S&(S&)S&nS&0s&1s&2s&3s&4s&5s&6s&7s&8s&9s&+s&-s&=s&(s&)s&Li&Pt&W=&oC&co&oF&N0&PO&Rx&SM&TM&Om&AO&13&23&15&25&35&45&16&56&18&38&58&78&1R&2R&3R&4R&5R&6R&7R&8R&9R&aR&bR&cR&_50R_&_100R_&_500R_&_1000R_&1r&2r&3r&4r&5r&6r&7r&8r&9r&ar&br&cr&_50r_&_100r_&_500r_&_1000r_&_1000RCD_&_5000R_&_10000R_&<-&-!&->&-v&<>&UD&_<!!_&_//>_&_!!>_&_<//_&<=&=>&==&FA&dP&TE&/0&DE&NB&(-&-)&*P&+Z&-2&-+&*-&Ob&Sb&RT&0(&00&-L&-V&PP&AN&OR&(U&)U&In&DI&Io&.:&:.&:R&::&?1&CG&?-&?=&?2&=?&HI&!=&=3&=<&>=&<*&*>&!<&!>&(C&)C&(_&)_&0.&02&-T&.P&:3&.3&Eh&<7&>7&7<&7>&NI&(A&TR&Iu&Il&</&/>&Vs&1h&3h&2h&4h&1j&2j&3j&4j&_1-o_&_2-o_&_3-o_&_4-o_&_5-o_&_6-o_&_7-o_&_8-o_&_9-o_&_10-o_&_11-o_&_12-o_&_13-o_&_14-o_&_15-o_&_16-o_&_17-o_&_18-o_&_19-o_&_20-o_&_(1)_&_(2)_&_(3)_&_(4)_&_(5)_&_(6)_&_(7)_&_(8)_&_(9)_&_(10)_&_(11)_&_(12)_&_(13)_&_(14)_&_(15)_&_(16)_&_(17)_&_(18)_&_(19)_&_(20)_&1.&2.&3.&4.&5.&6.&7.&8.&9.&_10._&_11._&_12._&_13._&_14._&_15._&_16._&_17._&_18._&_19._&_20._&_(a)_&_(b)_&_(c)_&_(d)_&_(e)_&_(f)_&_(g)_&_(h)_&_(i)_&_(j)_&_(k)_&_(l)_&_(m)_&_(n)_&_(o)_&_(p)_&_(q)_&_(r)_&_(s)_&_(t)_&_(u)_&_(v)_&_(w)_&_(x)_&_(y)_&_(z)_&_A-o_&_B-o_&_C-o_&_D-o_&_E-o_&_F-o_&_G-o_&_H-o_&_I-o_&_J-o_&_K-o_&_L-o_&_M-o_&_N-o_&_O-o_&_P-o_&_Q-o_&_R-o_&_S-o_&_T-o_&_U-o_&_V-o_&_W-o_&_X-o_&_Y-o_&_Z-o_&_a-o_&_b-o_&_c-o_&_d-o_&_e-o_&_f-o_&_g-o_&_h-o_&_i-o_&_j-o_&_k-o_&_l-o_&_m-o_&_n-o_&_o-o_&_p-o_&_q-o_&_r-o_&_s-o_&_t-o_&_u-o_&_v-o_&_w-o_&_x-o_&_y-o_&_z-o_&_0-o_&hh&HH&vv&VV&3-&3_&3!&3/&4-&4_&4!&4/&dr&dR&Dr&DR&dl&dL&Dl&LD&ur&uR&Ur&UR&ul&uL&Ul&UL&vr&vR&_Udr_&_uDr_&Vr&_UdR_&_uDR_&VR&vl&vL&_Udl_&_uDl_&Vl&_UdL_&_uDL_&VL&dh&_dLr_&_dlR_&dH&Dh&_DLr_&_DlR_&DH&uh&_uLr_&_ulR_&uH&Uh&_ULr_&_UlR_&UH&vh&_vLr_&_vlR_&vH&_Udh_&_uDh_&Vh&_UdLr_&_UdlR_&_uDLr_&_uDlR_&_UdH_&_uDH_&_VLr_&_VlR_&VH&FD&BD&TB&LB&FB&lB&RB&.S&:S&?S&fS&OS&RO&Rr&RF&RY&RH&RZ&RK&RX&sB&SR&Or&UT&uT&PR&Tr&Dt&dT&PL&Tl&Db&Dw&LZ&0m&0o&0M&0L&0R&Sn&Ic&Fd&Bd&*2&*1&_TEL_&_tel_&<H&>H&0u&0U&SU&Fm&Ml&cS&cH&cD&cC&_cS-_&_cH-_&_cD-_&_cC-_&Md&M8&M2&_M16_&Mb&Mx&MX&OK&XX&-X&IS&,_&._&+"&+_&*_&;_&0_&<+&>+&<'&>'&<"&>"&("&)"&=T&=_&('&)'&(I&)I&-?&_=T:)_&A5&a5&I5&i5&U5&u5&E5&e5&O5&o5&ka&ga&ki&gi&ku&gu&ke&ge&ko&go&sa&za&si&zi&su&zu&se&ze&so&zo&ta&da&ti&di&tU&tu&du&te&de&to&do&na&ni&nu&ne&no&ha&ba&pa&hi&bi&pi&hu&bu&pu&he&be&pe&ho&bo&po&ma&mi&mu&me&mo&yA&ya&yU&yu&yO&yo&ra&ri&ru&re&ro&wA&wa&wi&we&wo&n5&vu&"5&05&*5&+5&a6&A6&i6&I6&u6&U6&e6&E6&o6&O6&Ka&Ga&Ki&Gi&Ku&Gu&Ke&Ge&Ko&Go&Sa&Za&Si&Zi&Su&Zu&Se&Ze&So&Zo&Ta&Da&Ti&Di&TU&Tu&Du&Te&De&To&Do&Na&Ni&Nu&Ne&No&Ha&Ba&Pa&Hi&Bi&Pi&Hu&Bu&Pu&He&Be&Pe&Ho&Bo&Po&Ma&Mi&Mu&Me&Mo&YA&Ya&YU&Yu&YO&Yo&Ra&Ri&Ru&Re&Ro&WA&Wa&Wi&We&Wo&N6&Vu&KA&KE&Va&Vi&Ve&Vo&.6&-6&*6&+6&b4&p4&m4&f4&d4&t4&n4&l4&g4&k4&h4&j4&q4&x4&zh&ch&sh&r4&z4&c4&s4&a4&o4&e4&_eh4_&ai&ei&au&ou&an&en&aN&eN&er&i4&u4&iu&v4&nG&gn&_(JU)_&1c&2c&3c&4c&5c&6c&7c&8c&9c&_10c_&_KSC_&ff&fi&fl&_ffi_&_ffl_&ft&st&_3+;_&_aM._&_aH._&_a+-_&_a+._&_b+-_&_b+,_&_b+;_&_b+._&_tm-_&_tm._&_t+-_&_t+,_&_t+;_&_t+._&_tk-_&_tk,_&_tk;_&_tk._&_g+-_&_g+,_&_g+;_&_g+._&_hk-_&_hk,_&_hk;_&_hk._&_x+-_&_x+,_&_x+;_&_x+._&_d+-_&_d+._&_dk-_&_dk._&_r+-_&_r+._&_z+-_&_z+._&_s+-_&_s+,_&_s+;_&_s+._&_sn-_&_sn,_&_sn;_&_sn._&_c+-_&_c+,_&_c+;_&_c+._&_dd-_&_dd,_&_dd;_&_dd._&_tj-_&_tj,_&_tj;_&_tj._&_zH-_&_zH,_&_zH;_&_zH._&_e+-_&_e+,_&_e+;_&_e+._&_i+-_&_i+,_&_i+;_&_i+._&_f+-_&_f+,_&_f+;_&_f+._&_q+-_&_q+,_&_q+;_&_q+._&_k+-_&_k+,_&_k+;_&_k+._&_l+-_&_l+,_&_l+;_&_l+._&_m+-_&_m+,_&_m+;_&_m+._&_n+-_&_n+,_&_n+;_&_n+._&_h+-_&_h+,_&_h+;_&_h+._&_w+-_&_w+._&_j+-_&_j+._&_y+-_&_y+,_&_y+;_&_y+._&_lM-_&_lM._&_lH-_&_lH._&_lh-_&_lh._&_la-_&_la._&NU&SH&SX&EX&ET&EQ&AK&BL&BS&HT&VT&FF&CR&SO&SI&DL&D1&D2&D3&D4&NK&SY&EB&CN&EM&SB&EC&FS&GS&RS&US&DT&PA&HO&BH&NH&IN&NL&SA&ES&HS&HJ&VS&PD&PU&RI&S2&S3&DC&P1&P2&TS&CC&MW&SG&EG&SS&GC&SC&CI&ST&OC&PM&AC � ROOT� (�)(�)(�)[�][�] � ������ !� d���`�`�`�`�(�)[�] � �-<-��->�v�==�<����>|�^\=-�>�8��J��\,)d�d((�))�X`,�,:�:8�mV�<-�<-����->>��-��^|>-�>-|-�>-||-�-��-^\��/^-><�<-�>�><-�|v * fA.b`d`@<umd>V"R<umd>g`j<rnd>h<?>z<lat>j<vel>@.&.*<lat>*.J`r<lbd>w<vls>l^H<vcd>l!c!p!b<trl>G`k!q`d3tS<h><r><w>:\_M_L_B_v<o><H>~~beta theta upsi phi pi kappa rho ZHSCH`Esch`eoylilolWaHWamEmWa`se`su`si`sa`sE`s`so`sWarErWaxuxaxExoxWaqeqiqaqEqoqWeqWiqWaqWEqWQeQuQiQaQEQoQWeQWiQWaQWEQWbWavavEvovWatEtWacucicacEcWa`he`hu`hi`ha`hE`h`hohWehWihWahWEhWnWaNWae3kEkWekWikWakWEkWKWeKWiKWaKWEwuwE`u`I`ozEzWaZWayeyEyWadEdWaDWajEjojWagWugWigWagWEgWGWaTWaCeCWaPWaSWeSWuSWiSWaSWESWSWo`Sa`Su`Si`SE`S`SofafufEfWapWamYarYafYa`?:|:`1`2`3`4`5`6`7`8`9`10`20`30`40`50`60`70`80`90`100`10000h`aha'ha~hAh`AhA'hA~hIhOrhRh(->)(<-) o > 0/00 0/000```[-|P./. .: '''' .:. :.: :+:^0^4^5^6^7^8^9^+^-^=^(^)^n_5_6_7_8_9_+_=C//Crm/RsrJEURT//DpG|C|a/ca/sc/oc/u\hbar ImNo.(P)(SM)oz.OhmAng.Aleph Bet Gimel Dalet FAX 1/3 2/3 1/5 2/5 3/5 4/5 1/6 5/6 1/8 3/8 5/8 7/8 1/VIIVIIIXIXIIviiviiixii<->^|v</--/><<-^^||vv<-<^|_^|v_<~><-/->Nv<^||^><v||v>RET>u<=>^||v<<=^|^|=>>|v|v<=/=<=/=>^||^\\//^\\vv//<-==->^|=||=|v^::v|<-->|^!^-I^|I^^I\v_|-o>|v^|=->>><-|-<-|-><-||-<-||->\partialTDNE{}Nabla!(-!-) qed\prod\sum-/+ SQRT ROOT3 ROOT4 infty !PP .--~!~-~!=!~= !~= ~3=... !=3 =4.LE..GE..LT.NOT.EQ..GT.NOT.EQ.!<=!>=!<~!>~ <> >< !<> !>< !(C !)C !(_!)_)!_(+)(-)(/)(.)(=)[+][-][x][.] MODELS FORCES !PROVES NOT TRUE !FORCES NORMAL SUBGROUP OF CONTAINS AS NORMAL SUBGROUP MULTIMAP INTERCALATE XOR NAND DOT STAR >.<<<<=|>>=|<![_!]_[!_]!_<!~>!~(-/) >i< :( OPT [X>[kbd]<X] ALT <-pppp->[PrSc][ClSc] CR _^_<|cOo"8"<vRvSolAsc.Desc.Conj.Opp."J"Joe<==<--||^!X!!Z!!R!!B!2TSXP(*'\,)(PEACE)-HVN--LAK--FIR--THR--WND--WTR--MTN--RTH-:-(:-)(-:Lun1Lun3MerVenTerMarJupSatUraNepPluAriGemCncLeoVirScoAqrPscd-dd=d/_\/1\/2\/3\/4\/5\/6\/7\/P\/p\(oo)oLd1d2d5d6(:)((.))((:)) f F 'X`+-),X,$^T^}T{:*:}|{!V!f.f.m.m.m.f.xm.xmf.o|o/b//c/8<>8(TEL)+->-[v]mV, x X<x><3((1))((2))((3))((4))((5))((6))((7))((8))((9))((10))>>->vv\v^^/^^||||||||vvOOv(+)><---<---><===<===><---||---><===||===>~~~><=|=<=|=><=||-|v^|-|^|||<- -<- - ->- - ->>-|->>-||->>->>>-|->>>-||->>-<<>>-<><-<><-||-><>^\vv/^^\,,/^^X^Xv^X^vX ^X v-^)v(v->+<-+-x-><-o->^^|o\int\int\int\int .xx_xx(x((x))/+\/-\/x\::=:=:v-__.~~.(([[]]NULENQDC1DC2DC3DC4NAKSYN � (�)(�)(�)[�][�] � ROOT� !� 3� 4�d�!��'h' !� !�t� � !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~���� & ����������� " ���������^�������������V����Q!��X��� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%%%%%%%$%,%4%<%�%�%�%�%�%�%�%�% #�%""H"d"e"�!#����P%Q%R%QTT%VWW%X%Y%Z%[%�]%^%_%`%a%c%f%g%h%i%j%�l%�N01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'* !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?�%�%�%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%%%�%�%�%�%�%@ABCDEFGHIJKLMNOQ��TVW�"!��%����
!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~���� � �� ��������������������������������%�%�%%$%����c%Q%W%]%��%%4%,%%%<%��Z%T%i%f%`%P%l%����������%%�%�%���%�������������������������������%� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?�%�%�%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%%%�%�%�%�%�%@ABCDEFGHIJKLMNOQTW^�"�"!��%� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��""�%%%<%$%,%%4%%%%%�"����H"��������������������������������`abcdefghi�������������������������������������������������������������@��������������}�Q��������������% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~������������������������������� ����������#�������%�%�%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%%%�%�%�%�%�%������������"��)"a"�e"d" #!#�H"�"�" ��%� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~�������������1����������0�����^_���������������%�%�%%$%����c%Q%W%]%��%%4%,%%%<%��Z%T%i%f%`%P%l%���������%%�%�%���%�����������������������������%� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~�������o�B�PQ�y���9:��=>Z[���deA� �G��������}~6�z'_���%�%�%%$%���^c%Q%W%]%{|%%4%,%%%<%Z%T%i%f%`%P%l%��G���%%�%�%bn�%����CDH`(aHT�Up��c����(�����'� ���qXY�%� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~����������������������������������������������������������%�%�%%$%�����c%Q%W%]%��%%4%,%%%<%��Z%T%i%f%`%P%l%������1������%%�%�%���%�������������������� 3�����'� ���' ����%� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~���#�BVW+y�����M�"�Z[�������*�{|z ������A���%�%�%%$%c%Q%W%]%.`%%4%,%%%<%rjZ%T%i%f%`%P%l%} /ask~%%�%�%�%�%�%��LC���D67;<FE �� ���� �"�����%� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~���������������������������c������1������������������%�%�%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%%%�%�%�%�%�%�������������������e"d"���H"�"��" ��%� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~����������������������������������� ��������������#�������%�%�%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%%%�%�%�%�%�%������"��������&!�"���" ")"a"�e"g"d"f" #�!#�H"� "��' " ��%� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~� & ! 0 9 ��� " "!: ����������V���������������W�����.���y"6*;`CE�L���rAZj�{}�/�� �z#7+<aDF�M���sB[k�|~� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~� ~ � & ! �0 y9 R���� " �"!�: S �������������������������������!"#$%&'()*+,-./0123456�789:@ABC�D�EFGH�����IJ��KLMN�OP�Q�R�� � !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~� � & ! �0 9 " �"!: ����� ������������������������������������������������������������������������������ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~� � & ! 0 9 � � " "!: �������������� ������������������������������������������������������������������������������ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~� � & ! �0 `9 R} �" �"!a: S~x����������������� ���������' �'����������������������������������������������������������������������� !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ S & ! � 0 9 R " "!Y: Z\[_�^�����������V����Q!T�XUW !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~� & ! 0 `(9 Zd}y " "!aH: [e~6z���A�����^����{� ��(B������'_�=�>|T���9�'����CG��P��Xn�p��b�U���:� �G����DH��Q��Yo�q��c��UCSetTransParams: from %s(%d) to %s(%d) UCChangeTerminalCodepage: Called, but not implemented!RestoreSession %s SaveSession %s # lynx session / g h %d %d V %d EXTERNAL: '%s' <==> '%s' lookup_externalLYExtern.cselected choice %d of %d External support is currently disabled.Unable to get status of '%s'.testing ok_stat(%s) LYExecv path='%s' argv[%d] = '%s' LYexecv ->%d move %s to %s-fremove %sbuiltin remove ->%d %s LYNXDIRED://testing ok_lstat(%s) Remove directory '%s'?Remove directory?Remove file '%s'?Remove file?Remove symbolic link '%s'?Remove symbolic link?rmdirbuiltin rmdir ->%d %s Enter new location for file: NULL URL pointerPermissions for <H1>%s%s</H1> Specify permissions below:<Ol><Li>%s<Br><Br> %s %s:<Br> Others:%s<Br> form to permit</Body></Html>mode=IRUSRIWUSRIXUSRIRGRPIWGRPIXGRPIROTHIWOTHIXOTHInvalid mode format.Invalid syntax format.chmod %.4o %s%.4ochmodbuiltin chmod %.4o ->%d %s Enter new name for file: .~/touch %stouchbuiltin touch ->%d %s make directory %smkdirbuiltin mkdir ->%d %s ,Nothing currently selected.%s.<p> tagged item:Current selection:<em>%s</em> %d %stagged items:%s<br> %s , ...<a href="%s">%s</a> keystrokes/dired_help.htmlCurrent directory:<em>%s</em> %s<br> <em>%s</em> modify_tagged(%s) NLPNEW_FILENEW_FOLDERMODIFY_NAMEMODIFY_LOCATIONPERMIT_SRCREMOVE_SINGLEDECOMPRESSUNTAR_GZcd %s; %s -qdc %s | %s %s %s-xfUNTAR_Zcd %s; %s %s | %s %s %sUNTARcd %s; %s %s %s-cfcd %s; %s %s %s %s | %s >%s%scd %s; %s %s %s %s.tar %sUNGZIP%s -d %scd %s; %s -rq %s.zip %scd %s; %s -q %sExecuting %s add_menu_itemLYLocal.cChange directoryLYNXDIRED://CHDIRNew File(in current directory)LYNXDIRED://NEW_FILE%dNew DirectoryLYNXDIRED://NEW_FOLDER%dModify File Name(of current selection)LYNXDIRED://MODIFY_NAME%pModify Directory NameModify Name(of selected symbolic link)Modify File PermissionsLYNXDIRED://PERMIT_SRC%pModify Directory PermissionsChange Location(of selected file)LYNXDIRED://MODIFY_LOCATION%p(of selected directory)Remove File(current selection)LYNXDIRED://REMOVE_SINGLE%pRemove DirectoryRemove Symbolic LinkExpandLYNXDIRED://UNTAR_Z%pLYNXDIRED://UNTAR_GZ%pUncompressLYNXDIRED://DECOMPRESS%pLYNXDIRED://UNGZIP%pLYNXDIRED://UNZIP%pUnTarLYNXDIRED://UNTAR%pLYNXDIRED://TAR%pTar and compress(using GNU gzip)LYNXDIRED://TAR_GZ%pPackage and compress(using zip)LYNXDIRED://ZIP%pCompress(using Unix compress)LYNXDIRED://COMPRESS%p(using gzip)LYNXDIRED://GZIP%pLYNXDIRED://MOVE_TAGGED%dLYNXDIRED://REMOVE_TAGGEDLYNXDIRED://CLEAR_TAGGEDUnable to %s due to system error!Probable failure to %s due to system error!move_file source=%s, target=%s builtin move ->%d source=%s target=%s ...remove source after copying ->%d Illegal filename; request ignored.Destination has different owner! Request denied.Destination is not a valid directory! Request denied.The selected item is not a file or a directory! Request ignored.Enter new location for directory: Unexpected failure - unable to find trailing path separatorSource and destination are the same location! Request ignored!Unable to open permit options file<Html><Head> <Title>%s</Title> </Head> <Body> <Form Action="%s//PERMIT_LOCATION%s"> <Input Type="checkbox" Name="mode" Value="IRUSR" %s> Read<Br> <Input Type="checkbox" Name="mode" Value="IWUSR" %s> Write<Br> <Input Type="checkbox" Name="mode" Value="IXUSR" %s> %s<Br> <Input Type="checkbox" Name="mode" Value="IRGRP" %s> Read<Br> <Input Type="checkbox" Name="mode" Value="IWGRP" %s> Write<Br> <Input Type="checkbox" Name="mode" Value="IXGRP" %s> %s<Br> <Input Type="checkbox" Name="mode" Value="IROTH" %s> Read<Br> <Input Type="checkbox" Name="mode" Value="IWOTH" %s> Write<Br> <Input Type="checkbox" Name="mode" Value="IXOTH" %s> %s<Br> <Br> <Li><Input Type="submit" Value="Submit"> %s %s %s. </Ol> </Form> Special URL only valid from current File Permission menu!permit_location: called for <%s>. permit_location: called for file '%s'. There is already a directory with that name! Request ignored.There is already a file with that name! Request ignored.The specified name is already in use! Request ignored.Enter new name for directory: Illegal character (path-separator) found! Request ignored.Enter name of file to create: Illegal redirection "//" found! Request ignored.Enter name for new directory: Temporary URL or list would be too long.Create file or directory (f or d): <p>Upload to current directory:<p> <a href="LYNXDIRED://UPLOAD=%d/TO=%s"> %s </a><br> Enter new location for tagged items: Modify name, location, or permission (n, l, or p): This feature not yet implemented!Remove all tagged files and directories?local_dired: called for <%s>. cd %s; %s %s %s %s | %s -qc >%s%sExecuting system command. This might take a while.Move all tagged items to another location.Remove all tagged files and directories.Untag all tagged files and directories.lnsdLNSDHTParsePort %d /..//..? QUERY PATH host path puncHTParse: aName:`%s' relatedName:`%s' want:%s%s%s%s%s%s%s snewspostsnewsreplyHTParse: (ABS) HTParse: (Related-ABS) HTParse: (REL) HTParse: (Related-REL) news:/HTParse: (No inheritance) HTParse: ignore:`%s' HTParse: spaces:`%s' HTParse: encode:`%s' HTParse: result:`%s' pass LYFillLocalFile:`%s' HTRelativeHTEscapeHTEscapeUnsafeHTMake822Word../../../WWW/Library/Implementation/HTParse.cHTparse: `%s' expressed relative to `%s' is `%s'. localLocation=www/diredget_physical %s ?0,0Proxied=NoProxy=:119/NNTPSERVER:210/WWW_%s_GATEWAY%s_proxyGateway found: %s proxy server found: %s show alert:Access forbidden by ruleHTAccess: status=%d Log: %24.24s %s %s %s HTAccess: Can't access `%s' Unable to access document.HTSearchLYUCPushAssumed: UCLYhndl_for_unspec changed %d -> %d LYUCPopAssumed: UCLYhndl_for_unspec changed %d -> %d HTAccess: loading document %s Redirection limit of 10 URL's reached.Document with POST content not found in cache. Resubmit?HTAccess: '%s' is a redirection URL. HTAccess: Redirecting to '%s' HTAccess: Document already in memory. HTAccess: Auto-reloading document. HTAccess: Appending '?0,0' coordinate pair. Loading failed, use a previous copy.HTAccess: Loading failed, use a previous copy. HTAccess: `%s' has been accessed. HTAccess: `%s' has been accessed, partial content. HTAccess: `%s' has been accessed, No data left. HTAccess: `%s' has been accessed, No data loaded. HTAccess: `%s' has been accessed, transfer interrupted. **** HTAccess: socket or file number returned by obsolete load routine! **** HTAccess: Internal software error. Please mail lynx-dev@nongnu.org! **** HTAccess: Status returned was: %d ../../../WWW/Library/Implementation/HTAccess.cSSL error:%s-Continue?HTTP: Seeding PRNG :/?#[]@-._~trim auth: result:`%s' trim host: result:`%s' CONNECTHTTP/1.0HTTP/1.1Accept: 0.0https://HTTP: connect_url = '%s' HTTP: connect_host = '%s' snews://HTTPSConnection interrupted....adding SSL_OP_NO_TLSv1 HTTP: SSL: %s Validating CNs in '%s' :CN</CN=:SAN<DNS=IP=SSL errorCertificate issued by: %sCONNECT POST HEAD GET Host: %s%c%cConnection: close%c%c;q=%4.3f;mxb=%ld;q=%4.3fAccept: %s%s%s*/*;q=0.01%c%cAccept-Encoding: %s%c%cAccept-Language: %s%c%cAccept-Charset: , iso-8859-1;q=0.01, us-ascii;q=0.01Pragma: no-cache%c%cCache-Control: no-cache%c%cUser-Agent: %.*s%c%cFrom: %s%c%cReferer: Cookie: Cookie2: $Version="1"HTTP: Sending Cookie: %s Content-type: %s%c%cContent-length: %d%c%cSending HTTP request.Retrying as HTTP0 request.HTTP: WRITE delivered OK HTLoadHTTPHTTP: Trying to read %d HTTP: Read %d HTTP: Rx: %s Address should begin with<TITLE>Help %20s %d URL=%s (%s) STATUS=%s --- Talking HTTP0. HTTP: format_in is '%s', --- Talking HTTP1. HTTP: close socket%s %d %s Show the 401 message body?Show the 407 message body?HTTP: Proxy URL is '%s' SSL callback:%s, preverify_ok=%d, ssl_okay=%dHTGetSSLHandle: client key file is set to %s by config SSL_CLIENT_KEY_FILE HTGetSSLHandle: client cert file is set to %s by config SSL_CLIENT_CERT_FILE User/password contains only punctuation: %sUser/password may be confused with hostname: '%s' (e.g, '%s')HTTP: Sending proxy authorization: %s HTTP: Sending authorization: %s HTTP: Not sending proxy authorization (yet). HTTP: Not sending authorization (yet). HTTP: Interrupted on connect; recovering cleanly. HTTP: Unable to connect to remote host for `%s' (errno = %d). Unable to connect to remote host....called SSL_set_tlsext_host_name(%s) ->%d Retrying connection without TLS.HTTP: Unable to complete SSL handshake for '%s', SSL_connect=%d, SSL error stack dump follows Unable to make secure connection to remote host.Matching ssl_host '%s' cert_host '%s' Verified connection to %s (cert=%s)Verified connection to %s (subj=%s)Can't find common name in certificateUNVERIFIED connection to %s (cert=%s)Secure %d-bit %s (%s) HTTP connectionomit Accept-Encoding to work-around interaction with -source User-Agent: %s/%s libwww-FM/%s%c%cCan't proceed without a username and password.Proceed without a username and password?HTTP: Sending Cookie2: $Version ="1" HTTP: Doing post, content-type '%s' HTTP: Got status 0 in initial write HTTP: BONZO ON WRITE Trying again with HTTP0 request. HTTP: Hit unexpected network WRITE error; aborting connection. Unexpected network write error; connection aborted.HTTP request sent; waiting for response.../../../WWW/Library/Implementation/HTTP.cHTTP: Interrupted initial read. HTTP: BONZO Trying again with HTTP0 request. HTTP: Hit unexpected network read error; aborting connection; status %d:%s. Unexpected network read error; connection aborted.HTTP: Hit unexpected network read error; aborting connection; status %d. <TITLE>Bad File Request</TITLE>Document address invalid or access not authorisedHTTP: close socket %d to retry with HTTP0 HTTP: Scanned %d fields from line_buffer HTTP: format_in being changed to text/HTML Treating as '%s' with encoding '%s' Got unexpected Informational Status.Request fulfilled. Reset Content.HTTP: Proxy tunnel to '%s' established. Will attempt handshake and snews connection. Will attempt handshake and resubmit headers. Got unexpected 304 Not Modified status.Redirection of POST content requires user approval.HTTP: Have POST content. Treating 301 (Permanent) as Temporary. Have POST content. Treating Permanent Redirection as Temporary. HTTP: Access authorization required. Use the -auth=id:pw parameter. to retry with Access AuthorizationCan't retry with authorization! Contact the server's WebMaster.HTTP: Proxy authorization required. Use the -pauth=id:pw parameter. to retry with Proxy AuthorizationCan't retry with proxy authorization! Contact the server's WebMaster.Unknown status reply from server!HTTP: Interrupted followup read. HTTP: Trying again with HTTP0 request. HTTP: Picked up location '%s' Retrying with access authorization information.Retrying with proxy authorization information.SSL error:host(%s)!=cert(%s)-Continue?���Q������p�������Q���%%%.*sld%%%.*sd%%%.*ssREADME%3Ferror seeking in stream not a gzip-stream static Huffmandynamic Huffmannon-HTSetSuffix/tmp/W3_Cache_%s/WWW/%s/%s%sURLPath `%s' means path `%s' Node `%s' means path `%s' /Net/Node `%s' means file `%s' %s//%sFile `%s' means node `%s' display character setFile: Value of %s is %.3f application/gzipapplication/compress File is not editable. /~type=/%2F/vmsysu:/anonymou.WelcomeCurrent directory is %s/../../..application/x-compressed %a.multiHTLoadFile: can't stat %s %s is a directory .www_browsableOpening directory %s print_local_dir() started Reading directory...Subdirectories:Files: -> application%.12s%.7s %.4s %c%s%s%sData transfer interrupted.Can't open `%s', errno=%d Can't access requested file.Empty Directory/usr/bin/install--S--s-wS-wsr-Sr-srwSrws--x-w--wxr--r-xrw-rwx--T--t-wT-wtr-Tr-trwTrwt������������$��������c��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e���c��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e���b��@e��@e��@e��@e��@e��@e��@e��@e��@e���b��@e��@e��@e��@e��@e��@e��@e��@e��@b��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e��@e���b��@e��@e���a��@e��@e���a��@e��@e��@e���_�� e��@e��@e���d��d��@e��@e���c��@b���o��,o���o���o���o���o���n���o���o���o���o���o���o���o���o���o��|o���o���o��lo��\o���o��Lo��<o��isDeflate: assume zlib-wrapped deflate isDeflate: not a deflate-stream isDeflate: %send block, %s compression ../../../WWW/Library/Implementation/HTFile.cHTnameOfFile_WWW(%s,%d,%d) = %s HTCharsetFormat: Extended MIME Content-Type is %s GetFileInfo: '%s' is a%s %s %s file, charset=%s (%d). HTCompressFileType(%s) returns %d:%s File mode is 0%o, uid=%d, gid=%d. My uid=%d, %d groups (<meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1"> Multiformat: directory scan failed.HTLoadFile: value of presenting %s is %f Could not find suitable representation for transmission.Directory browsing is not allowed.Selective access is not enabled for this directoryThis directory is not readable.Reading the directory interrupted by user Unknown format character `%c' in list format HTLoadFile: Opening `%s' gives %p HTLoadFile: gzopen of `%s' gives %p HTLoadFile: zzopen of `%s' gives %p Could not open file for decompression!���>�x��@��x��HTBTree_newHTBTree_add../../../WWW/Library/Implementation/HTBTree.cJan9999%02d%.2sHTFTP:close_connection: %sclose master socketReceiving FTP directory.HTFTP: Line in %s is %s parse_dir_entrycan not access directory .total not available.ME%.3s %.2s %c%.1s VMS.dir%.6s %.4s%.6s %.5sMS Windows%.3s %.2s 20%.2s 19%.2s %02d:%.2sVM/CMSread.meAdding file to BTree: %s * Kb%luTransferred %d bytes%02d Tx: %s Rx: %s230-250-220-%d%cThis server is broken (RETR) This server is broken (EPSV) CDUPMACB E MACB %s %s%c%cNCSATCPCPWD SITE DIRSTYLE MSDOS offsetup_connection(%s) get_connectionget_connection(%s) %s@%sat beginning of loginHTFTP: Interrupted %s. awaits your command ready.NetPresenzwhile sending usernamePASS %s%c%cPASS %s@%s%c%cwhile sending passwordACCT noaccountHTFTP: Login fail: %sHTFTP: Logged in. SYST UNIX Type: L8 MAC-OS MachTenUnixMadGoatVM DCTSMAC-OS TCP/Connect IIMACOS Peter's ServerWindows_NTWindows2000getsockname failedsocket for master socketAFgetsocknameHTFTP: This host is %s bindPORT %d,%d,%d,%d,%d,%d%c%cEPRT |%d|%s|%s|%c%cJUNK%c%clistenHTFTP: Port defined. PASVEPSV%d,%d,%d,%d,%d,%d%d.%d.%d.%d(%c%c%c%d%c)HTFTP: getnameinfo failed %s//%s:%d/FTP dataconnect for datasetup_connection returns %d HTVMSname%s%s:%s%s%s:[%s]%sHTFTPLoad(%s) %s connection %2HTFTP: type=%s HTFTP: UnEscaped %s HTFTP: Trimmed '%s' HTFTP: VMSized '%s' HTFTP: Filename '%s' [.%s%.*s[%s]%.*s[000000]000000%s:[.%.*s]change path '%s' ...to path '%s' NLST%d %ldRETR{{reconnecting... ...done }}reconnecting acceptTCP: Accepted new socket %d ._-Receiving FTP file.HTFTPLoad: normal end; control socket is %d closing control socket %d control connection closeFebAprMayJunJulAugSepOctNovDecHTFTP: Closing control socket %d HTFTP: Closed master socket %u read_directory: interrupted after %d bytes read_directory: interrupted_in_next_data_char after %d bytes ../../../WWW/Library/Implementation/HTFTP.cHTFTP: Falling back to treating as Unix server. HTFTP: %s filename: %s date: %s size: %ld HTFTP: Closing data socket %d HTFTP: No control connection set up!! HTFTP: Error %d sending command: closing socket %d HTFTP: Interrupted in HTGetCharacter, apparently. Adding message to help cache: %s Error on rx: closing socket %d HTFTP: They close so we close socket %d HTFTP: Treating as %s server. HTFTP: Treating as NCSA server. HTFTP: Treating as Unix server. HTFTP: Treating as VMS server. HTFTP: Treating as Generic server. HTFTP: DIRSTYLE failed, treating as Generic server. Enter password for user %s@%s:HTFTP: Interrupted on connect HTFTP: Unable to connect to remote host for `%s'. FTP connected, socket %d control %p HTFTP: Treating as MachTen server. HTFTP: Treating as MSDOS (Unix emulation) server. HTFTP: Treating VMS as UNIX server. HTFTP: Treating as CMS server. HTFTP: Treating as DCTS server. HTFTP: Looks like a TCPC server. HTFTP: Treating as NetPresenz (MACOS) server. HTFTP: Treating as Peter Lewis (MACOS) server. HTFTP: Treating as Window_NT server. HTFTP: Treating as Window_2K server. HTFTP: Treating as MS Windows server. MACOS AppleShare IP FTP ServerHTFTP: Treating as AppleShare server. HTFTP: Ugh! A Generic server. HTFTP: Opened master socket number %d HTFTP: bound to port %d on %s TCP: Master socket(), bind() and listen() all OK HTFTP: Interrupted in response (port_command) HTFTP: PASV reply has no inet address! HTFTP: EPSV reply has invalid format! HTFTP: getpeername(control) failed HTFTP: Server is listening on port %d FTP data connected, socket %d Unable to connect to FTP host.HTFTP: Rejecting path due to illegal escaped slash. HTFTP: Rejecting path due to non-Unix-style syntax. check '%s' to translate x/y/ to [.x.y] 150 Opening ASCII mode data connection for /bin/dl. HTFTP: Treating as "dls" server. 4q��n��n��p��{m��4q��nl��n��nl��n��n��l��n��n��n��Sk��<w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w��w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w���w��dv���w���w���w���w���w���w���w���w���w��,v���w���w���w���w���w���w���w���w���u���w���w���w���w���w���w���w���w���w���w���w���w��dv���w���w���u���w���w���u���w���w���w���s���w���w���w���w��tw���w���w��Tw���u��000 *** TCP read error on respondump_addrinfo %s: read_addrinfo length %lu ...read_addrinfo %d items read_addrinfo "%s: %p { h_name = %p "%s", h_aliases = %p {%s %p "%s"%s0x0 }, h_addrtype = %d, h_length = %d, h_addr_list = %p%s %p%s%d%s, 0x0 } }CHILD gethostbynameCHILD fill_rehostentsetup_nsl_forkRead from pipeHTGetAddrInfoCHILD getaddrinfofilladdr_info %p ...fill_addrinfo %d:%lu fill_addinfoCHILD fill_addrinfoLYGetHostByName%s: Can't parse `NULL'. %s: parsing `%s'. %s: INTERRUPTED for '%s'. TCP: Local host name is %s Making %s connection to %sthis socket's first connectthis socket's first selectfailed selectconfirm-ready connectconfirm-not-ready connect [%d] family %d, socktype %d, protocol %d addr %s port %s ../../../WWW/Library/Implementation/HTTCP.c%s: INTERRUPTED gethostbyname. %s: NSL_FORK child %d exited, status 0x%x. %s: NSL_FORK child %d got signal, status 0x%x! %s: NSL_FORK child %d dumped core! %s: NSL_FORK child %d is stopped, status 0x%x! HTGetAddrInfo: getaddrinfo(%s, %s): %s TCP: Error %d in `SOCKET_ERRNO' after call to %s() failed. %s %s: Resolved name to a hostent. %s: Can't find internet node name `%s'. Unable to locate remote host %s.socket failed: family %d addr %s port %s.Could not make connection non-blocking.Connection failed (too many retries).*** INTERRUPTED in middle of connect. this socket's first and only connectCould not restore socket to blocking.HTDoRead - refusing to read fd 0 which is a tty! HTDoRead - no file descriptor! HTDoRead - interrupted before starting! Socket read failed (too many tries)....HTDoRead returns %d (%ld seconds) S_attr_gapS_commentS_croS_doctypeS_dollarS_dollar_dqS_dollar_parenS_dollar_paren_dqS_dollar_paren_sqS_dollar_sqS_dquotedS_endS_entityS_equalsS_eroS_escS_esc_dqS_esc_sqS_exclamationS_in_kanjiS_incroS_piS_junk_tagS_litteralS_markedS_nonascii_textS_nonascii_text_dqS_nonascii_text_sqS_parenS_paren_dqS_paren_sqS_pcdataS_scriptS_sgmlattS_sgmleleS_sgmlentS_squotedS_tagS_tag_gapS_tagname_slashS_textS_attrSRCSTOP %d SRCSTART %d &#xSGML Comment: <%s> SGML: class is '%s' supplied,***forced bySGML: </%s> ignored SGML: End </%s> tagnum(%p) = %d SGML: Restart <%s> SGML: Start <%s> start_elementSGML before %s|%.*s|%c| <?leading spaces: %d trailing spaces: %d <WBR>%cSGML: `<%.*s/' found! SGML: Treating <%s%c as text SGML: *** Invalid element %s SGML Identifier: <%s> !DOCTYPE!ENTITY!ELEMENT!ATTLISTSGML Doctype: <%s> DTD XHTML ...processing extended HTML SGML Marked Section: <%s> ![INCLUDE[![CDATA[SGML discarding empty %s SGML: found attribute %s, %d SGML: found = but no value %sUnknown end tag </%s> FORMSGML: `</%s%c' found! ?xml encoding=...Use UTF-8 for XML SGML after %s|%.*s|%c| SGML_write found UTF-8 BOM SGML_beginTO_SJISTO_JIS(B$B������������������������������������������������������������������������������������������������������������������������������SGMLParserL�<�,��������������|�l�\�L�<�,������������������|�l�\�L�<�,�������������\�_��+���*��X*��0*���)���)���-���)��.���-��0.���+��`#���!��X,��p!��p"���,��`.�� "��@2���!��#��p���(���(��p-��@-��P)��-���,��X��#���'���&���'��&���%���$���$��M���+�����T*��*���)���)��D)��)���,���(��T-��$-���-��D+���"��� ���+��� ���!���+���-��t!���1��$!��l"�����D(��(���,���,���(��d,��,,�����l"���&��$&��D'��\%���$��L$���#������*��h/���)��h)��)���(���(��h(��L,��0(���,��|,���,���*��"��* ��+�� ��!��D+��-��� ���0��x ���!�����'��`'��,���+���'���+���+�����!��@&��x%���&���$��P$���#��0#�����8*���a���J���J���J���J���J���J���J���J���J���a���J���J���J���J���J���J���a���J���J���J���J���J���J���J���J���a���J���J��[a���J���J��[a���J���J���J���J���J���J��[a���a���J���J���J���J���J���a���J���a���J���J���J���J���J���J���J���J���J���J���J���J���J���a���J���J���J���J���J���J���J���J���J��[a��[a���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���a���J���J���J���J���J���J���J���J���J���J���J���J���J���J���a���J���J���J���J���J��[a��[a���J���J��[a��[a��[a���J��[a���a���a��SGML: attribute value is '%s' SGML: Attribute value %s ***ignored handle_entity: Ignoring '%s'. SGML: Unknown entity '%s' %lX %ld SGML: End </%s> <- %s end </%s> SGML: Still open %s, ***no open %s for </%s> SGML: Nesting <%s>...<%s> <- ***invalid end </%s> SGML: ***Ignoring end tag </%s> in SELECT block. SGML: ***Illegal end tag </%s> found. SGML: Found </%s> when expecting </%s>. </%s> ***assumed. SGML: Found </%s> when expecting </%s>. </%s> ***Ignored. SGML: Continue with other content model for <%s> SGML: Extra end tag </%s> found and ignored. SGML: End </%s> <- %s start <%s> SGML: Still open %s <- ***invalid start <%s> SGML: Still open %s <- ***ignoring start <%s> SGML: Still open %s, ***converting invalid <%s> to </%s> SGML: ***Faking SELECT end tag before <%s> start tag. SGML: ***Ignoring start tag <%s> in SELECT block. ../../../WWW/Library/Implementation/SGML.cUCTransUniChar returned 0x%.2lX:'%c'. SGML: Found PI in PCDATA, junking it until '>' SGML_character: Handling 'zwnj' entity as 'WBR' element. SGML_character: Handling '8204' (zwnj) reference as 'WBR' element. SGML_character: Ignoring '%s%s'. SGML: Found PI, looking for '>' SGML: *** Unknown element "%s" SGML Entity Declaration: <%s> SGML Element Declaration: <%s> SGML Attribute Declaration: <%s> SGML Do%s ignore_when_empty:%s SGML: Unknown attribute %s for tag %s SGML: `</%s%c' found! Ignoring it. SGML: ***Faking SELECT end tag before </%s> end tag. SGML: `</%s%c' found! Treating as '<%s%c'. SGML Processing instruction: <%s> SGML_write found UCS-2 LE BOM SGML_write found UCS-2 BE BOM <HTML><HEAD><TITLE>source</TITLE></HEAD><BODY><PRE>strictABBRACRONYMAPPLETARTICLEASIDEAUAUTHORBASEFONTBDOBGSOUNDBIGBLINKBODYTEXTCAPTIONCITECOLCOLGROUPCREDITDDDELDFNDIVEMBEDFIELDSETFIGUREFOOTERFRAMESETHEADERIFRAMEINPUTINSISINDEXKBDKEYGENLABELLEGENDLHLIMARQUEEMATHMETANAVNEXTIDNOFRAMESOVERLAYPLAINTEXTSAMPSCRIPTSECTIONSHYSMALLSPOTSTRIKESTRONGSUBSUPTABLETBODYTEXTFLOWTFOOTTHEADTTVARWBRCLASSCLEARCOMPACTDINGBATCHAROFFDPNOWRAPVALIGNACCEPT-CHARSETACCESSKEYCOLSDISABLEDNOTABONBLURONCHANGEONFOCUSONSELECTREADONLYTABINDEXAXESAXISBACKGROUNDCOLSPANROWSPANSCOPECELLPADDINGCELLSPACINGCOLSPECNOFLOWRULESSUMMARYUNITSINDENTMEDIANOTATIONMULTIPLEDEFEREVENTFORLANGUAGESCRIPTENGINEACCEPTACCEPT-ENCODINGDATAVALUEVALUEREFVALUETYPESELECTEDSHAPECONTINUESEQNUMSTARTARCHIVECLASSIDCODEBASECODETYPEDECLAREHSPACESHAPESSTANDBYVSPACEROLECONTENTHTTP-EQUIVSCHEMEHREFLANGRELTARGETSKIPCHALLENGEPROMPTALTCHECKEDMAXLENGTHMINLONGDESCFRAMEBORDERMARGINHEIGHTMARGINWIDTHSCROLLINGNOSHADEONLOADONUNLOADNORESIZEENCTYPEMETHODONRESETONSUBMITSUBJECTFACEPARAMSDATETIMEALINKBGCOLORVLINKLOOPCOORDSNOHREFi18ncellaligneventsGEN5bgcolorONCLICKONDBLCLICKONKEYDOWNONKEYPRESSONKEYUPONMOUSEDOWNONMOUSEMOVEONMOUSEOUTONMOUSEOVERONMOUSEUPHTMLDTD: Copying %s DTD element info of size %d, %d * %d creation of chunkHTChunkCreate2HTChunkCreate2 dataHTChunkReallocHTChunkEnsure../../../WWW/Library/Implementation/HTChunk.cHTChunkCreate2: requested %d, allocate %u HTPlain_write: Ignoring '%lX'. ../../../WWW/Library/Implementation/HTPlain.cHTPlain_newPlainPresenter"CSSTRIM:%s -> %d (undefined) %s CSS:%s -> %d ca=%d CSSTRIM:link=%s HTMLGenerator<HTML> <BODY> <PRE> PlainToHTMLplaintexttoHTMLHTMLGenSTYLE:end_element: ending non-EMPTY style CSSTRIM: start_element: top <%s> STYLE:begin_element:ending EMPTY element style ../../../WWW/Library/Implementation/HTMLGen.cHTAtom_for../../../WWW/Library/Implementation/HTAtom.cStages %s*%s%d:%d:%sHTParentAnchor_newHTParentAnchor0_newHTChildAnchor_newHText_pool_ChildAnchor_new (internal link)Entered HTAnchor_findAddress Old title was "%s". Old title was NULL. HTAnchor_getUCInfoStage_setUCInfoStage_resetUCInfoStage../../../WWW/Library/Implementation/HTAnchor.cAnchor %p with address `%s' already exists. New anchor %p has hash %d and address `%s' Child anchor %p of parent %p with name `%s' already exists. HTAnchor: New Anchor %p named `%s' is child of %p HTAnchor_findNamedChild called with NULL parent. HTAnchor_addChild called with NULL parent. HTAnchor: New unnamed Anchor %p is child of %p Entered HTAnchor_findChildAndLink: tag=`%s',%s href=`%s' *** Duplicate ChildAnchor %p named `%s', different dest %p or type, creating unnamed child Linking child %p to anchor %p *** child anchor already has destination, exiting! SourceCache: Removing file %s SourceCache: Removing memory chunk %p HTAnchor_setTitle: New title is NULL! file://localhostHTStyleNewHTStyleSheetNew../../../WWW/Library/Implementation/HTStyle.cStyleSheet: No style named `%s' HTList_new%p, node %p, list %p HTList_addObjectHTList_addObjectAt../../../WWW/Library/Implementation/HTList.cHTList: Trying to append list %p to a nonexisting list *** HTList: Refuse linking already linked obj HTList: Trying to link object %p to a nonexisting list HTList: Trying to add object %p to a nonexisting list HTList: Treating negative object position %d as %d. HTAlloc\r\t\f\%03oHTSACopyHTSACatPARAM-ADD:%s HTSACopy_extra ;,=\&#$^*?(){}<>"';`|HTQuoteParameterPARAM-EXP:%s PARAM-END:%s HTSABAllocHTSABCopy(%p, %p, %d) === %4d:HTSABCopy=> %4d:HTSABCat(%p, %p, %d) 2.14../../../WWW/Library/Implementation/HTString.cHTAddRuleRule: For `%s' op %d `%s'Rule: For `%s' op %d %s %s DEFAULTProtectNULL!!DefProtRule: %sunlessredirecteduserspecrule, setupshow rule message:Rule alert:HTRule: Pass `%s' For `%s' using `%s' %.*s%.*s%sHTRule: ...and pass `%s' For `%s' will not use proxy HTRule: *** FAIL `%s' defprotprotectInsufficient operands:HTRule: %s %s presentationhtbinbindirpassfailredirectredirectpermredirecttemppermitredirectionuseproxyalwaysalertprogressusermsginfomsgBad ruleHTRule: %s '%s' 301permanent302303seeotheruserspecified../../../WWW/Library/Implementation/HTRules.c....... rule ignored, unrecognized `%s'! ....... rule ignored, unrecognized `%s %s'! HTRule: `%s' matched %s %s: `%s' HTRule: Mark for redirection permitted HTRule: ...and redirect to `%s' HTRule: ...and redirect like 301 to `%s' For `%s' proxy server ignored: %s HTRule: proxy server found: %s Rule: Ignoring `%s' in Redirect HTRules: Can't open rules file %s ��������������/��/�����/��;�����������R��HTFormat: Looking up presentation for %s to %s FindPresentation: found exact match: %s -> %s StreamStack: found strong wildcard match: %s -> %s HTFormat: comparing %s and %s for half match StreamStack: found strong subtype wildcard match: %s -> %s StreamStack: found weak wildcard match: %s ../../../WWW/Library/Implementation/HTFormat.cHTSetPresentation rep=%s, command=%s, test=%s, qual=%f HTSetConversion rep_in=%s, rep_out=%s, qual=%f HTFormat: Interrupted in HTGetCharacter HTFormat: Interrupted in HTGetSSLCharacter StreamStack: Constructing stream stack for %s to %s (%s) StreamStack: found exact match: %s -> %s StreamStack: Returning *unknown* stream! HTFilterPresentations (AcceptMedia %#x) HTFormat: Evaluating stream stack for %s worth %.3f to %s HTZzFileCopy inflateInit() %s HTZzFileCopy inflateReset() %s HTCopy: Unexpected server disconnect. Treating as completed. HTCopy read %ld header bytes (%d extra vs %d total) HTCopy copied %ld actual, %ld limit HTFormat: Read error, read returns %d HTFormat(in HTParseGzFile): %s HTGzFileCopy: Read error, gzread returns %d gzclose gzclose : error number %d HTSetPresentationrepresentation != NULLHTSetConversionHTFormat: File read error %d HTFormat: SSL_read error %d StreamStack: Using %s StreamStack: Returning "%s" StreamStack: Returning NULL! match %s %s 1.2.11HTZzFileCopy inflate() %s NETREADUnexpected server disconnect.Unexpected read error.Reading headers...HTCopy read %ld header bytes Data transfer completeHTFormat: %s HTFormat(in HTParseFile): %s HTFormat(in HTParseMem): %s gzerror : %s gzerror NetToTextErrorStream. Created ErrorStreamHTSetPresentation��I�P NOTcontent is%s compressed Begin pumpData ...address{%s} HTMIME: Can't translate! ** Refresh: %s seconds <a href="%s%s">%s</a><br>URL %s%s HTMIME: PICKED UP Age: '%s' Ignoring it! HTMIME: PICKED UP Date: '%s' HTMIME: PICKED UP ETag: %s HTMIME: PICKED UP Link: '%s' HTMIME: PICKED UP Safe: '%s' chunkedHTMIME: PICKED UP URI: '%s' HTMIME: PICKED UP Vary: '%s' HTMIME: PICKED UP Via: '%s' eep-alive:HTMIME length %ld cept-ranges:'g' or 'l'ernates:'l' or 't'che-control:'a' or 'o'kie:'n' or 'o'ent-'n' or 't'ag:'t' or 'x'st-modified:cation:'a', 'i' or 'o'blic:'r' or 'u'gma:xy-authenticate:HTMIME: Was R, found E resh:ry-after:'f' or 't'fe:'a' or 'e'-cookie'r' or 't'':' or '2'ansfer-encoding:'i' or 'r'grade:'p' or 'r''a' or 'i'w-authenticate:'a' or 'w'HTMIME: in case CONTENT_ ase:isposition:eatures:d5:ange:HTMIME: in case CONTENT_L HTMIME: in case CONTENT_T Server Content-Type:%s HTMIME: %.*s HTMIME: %s HTMIMEConvert HTMIMEConvertdefault Content-Type is %s HTmmdecode=?ISO-2022-JP?B?=?ISO-2022-JP?Q?HTmmdec_base64HTmmdec_quoteHTrjisMIMEParserreinterpreting as content-type:%s, encoding:%s HTMIME: Extended MIME Content-Type is %s ...pumpData finished reading header HTTP: 'Location:' is zero-length! Got redirection with a bad Location header.HTTP: Failed to pick up location. Got redirection with no Location header.HTMIME: MIME Content-Type is '%s', converting to '%s' HTMIME: MIME Content-Type is '%s', Treating as '%s'. Converting to '%s' Formatting refresh-url as first line of result ...end of pumpData, copied %ld vs %ld HTIME_put_character expected LF in chunked data HTMIME: PICKED UP Accept-Ranges: '%s' HTMIME: PICKED UP Allow: '%s' HTMIME: PICKED UP Alternates: '%s' HTMIME: PICKED UP Cache-Control: '%s' HTMIME: PICKED UP Cookie: '%s' HTMIME: PICKED UP Connection: '%s' HTMIME: PICKED UP Content-Base: '%s' HTMIME: PICKED UP Content-Disposition: '%s' HTMIME: PICKED UP Content-Encoding: '%s' HTMIME: PICKED UP Content-Features: '%s' HTMIME: PICKED UP Content-Language: '%s' HTMIME: PICKED UP Content-Length: '%s' Converted to integer: '%ld' HTMIME: PICKED UP Content-Location: '%s' HTMIME: PICKED UP Content-MD5: '%s' HTMIME: PICKED UP Content-Range: '%s' HTMIME: PICKED UP Content-Transfer-Encoding: '%s' HTMIME: PICKED UP Content-Type: '%s' HTMIME: PICKED UP Expires: '%s' HTMIME: PICKED UP Keep-Alive: '%s' HTMIME: PICKED UP Last-Modified: '%s' HTMIME: PICKED UP Location: '%s' HTMIME: *** Ignoring Location! HTMIME: PICKED UP Pragma: '%s' HTMIME: PICKED UP Proxy-Authenticate: '%s' HTMIME: PICKED UP Public: '%s' HTMIME: PICKED UP Refresh: '%s' HTMIME: PICKED UP Retry-After: '%s' HTMIME: PICKED UP Server: '%s' HTMIME: PICKED UP Set-Cookie: '%s' HTMIME: PICKED UP Set-Cookie2: '%s' HTMIME: PICKED UP Title: '%s' HTMIME: PICKED UP Transfer-Encoding: '%s' HTMIME: PICKED UP Upgrade: '%s' HTMIME: PICKED UP Warning: '%s' HTMIME: PICKED UP WWW-Authenticate: '%s' HTMIME: Got 'A' at beginning of line, state now A HTMIME: Got 'C' at beginning of line, state now C HTMIME: Got 'D' at beginning of line, checking for 'ate:' HTMIME: Got 'E' at beginning of line, state now E HTMIME: Got 'K' at beginning of line, checking for 'eep-alive:' HTMIME: Got 'L' at beginning of line, state now L HTMIME: Got 'P' at beginning of line, state now P HTMIME: Got 'R' at beginning of line, state now R HTMIME: Got 'S' at beginning of line, state now S HTMIME: Got 'T' at beginning of line, state now T HTMIME: Got 'U' at beginning of line, state now U HTMIME: Got 'V' at beginning of line, state now V HTMIME: Got 'W' at beginning of line, state now W HTMIME: Was A, found C, checking for 'cept-ranges:' HTMIME: Was A, found G, checking for 'e:' HTMIME: Was A, found L, state now AL' HTMIME: Bad character `%c' found where `%s' expected HTMIME: Was AL, found L, checking for 'ow:' HTMIME: Was AL, found T, checking for 'ernates:' HTMIME: Was C, found A, checking for 'che-control:' HTMIME: Was C, found O, state now CO' HTMIME: Was CO, found N, state now CON HTMIME: Was CO, found O, checking for 'kie:' HTMIME: Was CON, found N, checking for 'ection:' HTMIME: Was CON, found T, checking for 'ent-' HTMIME: Was E, found T, checking for 'ag:' HTMIME: Was E, found X, checking for 'pires:' HTMIME: Was L, found A, checking for 'st-modified:' HTMIME: Was L, found I, checking for 'nk:' HTMIME: Was L, found O, checking for 'cation:' HTMIME: Was P, found R, state now PR' HTMIME: Was P, found U, checking for 'blic:' HTMIME: Was PR, found A, checking for 'gma' HTMIME: Was PR, found O, checking for 'xy-authenticate' HTMIME: Was RE, found F, checking for '%s' HTMIME: Was RE, found T, checking for '%s' HTMIME: Was S, found A, checking for 'fe:' HTMIME: Was S, found E, state now SE' HTMIME: Was SE, found R, checking for 'ver' HTMIME: Was SE, found T, checking for '-cookie' HTMIME: Was SET_COOKIE, found :, processing HTMIME: Was SET_COOKIE, found 2, checking for ':' HTMIME: Was T, found I, checking for 'tle:' HTMIME: Was T, found R, checking for 'ansfer-encoding' HTMIME: Was U, found P, checking for 'grade:' HTMIME: Was U, found R, checking for 'i:' HTMIME: Was V, found A, checking for 'ry:' HTMIME: Was V, found I, checking for 'a:' HTMIME: Was W, found A, checking for 'rning:' HTMIME: Was W, found W, checking for 'w-authenticate:' HTMIME: Was CONTENT_, found B, checking for 'ase:' HTMIME: Was CONTENT_, found D, checking for 'isposition:' HTMIME: Was CONTENT_, found E, checking for 'ncoding:' HTMIME: Was CONTENT_, found F, checking for 'eatures:' HTMIME: Was CONTENT_, found L, state now CONTENT_L HTMIME: Was CONTENT_, found M, checking for 'd5:' HTMIME: Was CONTENT_, found R, checking for 'ange:' HTMIME: Was CONTENT_, found T, state now CONTENT_T HTMIME: Was CONTENT_, found nothing; bleah HTMIME: Was CONTENT_L, found A, checking for 'nguage:' HTMIME: Was CONTENT_L, found E, checking for 'ngth:' HTMIME: Was CONTENT_L, found O, checking for 'cation:' HTMIME: Was CONTENT_L, found nothing; bleah HTMIME: Was CONTENT_T, found R, checking for 'ansfer-encoding:' HTMIME: Was CONTENT_T, found Y, checking for 'pe:' HTMIME: Was CONTENT_T, found nothing; bleah Server Headers (%d bytes): %.*s HTMIME: *** Syntax error. (string too long) ../../../WWW/Library/Implementation/HTMIME.c���(���:���i���v���]���������������������������������������u�������������Z������.����������������������������������������������������������������������������������������0�������������������M������������������Q���������������������������������������� ����������������������������������t�������k���M�������p���p���g��p���p������p������p���>��p�����p���p���p���p������p���p���p���p���p������p���p���p�������p���p���p������p���p���p����������p���p���p���|���1���p���p�����p���5��p���h���p���p������p���p�������p���p����p���p�������p���p���z����������;��X�������O������������������������������������������������������������������������������������������������������������������������������������������������������������������������������K��u����������������������������������R�����������(�������n�����������������������������������K��u����������������������������������R�����������(�������n���� ��x�����C�� �� �� �� �� �����^�� �� �� �� ��)�� ����� �� �� �� �� �� �� �� �� �� �� �� �� ���� ��x�����C�� �� �� �� �� �����^�� �� �� �� ��)�� ��������������W���������'��������������������a��t�����<������@��k���������������]!�� !��� ������e ��A"�� "������w"��)���#�����������#��- �������������N#��#������n������4������f��!����������������y��A������ ������������a��J�� ���������� �� �� �� �� ��'����� �� �� �� ��e�� ����� �� �� �� �� �� �� �� �� �� �� �� �� ��J�� ���������� �� �� �� �� ��'����� �� �� �� ��e�� �����D.��D.��l.���.��$/��4/���.���.��/��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��/��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��D.��\.��HTNews: EOF on read, closing socket %d Network Error: connection lost Network Error: connection lostHTNews: Unable to send command. Disconnecting. HTNews: Interrupted on read, closing socket %d Trying to find address in: %s HTNews: NNTPSERVER defined as `%s' HTNews: File %s defines news host as `%s' HTNews: Proxy command is '%.*s' News: doing HTDoConnect on '%s' HTNews: Interrupted on connect; recovering cleanly. HTNews: Unable to connect to news host. HTNews: Connected to news host %s. HTNews: Unable to complete SSL handshake for '%s', SSL_connect=%d, SSL error stack dump follows Secure %d-bit %s (%s) NNTP connectionHTNews: Proxy command returned status '%d'. Can't read news info. News host %.20s responded: %.200sCan't read news info, empty response from host %sCannot open temporary file for news POST.Reading list of available newsgroups.HTNews..... group name too long, discarding. Reading list of articles in newsgroup.Newsgroup status=%d, count=%d, (%d-%d) required:(%d-%d) NNTP command to be sent: %sNNTP Response: %s .newsauthUsername for news host '%s':AUTHINFO USER %.*s%c%cConnection closed ???Change username?Username:Password for news host '%s':AUTHINFO PASS %.*s%c%cChange password?%s%.*sH %s SUBJECT:DATE:ORGANIZATION:FROM:REPLY-TO:NEWSGROUPS:REFERENCES:FOLLOWUP-TO:MESSAGE-ID:No SubjectFrom:Reply to:Trying to find name in: %s Organization:Newsgroups:posterFollowup to:snewsreply://newsgroupsnewsgroupReferences:B %s ,>)"rticle <newreplyHTNews: Looking for %s /usr/local/lib/rn/server%s://%.*s/%s//%.*s/%s//%.250s/news://%.*s/%s//%.*sGET %.*s%c%c%c%cURL too longGROUP %.*sARTICLE %s%.*s%sARTICLE No target for raw text!lose://%.*s/Connecting to NewsHost ...NNTPSNNTPCould not access %s.HTNews: SSL: %s Cannot POST to this host.mode reader%c%c No such group ARTICLE < No such articleXGTITLELIST NEWSGROUPS%c%cuthenticatNewsgroupsb %.*s%c[...] No matches for: %s%s %d%c%cNewsgroup %d %d %d %d No articles in this group.
No articles in this range. Chunk will be (%d-%d) %s, Articles %d-%d%s%s/%d-%d Block before is %s Earlier articlesAll available articles in Articles in HEAD %d%c%cG %s [%.*s]Status:Status (ARTICLE %d): Block after is %s Later articlessnewspost://Post to Reading news article.XGTITLE %.*s����<���<���<���<���<���<���<���<���<���<���<���<���<���<���<���<���<���<���<���<���<���L���<���Ĉ��<���<���<���<���<���<�������<���<���<���<���<���t���<���<���<���<���<���<���<���<���<���<���<���<���<���<���<���<���L���<���Ĉ��<���<���<���<���<���<�������<���<���<���<���<���t���From: anonymous@nowhere.you.knowCSO Search ResultsHTGopher: adding URL: %s HTLoadGopher%s//%s/%s//%s@%s/Gopher MenuHTGopher: Menu item: %s (HTML) (TEL) (3270) (FILE) (DIR) (+++) (CSO) (BIN) (UUE) (?) (IMG) (SND) (HQX) (MIME) (MOV) (PDF) (UNKN) //%s/%cgopher://error.host:1/0 checked$(NEXTFLD)HTLoadCSO: Looking for %s fields%c%c' to socket %d Sending CSO/PH request.sendHTLoadCSOindexed default public lookup url max No response from server!$(FID)$(FDESC)%.2046s$(FDEF)$(FNDX)$(FSIZE) size=%d maxlength=%d$(FSIZE2)$(QFIELDS)$(RFIELDS)$(NAMEFLD)$(HOST)$(PORT)content != NULL%d=query %s="%s"return=selected return all returnHTLoadCSO: Writing command `</DL></DL> <DD>%s <DT><I>%s</I><DD>Seek fail on %s HTGopher: Looking for %s :105/2:79/0Gopher indexCSO indexhURL:Sending Gopher request.www/unknown <DD> </DL> </DL> <P><DL> <DT>Output format:$(NEXTFLD) ../../../WWW/Library/Implementation/HTGopher.cHTGopher: Interrupted in HTGetCharacter, apparently. HTGopher: Bad menu item (type %d, port %s). abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789./-_$<HTML> <HEAD> <TITLE>CSO/PH Query Form for $(HOST)</TITLE> </HEAD> <BODY>HTLoadCSO: Interrupted on connect; recovering cleanly. HTLoadCSO: Unable to connect to remote host for `%s'. HTLoadCSO: Connected, writing command `HTLoadCSO: Unable to send command. CSO/PH request sent; waiting for response.HTLoadCSO: Interrupted in HTGetCharacter, apparently. <HTML> <HEAD> <TITLE>CSO/PH Results on %s</TITLE> </HEAD> <BODY> <HR><DL><DT>Information/status<DD><DL><DT> <HR><DL><DT>Entry %d:<DD><DL COMPACT><DT> <DT><I>%s</I><DD><A HREF="%s">%s</A> HTGopher: Passing to CSO/PH gateway. HTGopher: Passing to finger gateway.
This is a searchable Gopher index.
Please enter search keywords.
This is a searchable index of a CSO database.
Press the 's' key and enter search keywords.
The keywords that you enter will allow you to search on a person's name in the database. gopher found link to URL '%s' HTGopher: Interrupted on connect; recovering cleanly. HTGopher: Unable to connect to remote host for `%s'. HTGopher: Connected, writing command `%s' to socket %d HTGopher: Unable to send command. Gopher request sent; waiting for response.<H2><I>CSO/PH Query Form</I> for <EM>$(HOST)</EM></H2>To search the database for a name, fill in one or more of the fieldsin the form below and activate the 'Submit query' button. At leastone of the entered fields must be flagged as indexed.<HR><FORM method="POST" action="cso://$(HOST)/">[ <input type="submit" value="Submit query"> | <input type="reset" value="Clear fields"> ] <DT>Search parameters (* indicates indexed field):$(NAMEFLD) <DL COMPACT> <DT><I>$(FDESC)</I>$(FNDX) <DD>Last: <input name="q_$(FID)" type="text" size=49$(FSIZE2)> <DD>First: <input name="q_$(FID)" type="text" size=48$(FSIZE2)>$(QFIELDS) <DT><I>$(FDESC)</I>$(FNDX) <DD><input name="q_$(FID)" type="text" $(FSIZE)> $(NEXTFLD) <DD>Returned data option: <select name="return"> <option>default<option selected>all<option>selected</select><BR>$(RFIELDS) <input type="checkbox" name="r_$(FID)"$(FDEF)> $(FDESC)<BR> </DL></FORM><HR> </BODY> </HTML>����#���#���#���#���������������#���s���{���W���I���#���{�����������#���#���#���#���#���#���#���#���#���#���#���Ǥ�����#���#���#���#���#���#�������#���#���#���#���#���#���#���#���#���#���#���#���#���#���#���#���#���#���#���#���#���#������Ǥ��#���#���#���#���e���#���#���#���#���#��������}�������������}�������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������</BODY> </HTML> HTLoadCSO0123456789abcdefWarning: non-lookup field ignore<EM>Error:</EM> At least one indexed field value must be specifi</BODY> </HTML> <H2> <EM>CSO/PH -l HTTelnet: No host specified! remote %s session:Invalid hostname %s, password %s, port %s%s %s%s%sto host %s, user name %sHTTelnet: Can't output a live session -- must be interactive! HTTelnet: Invalid hostname %s! When you are connected, log in as: %s The password is: %s
Sorry, but the service you have selected is oneto which you have to log in. If you were running wwwon your own computer, you would be automatically connected.For security reasons, this is not allowed whenyou log in to this information service remotely. You can manually connect to this service using %s HTFinger command to be sent: %sHTFinger: Unable to send command. Disconnecting. HTFinger: Reading finger information HTFinger: Interrupted in HTGetCharacter, apparently. Could not load data (no sitename in finger URL)Invalid port number - will only use port 79!HTFinger: doing HTDoConnect on '%s' HTFinger: Done DoConnect; status %d HTFinger: Interrupted on connect; recovering cleanly. HTFinger: Unable to connect to finger host. HTFinger: Connected to finger host '%s'. No response from finger server.Finger server on HTFinger: Looking for %s Could not load data.lose://%s//w %s%c%c/%s%c%cCould not access finger host. NOT GIVEN in source file; ip-address.src WAIS source file descriptionAccess links%s//%s%s%s/%sDirect accessMaintainerHostHTWSRCConvertWSRCParserip-nametcp-portdatabase-namecostcost-unitfreemaintainerkeyword-listwindow-geometryupdate-timecontact-atlast-contactedconfidencenum-docs-to-requestfontfont-sizeHTWSRC: Unknown field `%s' in source file (or via proxy server, if defined)../../../WWW/Library/Implementation/HTWSRC.c��������������%s %s (%s:%d:%s) matched templateHTAASetup_lookup:%s `%s' %s `%s' did NOT match template(so probably not protected)%s `%s' %s HTAASetup_newHTAAServer_newHTAAForwardAuth_setnot found -- creatingcompose_auth_string: realm:HTAARealm_newcompose_auth_stringHTAA_composeAuth: %s %s `%s'HTAA_composeAuthServer reply header lines: in Proxy-Authenticate: fieldin WWW-Authenticate: fieldProxy-Authenticate:Invalid header '%s%s%s%s%s'HTAA_shouldRetryWithAuthUnknown scheme `%s' %s Authorization failed. Retry?WWW-Protection-Template:WWW-Authenticate:HTAASetup_lookup: resolving setup forHTAASetup_lookup: No template matched../../../WWW/Library/Implementation/HTAABrow.cusername for realm %s changed from %s to %spassword for realm %s user %s changedUsername for '%s' at %s '%s%s':Forwarding received authorizationComposing Proxy Authorization for %s:%d/%s This client doesn't know how to compose proxy authorization information for schemeComposing Authorization for %s:%d/%s This client doesn't know how to compose authorization information for schemeProtection template set to `%s' Invalid header line `%s' ignored Proxy authorization required -- retryingAccess without authorization denied -- retryingAuthorization: Proxy-AuthorizatnogroupnobodyHTAAProt_new: Protection file%s `%s' already in cache HTAAProt_newauthentication scheme:HTAA_parseProtFile: valid%s %s `%s' HTAA_parseProtFile: unknownHTAA_parseProtFile: Name%s `%s' bound to value `%s' %s %s %d (that line ignored) HTAAProt_new: %s `%s' -- using default protectionHTAA_UidToName: getpwuid%s(%d) returned (%s:%d:...) HTAA_NameToUid: getpwnam%s(%s) returned (%s:%d:...) HTAA_GidToName: getgrgidHTAA_NameToGid: getgrnamHTAAProt_new: Loading protection file `%s' ../../../WWW/Library/Implementation/HTAAProt.cHTAA_parseProtFile: Mask group: HTAA_parseProtFile: Mask group syntax error in protection setup file at lineHTAA_parseProtFile: Syntax errorUnable to open protection setup filenot specified (obligatory for DefProt rule)!! HTAA_setDefaultProtection: ERROR: Protection filenot specified for Protect ruleHTAA_setCurrentProtection: Protection filedefault protection is not set!!file not specified for Protect rule, andHTAA_setCurrentProtection: ERROR: ProtectionHTAssoc_add../../../WWW/Library/Implementation/HTAssoc.cHTAssoc_add: ERROR: assoc list NULL!! ��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������0�����������������������������������������������������������������������������������������@��P��������`�����������������������������������������p������������������������������ ��0��@��P��`�����UNKNOWN-LEX-ITEMNO-LEX-ITEMrecord separator (newline)field separator ':'item separator ',''('')'address qualifier '@'end-of-filealphanumeric string '%.*s'template string '%.*s'ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/BASICPUBKEYKERBEROSV4KERBEROSV5THIS-IS-A-BUGPubkeyKerberosV4KerberosV5BasicHTAA_setupReader���P�����X��h��x��make_template: made template `%s' for file `%s' ../../../WWW/Library/Implementation/HTAAUtil.cwith function HTAA_setupReader()HTAA_getUnfoldedLine: buffer not initializedHTGroup.c: Syntax error in rule file at line%s %d before: '%s' HTGroup.c: %s (got %s) Expecting a single name or '(' beginning list../../../WWW/Library/Implementation/HTGroup.cExpecting ')' closing user/group listExpecting a single address or '(' beginning listExpecting ')' closing address listExpected address part (single address or list)Garbage after group definitionparse_user_partExpecting user or group nameparse_address_partExpecting an address templateEmpty item not allowedparse_itemHTAA_parseGroupDef*REF* NULL RECORD