������ !"#$%&'()*+,-./0123ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=new tunnel state 'connect'new tunnel state 'receive'new tunnel state 'response'CONNECT phase completednew tunnel state 'failed'closedestroyallocate connect bufferCONNECT startCONNECT sendCONNECT receiveProxy CONNECT abortedchunk reading DONECONNECT response too largeIgnore chunked response-bodyWWW-Authenticate:Proxy-authenticate:CONNECT: fwd auth header '%s'Content-Length:Transfer-Encoding:CONNECT responded chunkedProxy-Connection:HTTP/1.CONNECT responseConnect me again pleaseCONNECT need to close+openH1-PROXYnew tunnel state 'established'%s cannot be done over CONNECTProxy CONNECT aborted due to timeoutEstablish HTTP proxy tunnel to %sFailed sending CONNECT to proxyProxy CONNECT connection closedIgnore %ld bytes of response-bodyCONNECT: no content-length or chunkedIgnoring Content-Length in CONNECT %03d responseIgnoring Transfer-Encoding in CONNECT %03d responseCONNECT tunnel failed, response %dCONNECT tunnel established, response %dpV��V���U���U��0U���T��]V���U���U��hU��U���T��[0] %zu bytes to nghttp2 -> %zdprocess_pending_input: nghttp2_session_mem_recv() returned %zd:%s[0] all data in connection buffer processed[0] process_pending_input: %zu bytes left in connection buffer[0] process %zu bytes in connection buffer[0] read %zu bytes nw data -> %zd, %d[%d] proxy_h2_on_stream_close, %s (err %d)[0] nghttp2_session_send error (%s)%d[0] flush nw send buffer(%zu) -> EAGAIN[%d] REFUSED_STREAM, try again on a new connectionHTTP/2 stream %u was not closed cleanly: %s (err %u)[%d] handle_tunnel_close -> %zd, %d[%d] tunnel_recv(len=%zu) -> %zd, %d[%d] cf_recv(len=%zu) -> %zd %d[%d] header for non-tunnel stream: %.*s: %.*s[%d] tunnel_send_callback -> %zd[0] nw_in_reader(len=%zu) -> %zd, %d[0] conn alive -> %d, input_pending=%dHTTP/2 proxy, send again with decreased length[%d] remote flow window is exhausted[%d] cf_send(len=%zu) BLOCK: win %u/%zu blocked_len=%zu[0] send: nothing to do in this session[%d] cf_send(len=%zu) -> %zd, %d, h2 windows %d-%d (stream-conn), buffers %zu-%zu (stream-conn)[0] nw_out_writer(len=%zu) -> %zd, %dFRAME[DATA, len=%d, eos=%d, padlen=%d]FRAME[HEADERS, len=%d, hend=%d, eos=%d]FRAME[PRIORITY, len=%d, flags=%d]FRAME[RST_STREAM, len=%d, flags=%d, error=%u]FRAME[PUSH_PROMISE, len=%d, hend=%d]FRAME[GOAWAY, error=%d, reason='%s', last_stream=%d][%d] rcvd FRAME not for tunnelCouldn't initialize nghttp2 callbacksnghttp2_submit_settings() failed: %s(%d)nghttp2_session_set_local_window_size() failed: %s(%d)Establish HTTP/2 proxy tunnel to %snghttp2_session_upgrade2() failed: %s(%d)[%d] send, nghttp2_submit_request error: %s[%d] new tunnel state 'connect'[%d] new tunnel state 'failed'[%d] new tunnel state 'response'[%d] new tunnel state 'established'[0] CONNECT: fwd auth header '%s'Failed receiving HTTP2 data[0] nw send buffer flushed[%d] DRAIN dselect_bits=%xHTTP/2 stream %u was reset[%d] increase window by %zd[%d] egress blocked, DRAIN:status[%d] status: HTTP/2 %03d[%d] header: %.*s: %.*sFailed sending HTTP2 dataFRAME[SETTINGS, ack=1]FRAME[SETTINGS, len=%d]FRAME[PING, len=%d, ack=%d]FRAME[WINDOW_UPDATE, incr=%d]FRAME[%d, len=%d, flags=%d][%d] <- %s[%d] got http status: %d[%d] -> %s%s%s%s:%dCouldn't initialize nghttp2[0] init proxy ctx -> %d[0] CONNECT start for %sWWW-AuthenticateProxy-Authenticate[%d] new tunnel state 'init'H2-PROXY�{���|��}��|��@|��h|���|��P{���{���������>����������TCP6TCP4PROXY UNKNOWN PROXY %s %s %s %i %i HAPROXYdata_pendingusing HTTP/3using HTTP/2using HTTP/1.xconnect, initconnect, check h21connect, all failedconnect -> %d, done=%dadjust_pollset -> %d socksHTTPS-CONNECTconnect+handshake %s: %dms, 1st data: %dmshard timeout of %dms reached, starting h21soft timeout of %dms reached, h3 has not seen any data, starting h21is_alive: poll error, assume deadis_alive: poll timeout, assume aliveis_alive: err/hup/etc events, assume deadis_alive: valid events, looks alivenw_in_read(len=%zu) -> %d, err=%dpartial read: empty buffer firstsocket successfully bound to interface '%s'Couldn't bind to interface '%s'Local Interface %s is ip %s using address family %iName '%s' family %i resolved to '%s' family %igetsockname() failed with errno %d: %sBind to local port %d failed, trying nextgetpeername() failed with errno %d: %sssrem inet_ntop() failed with errno %d: %sssloc inet_ntop() failed with errno %d: %ssa_addr inet_ntop() failed with errno %d: %sFailed to set SO_KEEPALIVE on fd %dFailed to set TCP_KEEPIDLE on fd %dFailed to set TCP_KEEPINTVL on fd %dImmediate connect fail for %s: %scf_udp_connect(), open failed -> %d%s socket %d connected: [%s:%d] -> [%s:%d]cf_udp_connect(), opened socket=%d (%s:%d)cf_udp_connect(), opened socket=%d (unconnected)Failed to enable TCP Fast Open on fd %dconnect to %s port %u from %s port %d failed: %saccepted_set(sock=%d, remote=%s port=%d)Recv failure: %srecv from bufferbuffered %zd additional bytesrecv(len=%zu) -> %d, err=%dSend failure: %ssend(len=%zu) -> %d, err=%dCould not set TCP_NODELAY: %scf_socket_close(%d)if!host!Couldn't bind to '%s'Local port: %hubind failed with errno %d: %s Trying %s:%d... Trying [%s]:%d...cf_socket_open() -> %d, fd=%dQUICUDPlocal address %s port %d...not connected yetCurl_conn_tcp_listen_set(%d)TCP-ACCEPTUNIXTCPrecv: no filter connectedsend: no filter connectedadded%u/%ld/%sConnection cache is full, closing the oldest oneipv4ipv6query connect reply: %dmsunsupported transport type %dConnection time-outcreated %s (timeout %ldms)%s done%s trying next%s starting (timeout=%ldms)all eyeballers failedSETUPHAPPY-EYEBALLShaproxy protocol not support with SSL encryption in place (QUIC?)%s connect timeout after %ldms, move on!%s connect -> %d, connected=%dConnection timeout after %ld ms%s assess started=%d, result=%dFailed to connect to %s port %u after %ld ms: %sError while processing content unencoding: %sError while processing content unencoding: Unknown failure within decompression software.Unrecognized content encoding type. libcurl understands %s content encodings.Reject response due to more than %u content encodings1.2.111.2.0.4identityce-errornonebrx-gzipdeflateFALSE#HttpOnly_%s%s%s %s %s %s %ld %s %sReplacedAdded; cookie contains TAB, dropping__Secure-__Host-securehttponlydomainversion expiresmax-age; =rbSet-Cookie:%s oversized cookie dropped, name/val %zu + %zu bytesinvalid octets in name/value, cookie droppedskipped cookie with bad tailmatch domain: %scookie '%s' for domain '%s' dropped, would overlay an existing cookie%s cookie %s="%s" for domain %s, path %s, expire %ldWARNING: failed to open cookie file "%s"ignoring failed cookie_init for %sIncluded max number of cookies (%zu) in request!# Netscape HTTP Cookie File # https://curl.se/docs/http-cookies.html # This file was generated by libcurl! Edit at your own risk.
WARNING: failed to save cookies in %s: %se�����������1��s��Y"��
%.*s. *�H��+KGS!@#$%/~//~ EXTERNALXOAUTH2PLAINOAUTHBEARERDIGEST-MD5CRAM-MD5SCRAM-SHA-1SCRAM-SHA-256Unsupported SASL authentication mechanism�X��$Y��Y���X���X��TY��DX��TW���Y��[��Z���W���Y���Z���Z���[��tZ��[%s] * < > { } { } default/MATCH:/M:/FIND:lookup word is missingFailed sending DICT request/DEFINE:/D:/LOOKUP:DICTCLIENT libcurl 8.5.0 MATCH %s %s %s QUIT CLIENT libcurl 8.5.0 DEFINE %s %s QUIT CLIENT libcurl 8.5.0 %s QUIT a DoH request is completed, %u to goFailed to encode DoH packet [%d]Content-Type: application/dns-messageDoH request %shttpsAAAAbad error codeCould not DoH-resolve: %sDoH: %s type %s for %sDoH Host name: %sTTL: %u secondsDoH A: %u.%u.%u.%uDoH AAAA: %s%02x%02xCNAME: %sBad labelOut of rangeLabel loopToo smallOut of memoryRDATA lengthMalformatBad RCODEUnexpected TYPEUnexpected CLASSNo contentBad IDName too long%.*s: %.*s CONNECT_ONLY is requiredFailed to get recent socketeasy handle already used in multi handleABSTRACT_UNIX_SOCKETACCEPTTIMEOUT_MSACCEPT_ENCODINGADDRESS_SCOPEALTSVCALTSVC_CTRLAUTOREFERERAWS_SIGV4CA_CACHE_TIMEOUTCERTINFOCHUNK_BGN_FUNCTIONCHUNK_DATACHUNK_END_FUNCTIONCLOSESOCKETDATACLOSESOCKETFUNCTIONCONNECTTIMEOUTCONNECTTIMEOUT_MSCONNECT_ONLYCONNECT_TOCONV_FROM_NETWORK_FUNCTIONCONV_FROM_UTF8_FUNCTIONCONV_TO_NETWORK_FUNCTIONCOOKIECOOKIEFILECOOKIEJARCOOKIELISTCOOKIESESSIONCOPYPOSTFIELDSCRLFCURLUCUSTOMREQUESTDEBUGDATADEBUGFUNCTIONDEFAULT_PROTOCOLDIRLISTONLYDISALLOW_USERNAME_IN_URLDNS_CACHE_TIMEOUTDNS_INTERFACEDNS_LOCAL_IP4DNS_LOCAL_IP6DNS_SERVERSDNS_SHUFFLE_ADDRESSESDNS_USE_GLOBAL_CACHEDOH_SSL_VERIFYHOSTDOH_SSL_VERIFYPEERDOH_SSL_VERIFYSTATUSDOH_URLEGDSOCKETERRORBUFFEREXPECT_100_TIMEOUT_MSFAILONERRORFILETIMEFNMATCH_DATAFNMATCH_FUNCTIONFOLLOWLOCATIONFORBID_REUSEFRESH_CONNECTFTPAPPENDFTPLISTONLYFTPPORTFTPSSLAUTHFTP_ACCOUNTFTP_ALTERNATIVE_TO_USERFTP_CREATE_MISSING_DIRSFTP_FILEMETHODFTP_RESPONSE_TIMEOUTFTP_SKIP_PASV_IPFTP_SSLFTP_SSL_CCCFTP_USE_EPRTFTP_USE_EPSVFTP_USE_PRETGSSAPI_DELEGATIONHAPPY_EYEBALLS_TIMEOUT_MSHAPROXYPROTOCOLHAPROXY_CLIENT_IPHEADERDATAHEADERFUNCTIONHEADEROPTHSTSHSTSREADDATAHSTSREADFUNCTIONHSTSWRITEDATAHSTSWRITEFUNCTIONHSTS_CTRLHTTP09_ALLOWEDHTTP200ALIASESHTTPAUTHHTTPGETHTTPHEADERHTTPPOSTHTTPPROXYTUNNELHTTP_CONTENT_DECODINGHTTP_TRANSFER_DECODINGHTTP_VERSIONIGNORE_CONTENT_LENGTHINFILEINFILESIZEINFILESIZE_LARGEINTERLEAVEDATAINTERLEAVEFUNCTIONIOCTLDATAIOCTLFUNCTIONIPRESOLVEKEEP_SENDING_ON_ERRORKRB4LEVELKRBLEVELLOCALPORTLOCALPORTRANGELOGIN_OPTIONSLOW_SPEED_LIMITLOW_SPEED_TIMEMAIL_AUTHMAIL_FROMMAIL_RCPTMAIL_RCPT_ALLLOWFAILSMAIL_RCPT_ALLOWFAILSMAXAGE_CONNMAXCONNECTSMAXFILESIZEMAXFILESIZE_LARGEMAXLIFETIME_CONNMAXREDIRSMAX_RECV_SPEED_LARGEMAX_SEND_SPEED_LARGEMIMEPOSTMIME_OPTIONSNETRCNETRC_FILENEW_DIRECTORY_PERMSNEW_FILE_PERMSNOBODYNOPROGRESSNOPROXYNOSIGNALOPENSOCKETDATAOPENSOCKETFUNCTIONPATH_AS_ISPIPEWAITPOST301POSTFIELDSIZEPOSTFIELDSIZE_LARGEPOSTQUOTEPOSTREDIRPREQUOTEPREREQDATAPREREQFUNCTIONPRE_PROXYPRIVATEPROGRESSDATAPROGRESSFUNCTIONPROXYAUTHPROXYHEADERPROXYPASSWORDPROXYPORTPROXYTYPEPROXYUSERNAMEPROXYUSERPWDPROXY_CAINFOPROXY_CAINFO_BLOBPROXY_CAPATHPROXY_CRLFILEPROXY_ISSUERCERTPROXY_ISSUERCERT_BLOBPROXY_KEYPASSWDPROXY_PINNEDPUBLICKEYPROXY_SERVICE_NAMEPROXY_SSLCERTPROXY_SSLCERTTYPEPROXY_SSLCERT_BLOBPROXY_SSLKEYPROXY_SSLKEYTYPEPROXY_SSLKEY_BLOBPROXY_SSLVERSIONPROXY_SSL_CIPHER_LISTPROXY_SSL_OPTIONSPROXY_SSL_VERIFYHOSTPROXY_SSL_VERIFYPEERPROXY_TLS13_CIPHERSPROXY_TLSAUTH_PASSWORDPROXY_TLSAUTH_TYPEPROXY_TLSAUTH_USERNAMEPROXY_TRANSFER_MODEQUICK_EXITRANDOM_FILEREDIR_PROTOCOLSREDIR_PROTOCOLS_STRREQUEST_TARGETRESOLVER_START_DATARESOLVER_START_FUNCTIONRESUME_FROMRESUME_FROM_LARGERTSPHEADERRTSP_CLIENT_CSEQRTSP_REQUESTRTSP_SERVER_CSEQRTSP_SESSION_IDRTSP_STREAM_URIRTSP_TRANSPORTSASL_AUTHZIDSASL_IRSEEKDATASEEKFUNCTIONSERVER_RESPONSE_TIMEOUTSHARESOCKOPTDATASOCKOPTFUNCTIONSOCKS5_AUTHSOCKS5_GSSAPI_NECSOCKS5_GSSAPI_SERVICESSH_AUTH_TYPESSSH_COMPRESSIONSSH_HOSTKEYDATASSH_HOSTKEYFUNCTIONSSH_HOST_PUBLIC_KEY_MD5SSH_HOST_PUBLIC_KEY_SHA256SSH_KEYDATASSH_KEYFUNCTIONSSH_KNOWNHOSTSSSH_PRIVATE_KEYFILESSH_PUBLIC_KEYFILESSLCERTPASSWDSSLENGINESSLENGINE_DEFAULTSSLKEYPASSWDSSL_CTX_DATASSL_CTX_FUNCTIONSSL_EC_CURVESSSL_ENABLE_ALPNSSL_ENABLE_NPNSSL_FALSESTARTSSL_SESSIONID_CACHESTDERRSTREAM_DEPENDSSTREAM_DEPENDS_ESTREAM_WEIGHTSUPPRESS_CONNECT_HEADERSTCP_FASTOPENTCP_KEEPALIVETCP_KEEPIDLETCP_KEEPINTVLTCP_NODELAYTELNETOPTIONSTFTP_BLKSIZETFTP_NO_OPTIONSTIMECONDITIONTIMEVALUE_LARGETRAILERDATATRAILERFUNCTIONTRANSFERTEXTTRANSFER_ENCODINGUNIX_SOCKET_PATHUNRESTRICTED_AUTHUPKEEP_INTERVAL_MSUPLOADUPLOAD_BUFFERSIZEUSERAGENTUSE_SSLVERBOSEWILDCARDMATCHWRITEHEADERWS_OPTIONSXFERINFODATAXFERINFOFUNCTIONXOAUTH2_BEARER0123456789abcdef
Couldn't open file %sCan't open %s for writingCan't get the size of %sContent-Length: %ld Can't get the size of file.Last-Modified: %s, %02d %s %4d %02d:%02d:%02d GMT %sfailed to resume file:// transferAccept-ranges: b%s%s.tmpapplication/octet-streammultipart/form-data������������8���������������X�������x���h�������������X���h������������������USER %sPBSZ %dPASS %sACCT %sAccess denied: %03dQUITMaximum file size exceededREST %ldConnect data stream passivelyFailed EPSV attempt, exitingPASVWe got a 421 - timeoutAPPE %sSIZE %sCould not seek streamFailed to read datagetsockname() failed: %sbind(port=%hu) failed: %ssocket failure: %s%s |%d|%s|%hu|,%d,%dWeirdly formatted EPSV replyBad PASV/EPSV response: %03dCan't resolve new host %s:%huConnecting to %s (%s) port %d;type=REST %dMDTM %sCWD %sNLSTPRET %sPRET STOR %sPRET RETR %sCouldn't set desired modeTYPE %cFTP response timeoutChecking for server connectprivatesecure login failedAuthentication successfulAUTH %sACCT rejected by server: %03dPROT %cSYSTEntry path is '%s'Failed to figure out pathOS/400SITE NAMEFMT 1QUOT command failed with %03dMKD %sFailed to MKD dir: %03dunsupported MDTM reply formatSkipping time comparisonThe file does not existCouldn't use RESTdisabling EPRT usageFailed to do PORTConnect data stream activelyMaxdownload = %ldGetting file with size: %ldRETR response: %03dFailed FTP upload: %0dWildcard - Parsing startedWildcard - START of "%s"ABORcontrol connection looks deadExceeded storage allocationNo data was receivedQUOT string not accepted: %sFTPSACCT requested but none availableFailure sending QUIT command: %sftp server doesn't support SIZEOffset (%ld) was beyond file size (%ld)File already completely downloadedInstructs server to resume from offset %ldFailed EPSV attempt. Disabling EPSVFile already completely uploadedfailed to resolve the address provided to PORT: %sbind(port=%hu) on non-local address failed: %sFailure sending EPRT command: %sFailure sending PORT command: %sbind() failed, we ran out of portsIllegal port number in EPSV replySkip %u.%u.%u.%u for data connection, reuse %s insteadCan't resolve proxy host %s:%huCouldn't interpret the 227-responseError accept()ing server connectConnection accepted from serverpath contains control charactersUploading to a URL without a file nameRequest has same path as previous transferGot a %03d response code instead of the assumed 200FTP response aborted due to select/poll error: %dAccept timeout occurred while waiting server connectThere is negative response in cache while serv connectError while waiting for server connectReady to accept data connection from serverCtrl conn has data while waiting for data connPreparing for accepting server on data portGot a %03d ftp-server response when 220 was expectedunsupported parameter to CURLOPT_FTPSSLAUTH: %dFailed to clear the command channel (CCC)Server denied you to change to the given directory%04d%02d%02d %02d:%02d:%02d GMTLast-Modified: %s, %02d %s %4d %02d:%02d:%02d GMT MDTM failed: file does not exist or permission problem, continuingThe requested document is not new enoughThe requested document is not old enoughPRET command not accepted: %03dData conn was not available immediatelyWildcard - "%s" skipped by userftp_perform ends with SECONDARY: %dRemembering we are in dir "%s"Failure sending ABOR command: %spartial download completed, closing connectionserver did not report OK, got %dUploaded unaligned file size (%ld out of %ld bytes)Received only partial file: %ld bytes��4�����H��H�������Z���������������������@��������������������"�p�a�s�s�������(�����x�����P���������������������������P���P������P���P������������P���P���P������������P������P���������������P������������������P���������������������������������������������������������������������������������P���������������������������������������������P���EPSVPASVEPRTPORT -> total rwx-tTsS0123456789-APM0123456789:<DIR>��������h�������x��p�����H��� ��> �� ��- ��� ��� ��� ��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��� ��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��*��� ��� ��� ��*��*��*��*��*��*��*��� ��*��*��*��� ��*��*��� ����' �� ��� ��� ��h �� ��T ��/etc/pki/tls/certs/ca-bundle.crt�����������������������������������������������������b�����P��>��,�����t�����������������������������������������������~�����������H��6��%����������������������������������������������� ��� ��� ��������{��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ��j��Y��H��7��&���������� ��� ��� ��� ��� ��������4��$�� �� �� �� �� ���� �� �� �� �� �� �� �� ����� �����������������������������������������������������������������u��������������������������d��S��B��������������������������������������������������1�����������������������������������~��p��X��8����������������k��������������K�� �������������������������������������������������������.A%s?%sFailed sending Gopher requestGOPHERSGOPHER\6:%uShuffling %i addresses(none)Host %s:%d was resolved.too many IP, can't showIPv6: %sIPv4: %s (non-permanent)RESOLVE *:%d using wildcard.onion.onion.127.0.0.1.localhost::1Could not resolve %s: %sHostname in DNS cache was stale, zappedHostname in DNS cache doesn't have needed family, zappedBad syntax CURLOPT_RESOLVE removal entry '%s'Resolve address '%s' found illegalCouldn't parse CURLOPT_RESOLVE entry '%s'RESOLVE %.*s:%d - old addresses discardedAdded %.*s:%d:%s to DNS cache%sNot resolving .onion address (RFC 7686)Hostname %s was found in DNS cachemax-age=includesubdomains%256s "%64[^"]"unlimited%s%s "%s" %d%02d%02d %02d:%02d:%02d# Your HSTS cache. https://curl.se/docs/hsts.html # This file was generated by libcurl! Edit at your own risk. %s%s "%d%02d%02d %02d:%02d:%02d" Rewind stream before next sendNTLM send, close instead of sending %ld bytesNEGOTIATE send, close instead of sending %ld bytesPlease rewind output before next send%s: %s, %02d %s %4d %02d:%02d:%02d GMT %s auth using %s with user '%s'The requested URL returned error: %dAuthentication problem. Ignoring this.Ignoring duplicate digest auth header.Malformatted trailing header, skipping trailerChunky upload is not supported by HTTP 1.0Content-Type: application/x-www-form-urlencoded Failed sending HTTP POST requestRestricted outgoing cookies due to header size, '%s' not sentContent-Range: bytes 0-%ld/%ld Content-Range: bytes %s%ld/%ld Could only read %ld bytes from the inputThe entire document is already downloadedHTTP server doesn't seem to support byte ranges. Cannot resume.Connection: %s%sTE TE: gzip Proxy-Connection: Keep-Alive HTTP/%s %s%s%s%s%s%s%s%s%s%s%s%supload completely sent off: %ld out of %ld bytesOverflow Content-Length: valueHTTP/1.0 proxy connection set to keep aliveHTTP/1.1 proxy connection set closeHTTP/1.0 connection set to keep aliveNegotiate: noauthpersist -> %d, header part: %sHTTP 1.0, assume close after bodyToo large response headers: %zu > %uReceived HTTP/0.9 when not allowedReceived 101, Switching to HTTP/2no chunk, no close, no size. Assume close to signal endConnection closure while negotiating auth (HTTP 1.0?)Got HTTP failure 417 while waiting for a 100Got HTTP failure 417 while sending dataHTTP error before end of send, keep sendingHTTP error before end of send, stop sendingKeep sending data to get tossed awayUnsupported HTTP/1 subversion in responseUnsupported HTTP version in responseUnsupported response code in HTTP responseUnsupported HTTP version (%u.%d) in responseLying server, not serving HTTP/2Empty reply from serverHTTP/RTSP/If-Modified-SinceIf-Unmodified-SinceLast-ModifiedInvalid TIMEVALUEProxy-NegotiateDigestBasicProxyServerBearerProxy-authorizationAuthorization%sAuthorization: Basic %s Authorization: Bearer %s Forcing HTTP/1.1 for NTLMExpectExpect:Expect: 100-continue Host:Content-Type:Authorization:User-AgentHostHost:%s Host: %s%s%s Host: %s%s%s:%d http;type=%cContent-TypeTransfer-Encoding: chunked Content-LengthFailed sending PUT requestContent-Length: 0
Failed sending POST request%x Failed sending HTTP request; CookieCookie: %s%s=%sRange: bytes=%s Content-RangeContent-Range: bytes %s/%ld Ignoring the response-bodySimulate an HTTP 304 responseAccept: */* Accept-EncodingRefererReferer: %s Accept-Encoding: %s Accept%s Alt-UsedAlt-Used: %s:%d Proxy-ConnectionInvalid Content-Length: valuekeep-aliveContent-Encoding:Retry-After:Content-Range:Last-Modified:Persistent-Auth:falseLocation:Strict-Transport-Security:Illegal STS header skippedAlt-Svc:Nul byte in headerHeader without colon:schemeset pseudo header %s to %s:method:authority:pathKeep-AliveHTTPSHTTP://%s %s%s%s%s HTTP/1.%d [%d] Queuing PRIORITY[0] egress: wrote %zd bytes[0] ingress: read %zd bytes[%d] RESET: %s (err %d)[%d] CLOSED[%d] returning CLOSE[%d] returning ERR[%d] DRAIN closed streamInternal NULL streamToo many PUSH_PROMISE headers[%d] trailer: %.*s: %.*s:status:%u HTTP/2 [%d] Data for unknownstream %u closed[HTTP/2] [%d] [%.*s: %.*s][%d] submit -> %zd, %d (via h1 upgrade)created session via Upgrade[0] created h2 session%scf_connect() -> %d, %d, [%d] data done sendnghttp2/%s[0] ENABLE_PUSH: %s[%d] No Curl_easy associated[%d] No stream_ctx set[%d] PUSH_PROMISE receivedfailed to duplicate handleerror setting up stream: %dfailed to add handle to multiGot PUSH_PROMISE, ignore ith2cprocess_pending_input: %zu bytes left in connection buffernghttp2_session_send error (%s)%dflush nw send buffer(%zu) -> EAGAINProcess %zu bytes in connection bufferFailed receiving HTTP2 data: %d(%s)[0] ingress: connection closed[%d] req_body_read(len=%zu) left=%ld -> %zd, %dhttp/2: failed to clear user_data for stream %uHTTP/2 stream %u was closed cleanly, but before getting all response header fields, treated as errorhandle_stream_close -> %zd, %d[%d] stream_recv(len=%zu) -> %zd, %d[%zd-%zd], http/2 recv on a transfer never opened or already cleared[%d] cf_recv(len=%zu) -> %zd %d, buffered=%zu, window=%d/%d, connection %d/%dnghttp2_submit_ping() failed: %s(%d)nghttp2_session_send() failed: %s(%d)%zd bytes stray data read before trying h2 connectionconn alive -> %d, input_pending=%dinitialization failure, transfer not http initializedHTTP/2 send again with decreased length (%zd vs %zd)[%d] discarding dataon closed stream with responsesend request NOT allowed (via nghttp2)send: nghttp2_submit_request error (%s)%u[HTTP/2] [%d] OPENED stream for %s[HTTP/2] Warning: The cumulative length of all headers exceeds %d bytes and that could cause the stream to be rejected.send: nothing to do in this session[%d] cf_send(len=%zu) -> %zd, %d, upload_left=%ld, h2 windows %d-%d (stream-conn), buffers %zu-%zu (stream-conn)cf_send(len=%zu) -> %zd, %d, connection-window=%d, nw_send_buffer(%zu)nghttp2 unexpectedly failed on pack_settings_payloadhttp/2: failed to set user_data for stream %u[%d] premature DATA_DONE, RST stream[0] MAX_CONCURRENT_STREAMS: %d[0] notify MAX_CONCURRENT_STREAMS: %ureceived GOAWAY, error=%d, last_stream=%u[%d] DATA, buffered=%zu, window=%d/%dGot PUSH_PROMISE, ask application[%d] fail in PUSH_PROMISE receivedConnection: Upgrade, HTTP2-Settings Upgrade: %s HTTP2-Settings: %s Ignoring HTTP/2 prior knowledge due to proxyerror on copying HTTP Upgrade response: %dconnection buffer size could not take all data from HTTP Upgrade response header: copied=%zd, datalen=%zuCopied HTTP/2 data in stream buffer to connection buffer after upgrade: len=%zu(��8�P�x�����������$����,���������aws:amz%64[^:]:%64[^:]:%64[^:]:%64sawss3x-%s-content-sha256x-%s-content-sha256: %s%Y%m%dT%H%M%SZX-%s-Datex-%s-date:%s
host:%s%s: %s ;%25&%s %s %s %s %s %.*s%s4_request%s/%s/%s/%s%s4-HMAC-SHA256 %s %s %s%s4%sfirst aws-sigv4 provider can't be emptyaws-sigv4: service missing in parameters and hostnameaws-sigv4: service too long in hostnameaws_sigv4: picked service %s from hostaws-sigv4: region missing in parameters and hostnameaws-sigv4: region too long in hostnameaws_sigv4: picked region %s from hostaws-sigv4: too many query pairs in URLAuthorization: %s4-HMAC-SHA256 Credential=%s/%s, SignedHeaders=%s, Signature=%s %s%sUNSIGNED-PAYLOADToo long hexadecimal numberMalformed encoding foundBad content-encoding found������P��0�������������p��`�� ��0��@��P����Illegal or missing hexadecimal sequence%sAuthorization: Digest %s Negotiate auth restartedCurl_output_negotiate, no persistent authentication: cleanup existing context%sAuthorization: Negotiate %s NTLM auth restartedNTLM handshake rejected%sAuthorization: NTLM %s NTLM handshake failure (internal error)HTTP-PROXYCONNECT tunnel: HTTP/1.%d negotiatedinstalling subfilter for HTTP/1.1CONNECT tunnel: HTTP/2 negotiatedinstalling subfilter for HTTP/2CONNECT tunnel: unsupported ALPN(%d) negotiated%%%u%c%03dLOGOUTSEARCH %sUID FETCH %s BODY[%s]<%s>UID FETCH %s BODY[%s]Cannot FETCH without a UID.PREAUTHCAPABILITYSTORESELECTFETCHEXAMINESEARCHEXPUNGELSUBGETQUOTAROOTNOOPAUTH=+LOGINAUTHENTICATE %s %sAUTHENTICATE %s() {%*]\"LIST "%s" *LOGIN %s %sLOGINDISABLEDSASL-IRSTARTTLSSTARTTLS not available.STARTTLS deniedAuthentication cancelledAccess denied. %cOK [UIDVALIDITY Select failedFound %ld bytes to downloadUIDVALIDITYMAILINDEXSECTIONPARTIALMime-VersionMime-Version: 1.0APPEND %s (\Seen) {%ld}SELECT %simapIMAPSIMAPCannot SEARCH without a query string.Unexpected continuation responseNo known authentication mechanisms supportedPREAUTH connection, already authenticatedGot unexpected imap-server responseMailbox UIDVALIDITY has changedWritten %zu bytes, %lu bytes are left for transferFailed to parse FETCH response.Cannot APPEND without a mailbox.Cannot APPEND with unknown input file sizeCannot SELECT without a mailbox.p-��p-���.��p-��p-��p-��p-���.��G.��l.��p-��p-��p-���/��9���;���;��<;��9���:��9���:��<:���9���9��|9��l9���:��ENC MIC PASS ACCT Send: %s%sgetsockname()AUTH GSSAPITrying against %sbase64-encoding: %sADAT %sADAT=base64-decoding: %sFailed realloc of size %zuTrying mechanism %s...PBSZ %uPBSZ=confidentialError importing service name %s@%sError creating security contextServer didn't accept auth dataMechanism %s is not supported by the server (server returned ftp code: 504).Mechanism %s was rejected by the server (server returned ftp code: 534).server does not support the security extensionsTrying to change the protection level after the completion of the data exchange.Failed to set the protection's buffer size.Failed to set the protection level.CSEP ---- binary.gifmultipart/mixed; filename="; name="; boundary=8bitattachmenttext/plainContent-Dispositionmultipart/Content-Type: %s%s%sContent-Transfer-EncodingContent-Transfer-Encoding: %s\\\"\""%22 %0D %0Aimage/gif.jpgimage/jpeg.jpeg.pngimage/png.svgimage/svg+xml.txt.htmtext/html.html.pdfapplication/pdf.xmlapplication/xml7bitbase64quoted-printable�s��ps�� s���r��`r���r���r���q��Lr��Dy��6x��6x��6x��Dy���x���w��lx���w��H���0���P���p����0123456789ABCDEFABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Content-Disposition: %s%s%s%s%s%s%s----------------.%ld��������������������Β��Β������Β�������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������L����������������|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|�������|���|�������|���|���|���|���|���|���������|���̕��l���|�����������������������������������������|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���L���|���|���ܔ��|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���\���|���|���|���̔��|���|���|���|���4���|���|���|���|���|���|���|���|���ܔ��������������������������������������������������������������2���������������������������������F���Z���g���{����������Z���������������������%�����������������������������(nil)(nil)0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz$@Using client id '%s'Username is too large: [%zu]Password is too large: [%zu]Too long MQTT topicmqtt_doing: state [%d]Connection disconnectedGot DISCONNECTRemaining length: %zu bytesEEEE AAAAGAINserver disconnectedState not handled yetMQTTClient ID length mismatched: [%zu]Error %d sending MQTT CONNECT requestNo MQTT topic found. Forgot to URL encode it?Expected %02x%02x but got %02x%02x�@�����������x�������x���x�����������������������������(�������м�����������T���������T�$�����d�����Internal error removing splay node = %dConnection #%ld to host %s left intactResolving timed out after %ld millisecondsConnection timed out after %ld millisecondsOperation timed out after %ld milliseconds with %ld out of %ld bytes receivedOperation timed out after %ld milliseconds with %ld bytes receivedInternal error clearing splay node = %dTransfer was pending, now try anotherHostname '%s' was found in DNS cacheseek callback returned error %dthe ioctl callback returned %dioctl callback returned error %dnecessary data rewind wasn't possibleoperation aborted by pre-request callbackCannot rewind mime/post dataDowngrades to HTTP/1.1macdefmachineloginHOME%s%s.netrcMonMondayJanTuesdayWednesdayThursdayFridaySaturdaySundayFebMarAprMayJunJulAugSepOctNovDecTueWedThuFriSatSun;Zx����0NGMTUTUTCWETBST���WAT<AST�ADT�EST,EDT�CSThCDT,MST�MDThPST�PDT�YSTYDT�HSTXHDTCATXAHSTXNT�IDLW�CET���MET���MEWT���MEST����CEST����MESZ����FWT���FST����EET����WAST\���WADT ���CCT ���JST��EAST����EADTl���GST����NZT0���NZST0���NZDT�IDLE0���A<BxC�D�E,FhG�H�IKXL�M�N���O����PL���Q���R���S����T\���U ���V��W����Xl���Y0���Zserver response timeoutselect/poll errorcached response data too big to handleresponse reading failed (errno: %d)Excessive server response line length received, %zd bytes. StrippingAUTH %s %s+OKCAPAAPOP %s %s+APOPRETR . SASL STLSSTLS not supported.Authentication failed: %dpopPOP3SPOP3Got unexpected pop3-server response$4��D5��|6���5��$4��,6��4���4���4��t4��$4��%2ld:%02ld:%02ld%3ldd %02ldh%7ldd%5ld%4ldk%2ld.%0ldM%4ldM%2ld.%0ldG%4ldG%4ldT%4ldPCallback aborted�>��?��(?���>��H?��X?��h?��x?���>��?���?��** Resuming transfer from byte position %ld %% Total %% Received %% Xferd Average Speed Time Time Time Current Dload Upload Total Spent Left Speed
%3ld %s %3ld %s %3ld %s %s %s %s %s %s %s@�@/dev/urandomWARNING: using weak random seedABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789Cannot pause RTPFailed writing RTP dataANNOUNCEAccept: application/sdp GET_PARAMETERSET_PARAMETERDESCRIBEPLAYPAUSETEARDOWNGot invalid RTSP requestTransportTransport: %s Range: %s CSeqSession%s %s RTSP/1.0 CSeq: %ld Session: %s %s%s%s%s%s%s%s%sFailed sending RTSP requestCSeq:Session:Transport:interleaved=Got a blank Session IDRTSPRTSP: invalid RTP channel %d, skippingCannot write a 0 size RTP packet.The CSeq of this request %ld did not match the response %ldGot an RTP Receive with a CSeq of %ldGot invalid RTSP request: RTSPREQ_LASTRefusing to issue an RTSP request [%s] without a session ID.Refusing to issue an RTSP SETUP without a Transport: header.CSeq cannot be set as a custom header.Session ID cannot be set as a custom header.Content-Type: text/parameters Content-Type: application/sdp Unable to read the CSeq header: [%s]Got RTSP Session ID Line [%s], but wanted ID [%s]Unable to read the interleaved parameter from Transport header: [%s]�W���V���V��pW���V��XR���V��W��0W���V��XV���Q��PW��Write callback asked for PAUSE when not supportedFailure writing output to destinationExcess found writing body: excess = %zu, size = %ld, maxdownload = %ld, bytecount = %ldExceeded the maximum allowed file size (%ld) with %ld bytesFailed writing headerrawclientFLUSHRELOAD ����D�$��������l���L�����$�����q���������G�missing share in URL path for SMBSMB upload needs to know the size up frontNT LM 0.12D���T������4�������������Invalid input packetSMBSSMBx86_64-redhat-liEHLO %sRCPT TO:<%s@%s>RCPT TO:<%s> SMTPUTF8HELPVRFY %s%s%s%sEXPN%s %s%sHELO %sRemote access denied: %dAUTH STARTTLS not supported.STARTTLS denied, code %dCommand failed: %dMAIL failed: %dRCPT failed: %d (last error)DATA failed: %dRCPT failed: %d SIZE= AUTH=<>MAIL FROM:%s%s%s%s%s%s ..smtpSMTPSSMTPGot unexpected smtp-server response: %dUnexpectedly short EHLO responseFailed to alloc scratch buffer��x��������@���������� ��`��� ��X �����������`����������� ��� ��0��� ��( ��connection to proxy closedFailed to send %s: %sinitial SOCKS5 requestinitial SOCKS5 responseSOCKS5: hostname '%s' foundSOCKS5 connect requestSOCKS5 connect request ackSOCKS5 request granted.SOCKS4 communication to %s:%dHostname '%s' was foundSOCKS4: too long host nameSOCKS4 connect requestSOCKS4%s request granted.SOCKS-PROXYYSOCKS4: Failed receiving %s: %sSOCKS5: connecting to HTTP proxy %s port %dSOCKS5: the destination hostname is too long to be resolved remotely by the proxy.warning: unsupported value passed to CURLOPT_SOCKS5_AUTH: %uReceived invalid version in initial SOCKS5 response.Unable to negotiate SOCKS5 GSS-API context.SOCKS5 GSSAPI per-message authentication is not supported.No authentication method was acceptable.Undocumented SOCKS5 mode attempted to be used by server.Excessive user name length for proxy authExcessive password length for proxy authSOCKS5 sub-negotiation requestSOCKS5 sub-negotiation responseUser was rejected by the SOCKS5 server (%d %d).Failed to resolve "%s" for SOCKS5 connect.SOCKS5 connect to %s:%d (locally resolved)SOCKS5 connect to [%s]:%d (locally resolved)SOCKS5 connection to %s not supportedSOCKS5 connect to %s:%d (remotely resolved)SOCKS5 GSS-API protection not yet implemented.SOCKS5 reply has wrong version, version should be 5.Can't complete SOCKS5 connection to %s. (%d)SOCKS5 reply has wrong address type.SOCKS5 connect request addressSOCKS4%s: connecting to HTTP proxy %s port %dSOCKS4 non-blocking resolve of %sSOCKS4 connect to IPv4 %s (locally resolved)Failed to resolve "%s" for SOCKS4 connect.Too long SOCKS proxy user nameSOCKS4 reply has wrong version, version should be 0.Can't complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), request rejected or failed.Can't complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), request rejected because SOCKS server cannot connect to identd on the client.Can't complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), request rejected because the client program and identd report different user-ids.Can't complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), Unknown.unknown proxytype option givenSOCKS4 connection to %s not supportedg����g��g�����g��g��g��g����������g��g�����] ���%��A%���$��$��] ��� ��"��G#���"��^#���#��%�����=���$���%��GSS-API error: %s failed: %srcmdno GSS-API confidentialityout GSS-API data GSS-API integritygss_import_name()gss_init_sec_contextgss_inquire_contextgss_display_namegss_wrapgss_unwrapFailed to create service name.Failed to initial GSS-API token.Failed to send GSS-API authentication request.Failed to send GSS-API authentication token.Failed to receive GSS-API authentication response.Invalid GSS-API authentication response type (%d %d).Could not allocate memory for GSS-API authentication response token.Failed to receive GSS-API authentication token.Failed to determine user name.SOCKS5 server authenticated user %s with GSS-API.SOCKS5 server supports GSS-API %s data protection.Failed to wrap GSS-API encryption value into token.Failed to send GSS-API encryption request.Failed to send GSS-API encryption type.Failed to receive GSS-API encryption response.Invalid GSS-API encryption response type (%d %d).Failed to receive GSS-API encryptrion type.Failed to unwrap GSS-API encryption value into token.Invalid GSS-API encryption response length (%zu).SOCKS5 access with%s protection granted.Operation too slow. Less than %ld bytes/sec transferred the last %ld seconds
!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~�����������������������������������������������������������������������������������������������������������������������������No errorUnsupported protocolFailed initializationCouldn't resolve proxy nameCouldn't resolve host nameCouldn't connect to serverWeird server replyFTP: unknown PASS replyFTP: unknown PASV replyFTP: couldn't set file typeTransferred a partial fileQuote command returned errorHTTP response code said errorTimeout was reachedFTP: command PORT failedFTP: command REST failedSSL connect errorCouldn't resume downloadCouldn't read a file:// fileLDAP: cannot bindLDAP: search failedSSL crypto engine not foundRequested SSL level failedLogin deniedTFTP: File Not FoundTFTP: Access ViolationTFTP: Illegal operationTFTP: Unknown transfer IDRemote file already existsTFTP: No such userRemote file not foundError in the SSH layerRTSP session errorUnable to parse FTP file listChunk callback failedHTTP/3 errorQUIC connection errorproxy handshake errorUnknown errorInvalid multi handleInvalid easy handleInternal errorInvalid socket argumentUnknown optionUnknown share optionShare currently in useInvalid share handleCURLSHcode unknownUnsupported URL schemeA memory function failedNo scheme part in the URLNo user part in the URLNo password part in the URLNo options part in the URLNo host part in the URLNo port part in the URLNo query part in the URLNo fragment part in the URLNo zoneid part in the URLBad login partBad IPv6 addressBad hostnameBad file:// URLBad schemeBad pathBad fragmentBad queryBad passwordBad userlibcurl lacks IDN supportCURLUcode unknownUnknown error %dURL using bad/illegal format or missing URLA requested feature, protocol or option was not found built-in in this libcurl due to a build-time decision.Access denied to remote resourceFTP: The server failed to connect to data portFTP: Accepting server connect has timed outFTP: The server did not accept the PRET command.FTP: unknown 227 response formatFTP: can't figure out the host in the PASV responseError in the HTTP2 framing layerFTP: couldn't retrieve (RETR failed) the specified fileFailed writing received data to disk/applicationUpload failed (at start/before it took off)Failed to open/read local data from file/applicationRequested range was not delivered by the serverInternal problem setting up the POSTA required function in the library was not foundOperation was aborted by an application callbackA libcurl function was given a bad argumentFailed binding local connection endNumber of redirects hit maximum amountAn unknown option was passed in to libcurlMalformed option provided in a setoptServer returned nothing (no headers, no data)Can not set SSL crypto engine as defaultFailed to initialise SSL crypto engineFailed sending data to the peerFailure when receiving data from the peerProblem with the local SSL certificateCouldn't use specified SSL cipherSSL peer certificate or SSH remote key was not OKProblem with the SSL CA cert (path? access rights?)Unrecognized or bad HTTP Content or Transfer-EncodingFailed to shut down the SSL connectionFailed to load CRL file (path? access rights?, format?)Issuer check against peer certificate failedSend failed since rewinding of the data stream failedDisk full or allocation exceededSocket not ready for send/recvRTSP CSeq mismatch or invalid CSeqThe max connection limit is reachedSSL public key does not match pinned public keySSL server certificate status verification FAILEDStream error in the HTTP/2 framing layerAPI function called from within callbackAn authentication function returned an errorSSL Client Certificate requiredUnrecoverable error in select/pollPlease call curl_multi_perform() soonThe easy handle is already added to a multi handleWakeup is unavailable or failedFeature not enabled in this libraryAn invalid CURLU pointer was passed as argumentAn invalid 'part' argument was passed as argumentMalformed input to a URL functionPort number was not a decimal number between 0 and 65535URL decode error, most likely because of rubbish in the inputCredentials was passed in the URL when prohibitedAn unknown part ID was passed to a URL API functionUnsupported number of slashes following scheme8��8���7���7���7���7���7���7���7���7��x7��h7��X7��H7��87��(7��7��7���6���6��(8���6���6���6��(8���6���6��x6��h6��(8��X6��H6��(8��86��(6��6��6���5���5���5��(8���5���5���5��(8���5��(8���5��x5��h5��(8��(8��X5��H5��85��(5��5��(8��5���4���4���4��(8���4���4���4���4���4��x4��h4��X4��H4��84��(4��4��(8��(8��4���3���3���3���3���3���3���3���3��x3��h3��X3��H3��83��(3��3��3���2���2���2���2���2���6���6���7���6���6���6��7��7��(7��87��H7��X7��h7��x7���7���7���7���7���7���7���7��8���9���9���9���9���9���9���9��x9��h9��X9��H9��89��(9��9��9���8���8���8���8���8���8���8���8��x8��h8��X8��H8��88��(8��8��XDISPLOCNEW_ENVBINARYUnknown telnet option %sUSER,%sSENT%s IAC SB (terminated by %u , not IAC SE) (Empty suboption?)%s (unsupported)%d (unknown)Width: %d ; Height: %d IS SEND INFO/REPLY NAME = %.2x%c%c%c%c%s%c%cSending data failed (%d)%c%c%c%c%c%.*s%c%sWILLWONTDODONTEXOPL%s IAC %s%s IAC %d%s %s %s%s %s %dIn SUBOPTION processing, RCVDTime-outTELNETEOFSUSPABORTEORNOPDMARKBRKAOAYTGASBIACECHORCPSUPPRESS GO AHEADTIMING MARKRCTENAOLNAOPNAOCRDNAOHTSNAOHTDNAOFFDNAOVTSNAOVTDNAOLFDEXTEND ASCIIBYTE MACRODE TERMINALSUPDUPSUPDUP OUTPUTSEND LOCATIONTERM TYPEEND OF RECORDTACACS UIDOUTPUT MARKINGTTYLOC3270 REGIMEX3 PADNAWSTERM SPEEDLFLOWLINEMODEOLD-ENVIRONAUTHENTICATIONENCRYPTNEW-ENVIRONSyntax error in telnet option: %s�;���;��T;���;���;���:���:��L:��:��XS���Q���Q��(Q���R��PR�� R��HO��XP���S���S���S��rS��bS���S��tftp_rx: internal errorConnected for receiveConnected for transmitbind() failed; %s;mode=octetnetasciiTFTP file name too long%s%c%s%ctsizeblksizeTFTP finishedInternal state machine errorReceived too short packetTFTP error: %sgot option=(%s) value=(%s)%s (%ld)requestedblksize parsed from OACK%s (%d) %s (%d)tsize parsed from OACKTFTPset timeouts for state %d; Total % ld, retry %d maxtry %dReceived last DATA packet block %d again.Received unexpected DATA packet block %d, expecting block %dTimeout waiting for block %d ACK. Retries = %dReceived ACK for block %d, expecting %dtftp_tx: giving up waiting for block %d acktftp_tx: internal error, event: %iTFTP buffer too small for optionstftp_send_first: internal errorMalformed ACK packet, rejectinginvalid blocksize value in OACK packetblksize is larger than max supportedblksize is smaller than min supportedserver requested blksize larger than allocatedinvalid tsize -:%s:- value in OACK packetInternal error: Unexpected packet�c���e���e���e���e���e��Tc���c��operation aborted by callback%zx%sselect/poll returned error%s in chunked-encodingDone waiting for 100-continueNo URL setUser-Agent: %s Switch from POST to GETSwitch to %sstate.rewindbeforesend = TRUEMoving trailers state machine from initialized to sending.operation aborted by trailing headers callbackSuccessfully compiled trailers.Read callback asked for PAUSE when not supportedread function returned funny valueSignaling end of chunked upload after trailers.Signaling end of chunked upload via terminating chunk.Excess found: excess = %zu url = %s (zero-length body)Failed reading the chunked-encoded streamLeftovers after chunking: % ldu byteswe are done reading and this is set to close, stop sendWe are completely uploaded and finetransfer closed with %ld bytes remaining to readtransfer closed with outstanding read data remainingcannot mix POSTFIELDS with RESUME_FROMThe redirect target URL could not be parsed: %sClear auth, redirects to port from %u to %uClear auth, redirects scheme from %s to %sMaximum (%ld) redirects followedIssue another request to this URL: '%s'REFUSED_STREAM, retrying a fresh connectConnection died, tried %d times before giving upConnection died, retrying a fresh connect (retry count: %d)%ld-Invalid zoneid: %s; %ssocks5hsocks5socks4asocks4localhost%sClosing connectioncan multiplexseriallyServer upgrade cannot be usedMultiplexed connection foundConnected to %s (%s) port %uNO_PROXYno_proxyALL_PROXYall_proxyftp@example.comanonymous%s://%sURL rejected: %smemory shortagehttp_proxy.netrc parser errorInvalid IPv6 address formatConnecting to hostname: %sConnecting to port: %dNo connections available.localhost/Couldn't resolve proxy '%s'Could not resolve host: %sUnsupported proxy scheme for '%s'Unsupported proxy syntax in '%s': %sUnsupported proxy '%s', libcurl is built without the HTTPS-proxy support.Too old connection (%ld seconds idle), disconnect itToo old connection (%ld seconds since creation), disconnect itConnection %ld seems to be deadFound bundle for host: %p [%s]Server doesn't support multiplex yet, waitServer doesn't support multiplex (yet)Could multiplex, but not asked toCan not multiplex, even if we wanted toConnection #%ld isn't open enough, can't reuseServer upgrade doesn't support multiplex yet, waitclient side MAX_CONCURRENT_STREAMS reached, skip (%zu)MAX_CONCURRENT_STREAMS reached, skip (%zu)Found pending candidate for reuse and CURLOPT_PIPEWAIT is setToo long host name (maximum is %d)Switched from HTTP to HTTPS due to HSTS => %sProtocol "%s" not supported or disabled in libcurlUses proxy env variable %s == '%s'space-separated NOPROXY patterns are deprecatedCouldn't find host %s in the %s file; using defaultsPlease URL encode %% as %%25, see RFC 6874.No valid port number in connect to host string (%s)Alt-svc connecting from [%s]%s:%d to [%s]%s:%dRe-using existing connection with %s %sNo more connections allowed to host: %zuNo connections available in cacheNTLM picked AND auth done set, clear pickedNTLM-proxy picked AND auth done set, clear pickedUnix socket path too long: '%s'Failed to resolve host '%s' with timeout after %ld msC%20+dictldappop3127.0.0.1//?#ftp.dict.ldap.imap.smtp.pop3././/./.?/..//../..?file://%s%s%s%.*s%%25%s]xn-- /:#?!@{}[]\$'"^`*<>=;,+&()%%s://%s%s%s%s%s%s%s%s%s%s%s%s%s%sP��`����������������������0��H���@���-�� ��� ����>��]�����{ ��� ���� ��e��������������������������������
0123456789abcdeflibcurl/8.5.0zlib/%sx86_64-redhat-linux-gnualt-svcAsynchDNSbrotliGSS-APIHTTP2HTTPS-proxyIPv6KerberosLargefilelibzSPNEGOthreadsafeTLS-SRPUnixSocketsftpsgophergophersimapsmqttpop3srtspscpsftpsmbsmbssmtpstelnettftp%s %02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02xauth-int%s:%s:%08x:%s:%s:%s%s, opaque="%s"%s, algorithm=%s%s, userhash=truenonce="realm="algorithm=qop="md5-sess,authauth-confnoncestalerealmopaqueqopalgorithmMD5-sessSHA-256-SESSSHA-512-256SHA-512-256-SESSuserhashusername="%s", realm="%s", nonce="%s", uri="%s", cnonce="%s", nc=%08x, qop=%s, response="%s"username="%s", realm="%s", nonce="%s", uri="%s", response="%s"username="%s",realm="%s",nonce="%s",cnonce="%s",nc="%s",digest-uri="%s",response=%s,qop=%sgss_import_name() failed: gss_unwrap() failed: gss_wrap() failed: GSSAPI handshake failure (empty challenge message)gss_init_sec_context() failed: GSSAPI handshake failure (empty security message)GSSAPI handshake failure (invalid security data)GSSAPI handshake failure (invalid security layer)NTLM handshake failure (bad type-2 message)NTLM handshake failure (bad type-2 message). Target Info Offset Len is set incorrect by the peerNTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%s%sNTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%cuser + domain + host name too bigWORKSTATIONincoming NTLM message too bign,a=%s,host=%sauth=Bearer %sn,a=%s,host=%sport=%ldauth=Bearer %suser=%sauth=Bearer %sSPNEGO handshake failure (empty challenge message)%s/%s@%s\/@*.SSLKEYLOGFILE0123456789ABCDEFSSL_ERROR_NONESSL_ERROR_SSLSSL_ERROR_WANT_READSSL_ERROR_WANT_WRITESSL_ERROR_WANT_X509_LOOKUPSSL_ERROR_SYSCALLSSL_ERROR_ZERO_RETURNSSL_ERROR_WANT_CONNECTSSL_ERROR_WANT_ACCEPTSSL_ERROR_WANT_ASYNCSSL_ERROR_WANT_ASYNC_JOBSSL_ERROR unknown%s(%s)OpenSSL%s/%lx.%lx.%lx%s-fipsSSL Engine '%s' not foundSSL shutdown finishedSSL shutdown, EOF from serverSSL shutdown sentSSL shutdown send blockedfailed to store ssl sessionSSLv3TLSv1.0TLSv1.1TLSv1.2TLSv1.3TLS UnknownSSLv2TLS alertChange cipher specHello requestNext protocolKey updateEnd of early dataSupplemental dataEncrypted ExtensionsCertificate StatusFinishedCERT verifyServer finishedRequest CERTClient key exchangeServer key exchangeCertificateNewsession TicketServer helloClient helloTLS change cipherTLS handshakeTLS app dataTLS header(%x)%s (%s), %s, %s (%d): SSL shutdown timeoutPEMENGP12CURLOPT_SSLCERT_BLOB(memory blob)pkcs11:LOAD_CERT_CTRLcurl user interfaceunable to set private keypkcs11SSL_write() error: %sInsufficient randomnessSubjectIssuer%lxSerial NumberSignature AlgorithmPublic Key AlgorithmStart dateExpire date Unable to load public keyRSA Public Keypub_key%02x:SignatureCertvtls/openssl.cSSL: illegal cert name field common name: %s (matched)[NONE]%s certificate: subject: %s start date: %.*s expire date: %.*s issuer: %s SSL certificate verify ok.No OCSP response receivedInvalid OCSP responseError computing OCSP IDOCSP response has expired CAfile: %s CApath: %serror loading CRL file: %ssuccessfully loaded CRL file: CRLfile: %sNo SSLv2 supportNo SSLv3 supportError setting ALPNALPN: curl offers %sCipher selection: %sTLS 1.3 cipher selection: %sUsing TLS-SRP username: %sUnable to set SRP user namefailed setting SRP passwordSetting cipher list SRPFailed set SNISSL reusing session IDOpenSSL CF BIOSSL certificate problem: %s[blank]SSL connection timeoutopenssl0;��@;��P;��`;��p;���;���;���;���;���;���;���H��.I��I���G��rI��aI���G���G��PI���G���G��?I���I���I���I���I���I���G���G���G���I���G���I���I��I���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���G���H��$J��$J��J��$J��$J��$J��$J��$J���I���I��$J���I���I��Failed to initialise SSL Engine '%s': %sSSL shutdown, error: '%s', errno %dold SSL session ID is stale, removingossl_bio_cf_out_write(len=%d) -> %d, err=%dOpenSSL SSL_read on shutdown: %s, errno %dselect/poll on SSL socket, errno: %dSSL_get_shutdown() returned SSL_SENT_SHUTDOWNSSL_get_shutdown() returned SSL_RECEIVED_SHUTDOWNSSL_get_shutdown() returned SSL_SENT_SHUTDOWN|SSL_RECEIVED__SHUTDOWNcould not load PEM client certificate from %s, OpenSSL error %s, (no key found, wrong pass phrase, or wrong file format?)could not load ASN1 client certificate from %s, OpenSSL error %s, (no key found, wrong pass phrase, or wrong file format?)ssl engine does not support loading certificatesssl engine cannot load client cert with id '%s' [%s]ssl engine didn't initialized the certificate properly.unable to set client certificate [%s]crypto engine not set, can't load certificateBIO_new_mem_buf NULL, OpenSSL error %sBIO_new return NULL, OpenSSL error %scould not open PKCS12 file '%s'error reading PKCS12 file '%s'could not parse PKCS12 file, check password, OpenSSL error %scould not load PKCS12 client certificate, OpenSSL error %sunable to use private key from PKCS12 file '%s'private key from PKCS12 file '%s' does not match certificate in same filecannot add certificate to client CA listcannot add certificate to certificate chainnot supported file type '%s' for certificateunable to set private key file: '%s' type %sunable do create OpenSSL user-interface methodfailed to load private key from crypto enginecrypto engine not set, can't load private keyfile type P12 for private key not supportednot supported file type for private keyunable to create an SSL structurePrivate key does not match the certificate public keyOpenSSL SSL_write: %s, errno %dOpenSSL SSL_read: %s, errno %dset default crypto engine '%s'set default crypto engine '%s' failed subjectAltName: host "%s" matched cert's "%s" subjectAltName: host "%s" matched cert's IP address! subjectAltName does not match %sSSL: no alternative certificate subject name matches target host name '%s'SSL: unable to obtain common name from peer certificateSSL: certificate subject name '%s' does not match target host name '%s'SSL: couldn't get peer certificateSSL: couldn't get X509-issuer nameSSL: Unable to open issuer cert (%s)SSL: Unable to read issuer cert (%s)SSL: Certificate issuer check failed (%s) SSL certificate issuer check ok (%s)SSL certificate verify result: %s (%ld) SSL certificate verify result: %s (%ld), continuing anyway. Certificate level %d: Public key type %s%s (%d/%d Bits/secBits), signed using %sInvalid OCSP response status: %s (%d)Could not get peer certificate chainOCSP response verification failedError getting peer certificateCould not find certificate ID in OCSP responseSSL certificate status: %s (%d)SSL certificate revocation reason: %s (%d)SSL: public key does not match pinned public keyerror importing CA certificate blobsuccessfully imported CA certificate bloberror setting certificate verify locations: CAfile: %s CApath: %serror setting certificate verify locations, continuing anywayUnrecognized parameter passed via CURLOPT_SSLVERSIONSSL: couldn't create a context: %sfailed setting cipher list: %sfailed setting TLS 1.3 cipher suite: %sfailed setting curves list: '%s'failed setting SRP cipher listerror signaled by ssl ctx callbackSSL: couldn't create a context (handle)SSL: SSL_set_session failed: %sossl_bio_cf_in_read(len=%d) -> %d, err=%dOpenSSL SSL_connect: %s in connection to %s:%d SSL connection using %s / %s / %s / %sSSL certificate verification fai(cf_recv(len=%zu) -> %zd, %dCURL_SSL_BACKEND%s: public key hash: sha256//%s;sha256//-----BEGIN PUBLIC KEY----- -----END PUBLIC KEY-----cf_connect()cf_connect() -> %d, done=%dALPN: server accepted %.*sSSL-PROXYUnrecognized parameter value passed via CURLOPT_SSLVERSIONCURL_SSLVERSION_MAX incompatible with CURL_SSLVERSIONunsupported ALPN protocol: '%.*s'ALPN: server did not agree on a protocol. Uses default.h2http/1.1http/1.1No such file or directoryPermission deniedOperation failedBad message from SFTP serverNot connected to SFTP serverInvalid handleUnknown error in libssh2File already existsFile is write protectedNo mediaDisk fullUser quota exceededUnknown principleFile lock conflictDirectory not emptyNot a directoryInvalid filenameLink points to itselfssh-dssssh-rsaNULL<none>ssh error]:Invalid host pattern %s in %sFound host %s in %sUnknown host key type: %iSet "%s" as SSH hostkey typelibssh2: %sDid not find host %s in %sSSH MD5 public key: %sSSH SHA256 public key: %sSSH SHA256 fingerprint: %sSHA256 checksum matchSSH MD5 fingerprint: %sMD5 checksum matchSSH host check: %d, key: %sWARNING: writing %s failedpublickey%s/.ssh/id_rsa%s/.ssh/id_dsahostbasedCould not create agent objectFailure connecting to agentNo identity would matchkeyboard-interactiveAuthentication failureAuthentication completeSSH CONNECT phase doneSending quote commandspwdPWD chgrp chmod chown atime mtime ln symlink mkdir rename rmdir rm statvfs Unknown SFTP commandchmodchgrpchownatimemtimesymlink command failed: %smkdir command failed: %srename command failed: %srmdir command failed: %srm command failed: %sstatvfs command failed: %sBad file size (%ld)Upload failed: %s (%lu/%d)Creating directory '%s'ShutdownOperation timed outDisconnect timed outUses HTTPS proxylibssh2/%sSFTPSCPConnection to SFTP server lostOperation not supported by SFTP serverrsa-sha2-256,rsa-sha2-512,ssh-rsaFound host key type RSA1 which is not supportedFailure establishing ssh session: %d, %sDenied establishing ssh session: sha256 fingerprint not availablesha256 fingerprint could not be encodedDenied establishing ssh session: mismatch sha256 fingerprint. Remote %s is not equal to %sunsupported key type, can't check knownhostsWARNING: adding the known host %s failedSSH user accepted with no authenticationSSH authentication methods available: %sUsing SSH public key file '%s'Using SSH private key file '%s'Initialized SSH public key authenticationSSH public key authentication failed: %sInitialized password authenticationFailure requesting identities to agentAgent based authentication successfulInitialized keyboard interactive authenticationFailure initializing sftp session: %s257 "%s" is current directory. Syntax error command '%s', missing parameterSyntax error: Bad first parameter to '%s'Syntax error in %s: Bad second parameterSyntax error in ln/symlink: Bad second parameterSyntax error in rename: Bad second parameterAttempt to get SFTP stats failed: %sSyntax error: chgrp gid not a numberSyntax error: chmod permissions not a numberSyntax error: chown uid not a numberincorrect date format for %.*sAttempt to set SFTP stats failed: %sstatvfs: f_bsize: %llu f_frsize: %llu f_blocks: %llu f_bfree: %llu f_bavail: %llu f_files: %llu f_ffree: %llu f_favail: %llu f_fsid: %llu f_flag: %llu f_namemax: %llu Creating the dir/file failed: %sCould not open directory for reading: %sCould not open remote file for reading: %s :: %dCould not open remote file for reading: %sFailed to close libssh2 file: %d %sFailed to stop libssh2 sftp subsystemSCP requires a known file size for uploadFailed to send libssh2 channel EOF: %d %sFailed to get channel EOF: %d %sChannel failed to close: %d %sFailed to free libssh2 scp subsystem: %d %sFailed to disconnect libssh2 session: %d %sFailed to disconnect from libssh2 agent: %d %sFailed to free libssh2 session: %d %sDenied establishing ssh session: mismatch md5 fingerprint. Remote %s is not equal to %sDenied establishing ssh session: md5 fingerprint not availableFailure initialising ssh sessionFailed to enable compression for ssh sessionFailed to read known hosts from %s��������������������������������Щ�������������� ���0���@���P���`���p�������������������������������������������H��0���������h���������8����x���8�������(�������p��������H��h��ؼ��h����������8����������p���(����������������H���ȸ�����x���x������������h���������Ȳ������P�������H���ȯ��QOOOOOOONOOOOOOOO<<OOCOOO<<O7OOOOON OOOOOONI OFFO Reason unknown (;�)<`�*��0*�,��T�`-��H*�.���*�/���*�/���*�0��8+�0��T+02���+p2���+�2���+�3��<,�3��P,p4���,�7��-?��d-�?���-p@���-pA��.PB��\.�C���.�C���.�C���.�C���.�C��/D�� /0D��4/pD��H/�D��\/�E���/�F���/`I��80pI��L0�I��`0�I��t0�I���0�K���0N��$1 N��81@N��P1O��p1`P���1�P���1�P���1�P��2 Q��2PQ��(2�Q��P2R��d2@R��x2�R���2�R���2�R���2�S��3�T��L3�U��x3�U���3pV���3pW��4`X��T4`Y���4�Y��85Z��L5PZ��h5�Z���5�Z���5�Z���5P[��6�[��86�^���6P_���6�_��7`��87�o���7 p���7�p���7Pr��48`t���8�t���8�v���8@w��49`}���9�}���90��:���8:0���`:�����:����;P���$;����p;����;P����;����<�����<0����<�����<���H=Б���=����=��=����0>0���h>�����>�����>0���?���P?�����?����?p���@�T@����@@����@Я��A����XA����A�����A����Ap���8B����LB����`B`����B@����B����C���XC����C�����C��D����0D���TD�����D�����D����D���<E���pE����E���E ��0F���|F����F���F���TG����G����G@���G����G���H���LH����H`���H���I���TI����I����I���I�� J`�`J0��J���J���J���J���J��K�$K0�8KP�LK���K���K ��K���K��K`�L��0L��DL��|L���L���L���L��L��M�$MP�8M��LM��`MP�tM���M ��Mp��M���MP�DN��`N@��N���N���N��N0�OP�Op�(O��<O��PO��dO �xOP��O���O�O0��O`��O��P �<P��PP��dP��P`�P@��P��P � Q@�4Q��hQp����Q����Q0���4R@����R����R����S����LS ����S@����SP����S����T0��TT����T����T���Up��dU ���U`���U����U ��(V���`V���V����V���<W����W`���WP��X@��0X���hX ���X���X0���XP���X`��Yp�� Y���<Yp ���Y� ���Y�!���Y�!���Y@"��(Z�"��<Z�"��PZ�"��dZ�$���Z�'��[�'�� [�(��d[)���[ *���[�*��D\@-���\�-���\�-���\�.��]�/��`]@0���]1���]�1��^�2��T^ 3���^PF���^�H��D_0I��|_�M���_�M��` N��(`�N��|`�N���`�O���`�S�� a U��lapU���a�W���a�W���a�X��Hb�Y��|b�Z���b�Z���b�Z��c�Z��c[��0c�[���c\���c0]���c�]��(dP^��hd�^���d`_���d `���d�a��,e�b��|e�c���e`e��Tf�e���f�g���f�j��Xgl���g�l���g�m���gn���g�n��\h�o���h@p���hpp���hw��$i0}���i`}���i~��$j0~��@jp~��hj@���j����k����4k0���pkp����k�����k@���l����Tlp����l��l�����lЌ��m���XmЖ���m@���n`���tn�����n�����nЦ���nP����n`���o����,o����Dop���`o����to�����o�����o�����o����op����oЩ��p��0p�Dp���Xp�����p�����pp���Lq�����q��r���r`���Pr��r�����r@����r ���s����Ls@����s�����s`����s���s0����s�����s0���tp���Xt ���tt�����t�����t`���u ���|u���u0���u���8v@��hv����v����v���v���w���wP���w���w ���w0���w���x���x0��8x@��Lxp���x`���x���y���(y`��xyp���y���y���0z�|z@��z���z �H{��x{@��{���{���{��(|��P|��d|���|���|��0}P�\}`�}���}P���0~����~0���~�����,0��H����p ������p��8����T���p������������������,�0��p�������������X�P�����������0��P��4��ȃ�;��,�C����C����`D��Ԅ�D���E��� E��0�`E��X�pE��l��S���� T��`U���p^��8��^��L�@a�����a��І�a���pb��<��b��P�d�����d��� e��L��e��t��e�����e���� f����Pf��Ȉpf��܈�f���i��l�`j����n��P�pn�����o��̊p����p���q��`��q�����q����r��ċ0r���Pr���s��@��t���� u���� v��̌�v�����y��D�z��l��z�����|��ԍ0}���P}��(��}��`� �����p����p���8�����L�����`�@���������������ȏ����@�����������P���ܐЎ��(���x�������З��|����������p���ؒp���� ����@���� ���L� �����`���̓�����p���0�����D��������������ؔ`���4�����X�@���������ԕ�����P���L��������������4���������ė���ؗ�8������ ���ؘ@���� ����`�������l�p������������H�0�������� �� ����\�p����p���P�P�|�����0������� ��������4���������ԝ �� ����L� ������������0��4���������ȟ����`�����P�0��d������0������,�P��H������p�������С������l�0����0 ����"��\�%�����&��$�'��L�`'����(�����(����(����*��X� +��|��0����1��8�03�����>��h�C����PD���pD�� ��D��<�`E�����G�����H�����J��L��J��l��L����0M����M���pN��@��X�����Y��Ԫ0Z����Z����[��4��\��x�0^��ī`^��ث�^���0_��,�@w����pw�����{���|����|��L��~�����~��ȭ���8�������Ѓ������� ���L�P���h�������`����������Ќ�� �����D�p��������ذ@����P����������(���x�0���������������,�����@�p���t�@�����`�����`��������4����T���x�����������`�����Т����0���ȴ@��������0�P���\�����0���̵`�����l�P�����`�����p���������`���T�������Էp������0����|�`������8������P�����������l� ����@������������Ժ��������`��X�p��l����������� ��Ի�������$���P���d����x������@������������ȼ ��ܼ@�������$����8���p�p�����@�4�0�h�����@�����@� �h������ؿp�@�������`����(���T���h�����������,����t�p����� ��������<��������������������4����p�0�����������������P��L�P����������������������0��0� ����� ����!�����!�����"���`#�� �0$��<��$��X�0%��p�P%����p%�����%����`&����0'��,�`'��H��,�����,����@-����-��L��7����8���� 8����08����@8����P8����p8����8��$��8��8�9��L��9��x��9�����9�����:�����?��4��?��L��@����`A����pA����PB���pC��@��D����E���� E����pE�����E���`G��X� H����0H�����H����I����0I���PJ��T��M��p�N�����R����S����PS����S��$��U��p�pX�����X����`Y���p]��T�_����P`����``����a���0a��0� ~����p��������d����P�������������������4�0���H�P���\�p���p���������������p�����p���$�����h���������О��8�@���\�����������������@���H�p���d�����x� �����Ф����Ш��,����@�����l�Щ�������@�����`�����Ъ�������4�����H�p���|�������������������$�`���\����p� �����`������� ����������������@� ����P����@����p�����������P����t������`�������������@�������������������������8�@��t� ����@����`��������0����p��������p��@����t����P����@�`�\�@���p�������������\���������,�P�x�����`��������� ���P�����|���� �������������� ���$�����P�������p����������P��,�0��t������P����r��4��r��P�@s��t�Ps����ps����t����@t�����w��0��x����Py�����y����z�����z����z��@�P{��p��{�����{�����{����`|�����|���P��\�P�����Ё����P���D�`�����P�����P���������<������@�����`�������������������� �`���T�0�����p�����В�����������`����������p������,�����d�p�����������`��� �0�����������0��������@�����\� �����`����� �������0������������8�P�������(����<����h�������������@���T���h�P�|����@���������� ��`����8��`���t�����0���P���0�� �X�P�t������@����0��������<����������������(�0��P�P��d������������������4�`��h�p������������ ��4�` ��p�@%����%����,��<�`-�����-���0.����`.���/��4�`/��H��/��\� 0��p��0�����0���@1���`1����6��d�07����P7�����H���pI���I��`N��HpN��\�U����W����Y�� `Z��H \��t]���^����d���f��\g����g����h���j��8�k��|�l���Px��D�x��Xy��x0y���Py����}�� p~��l@���Ѐ�������@���4���������� �������@���l��������������$���t�����������������, ���� ���� @�� `��8 ��� 0�� @�� P�� `�p���,��@��T��h��|������������� ��0�@� ���������P�8 �X P�� ��� P�(����������(@���T����|�������`���H������� ������0����� ���� ���������P���d����` ������ ��4`��`���� ������ ��8��L����@���P���0��@��`��(��l������� �����<���X����0�������`�� p��4@ ����!����!����%��0&��L�&����'����'��+��X+��l@+����+��� ,����9��0�;��tp=���>���p>���>��4�?��h I���PI����N��$�[����b����l��L�m���pq���ps��`�s��t�s����t����t����t���u���u�� u�� 0u��0 @u��D Pu��X `u��l pu��� �u��� v��� �v�� !0x���!�x���!Py���!0|��"�|��D"�|��p"p}���"~��#`~��,#���X#p����#����#����D$�|$`����$�����$0���$%����\%���|%Є���% ����%0����%@����%���&P���&`���0&����d&��&`����&�����&���& ����&P����&����'����L' ���t'�����' ����'P����'��(P���P(p���d(����x(�����( ����(0����(����)���4)����) ����) ����)0���*P���*`���0*�����*��*0����*p���(+����T+����+��+���� ,���D,С��x,��,�����,@���-`���$-����8-����L-�����-P����-����8.����P.����d.Ц��x.��.����.0����.`����.�����.���/`��� /�X/�����/����/p����/ ���00Ь��l0����0����1P���h1��1����1P����1��2�2����X2P����2�����2����2���2���2���2zRx�$P���FJw�?:*3$"D���H\��uB�E�B �B(�I0�I8�D`� 8D0A(B BBBF �D���v�CG�`�F4����ZB�D�D �j CBGOADD����B�B�B �B(�A0�A8�DP�8A0A(B BBBLP��NA�Ldh���FB�B�O �B(�A0�A8�G� i� O� F� G� F� L� N� e 8A0A(B BBBF�l��2����8L�kL���F�B�A �D(�G0� (A ABBAS (C ABBEP���8d���rF�B�B �A(�A0�^(A BBB�����F�B�B �B(�A0�A8�G�� 8A0A(B BBBI}�E�E�E�E�E�A�D�I�A�B�B�A�D�I�H,` ��rF�I�B �B(�A0�A8�J�� 8A0A(B BBBAHx����F�B�B �B(�D0�A8�I`| 8A0A(B BBBH(�(���A�A�G e AAH0�����F�M�A �G@� AABHH$X���B�B�B �B(�D0�D8�D@� 8A0A(B BBBKLp���*B�B�B �D(�D0�� (D BBBHh (D BBBF������������)L�W��� ���)L�W4���H���9\ ��\p��mF�B�A �A(�D@� (A ABBHG (C ABBAt (F ABBA(�,���a�A�G U CAFL�����F�B�B �E(�D0�D8�D� 8A0A(B BBBGL �� `�� t�� ��� L����B�E�E �D(�D0�j (A BBBKq (F BBBAH����zF�B�B �E(�D0�A8�J�y 8A0A(B BBBG8���L���d����A�O H<����PT�A�G }AAE��H ��k AAK����$����@E�A�G pAA���+���/(��+$< ��rE�A�G bAAdx��=x���)����E����� ��=H�4 ���F�B�B �B(�A0�A8�DPX 8D0A(B BBBIH � ��F�B�B �B(�A0�A8�D`� 8D0A(B BBBH(` �!���E�D o AGCA� "��a,� \"��{J�D�G S AAFJ��H� �"���F�E�E �B(�A0�D8�Fp� 8A0A(B BBBGH `#���F�B�B �B(�D0�A8�DP� 8D0A(B BBBA�h $���F�E�E �E(�D0�D8�D@L 8A0A(B BBBI_ 8H0A(B BBBHK 8H0A(B BBBDM 8A0A(B BBBAL� p$���F�E�E �D(�D0�} (A BBBDV (A BBBCL�$��`�$��4E�n4|�$��CF�E�D �D(�G0b(A ABB��$�� ��$�� <��$���F�B�A �D(�G0R (A ABBD,@%��]R�A�D �m �A�B�IpLp%��P�D�C �w ABG� ABG~ ABGN �A�B�Oq ABDP���H ���4�(���E�D�G Q AAED AAB$�d(��RA�A�D IAA( �(��VE�D�G a GAGLL �(���F�B�B �B(�A0�A8�D�Z 8A0A(B BBBJ$� 8��lE�P0r AH4� h8��jF�D�D �n DBNVABH� �8���B�B�B �E(�A0�A8�GpR 8A0A(B BBBHHH:��B�B�B �B(�D0�D8�D`� 8A0A(B BBBH4��;���F�B�A �A(�D@t(C ABB@�0<���B�B�E �D(�A0�D@} 0A(A BBBI4�=���A�F�D H ICID AABpH>��F�B�B �B(�A0�A8�D`F 8D0A(B BBBK�hXpMhA`NhYpMhB`rhXpMhA`��C��|H P HH�D��GF�B�E �B(�A0�D8�G`� 8A0A(B BBBF$$E��tA�A�K dAA$LpE��qA�A�G eAA4t�E��MF�A�D �n DBIAABd��E��0F�H�B �B(�D0�A8�Dp� 8A0A(B BBBE�xG�IxApsxK�[xBp �G���E�K R AEH8$H��9F�B�B �B(�A0�A8�D`� 8A0A(B BBBC8�I���F�B�E �A(�A0�f(D BBB�\I��3A�T KKH�|I��RF�B�E �B(�A0�D8�G`� 8A0A(B BBBCp,�J���F�B�B �B(�A0�A8�D`@hYpKhA` hWpFxI�A�E�P`S 8D0A(B BBBC8�O���F�B�E �A(�A0�f(D BBB0�`O��xB�A�D �J�� AABFH�Q��GF�B�E �E(�A0�A8�G�z 8A0A(B BBBA8\�S���F�B�A �A(�G�[ (A ABBF$�DT��9E�A�D lAAL�\T��� F�B�B �B(�D0�A8�G�n 8A0A(B BBBH0�a���F�N�F �D0k AABC4Dhb���E�D�G N AAHD AAB(|�b��GY�D�G IM�H�X��b��'F�B�E �B(�A0�A8�D`� 8A0A(B BBBFhApPhA` �d��sE�H KA G8(e���F�O�A �F(�D@z (A ABBH<d�e���K�A�G OAAD��P ��N A�A�H$�f��CA�A�G wAAD�@f��pB�B�E �E(�A0�D8�G@K8A0A(B BBBPhf��|B�B�B �D(�D0�� (C BBBD� (A BBBAHh�h�� F�B�B �B(�A0�A8�DPP 8D0A(B BBBA8�hm��"B�F�D �D(�G`� (A ABBA$�\n���a�k DM�S�VP�n���P�E�A �D(�G0U (G� H�D�B�Ed(A ABBF����(l@o��QF�D�K vAAC��4�to���E�D�G F HAID AAB(��o��kF�D�D �s ABLL�p��kJ�B�B �B(�A0�C8�D`� 8A0A(B BBBDL0q��&`Lq��@tXq���B�D�D �W ABDX FBHDCB8��q���N�[�W�R FS MR Nx HF0�Xr��~F�A�A �D0� AABH@(�s��2F�B�E �D(�A0�J�� 0A(A BBBGHl�t��F�H�B �E(�D0�A8�Gp� 8A0A(B BBBAH�dw��vF�E�B �E(�G0�A8�J�� 8A0A(B BBBJ�x��EE� �x���A�\�H AJ DXy��vA�Q ] AA<h�y���B�D�C �G0f CABDC AAB(�z���F�A�D ��EB,��z��nF�A�D �F ABDH{���B�E�B �B(�A0�A8�G�{ 8A0A(B BBBG0P<���+B�A�A �G�E AABD0�8���B�I�A �J�� AABD8�$���@B�B�A �A(�G�M (A ABBHL�(���F�D�D �Z CBCc ABJZ CBAM ABHHD���B�B�B �B(�D0�D8�G�� 8A0A(B BBBID�L����U�D�D �w ABI`���H ���L�H�D�0������B�A�C �J�F AABFX����F�B�B �B(�D0�A8�DPM 8A0A(B BBBD0XA`NhKpRP\h�����F�E�B �B(�A0�A8�G�� 8A0A(B BBBHt�R�]�A��$��������fDV�X���iK�X A���� 8$�����F�J�I �D(�D@� (A ABBF8`L����F�J�I �D(�D@� (A ABBF8���F�J�I �D(�D@� (A ABBF@�����pF�E�E �D(�G0�D@� 0A(A BBBDH����F�B�B �H(�A0�D8�D@] 8D0A(B BBBK(h�����S�� HFB�H��X���(�T����A�A�DP� AAJ\�����B�B�A �A(�D0A (A ABBAp (A ABBHS (A ABBA<4 �����B�E�E �D(�F0�B (A BBBAHt �����B�B�B �E(�D0�D8�K`~ 8A0A(B BBBJ� |���B� ����� ����� ����!̘��$!ؘ��8!��L!�4`!����bF�B�A �A(�D0M(A ABB�!4����!@���1�!l���dA�[�!����dA�[4�!���UM�I�D �c ABHIAB0"<���QD"����/4X"�����E�C�G j CACt CAA�"�����"����"����" ���@�",����F�D�A �U ABEJ ABKVCB$#ț��8#ԛ��IL#���3`#<���Wt#����T�#Ԝ��C0�#���sK�D�D �V ABAE���$�#\���BE�G�J eAA�#����OH$�����F�B�B �B(�A0�A8�DPe 8A0A(B BBBAX$���\H C E t$H����E�I M AD<�$�����O�B�D �A(�D0Y(A ABBG�����$����$���%���%(���(%4���<%@���!P%\���d%h���x%t���3�%����+�%�����H _ I�% ���%�%<���!�%X���0(�%t���YE�G�D@A AAA($&����RE�D�D@} AAAP&ܠ��Rd&(��� (x&$���Ya�J�J ^AAA�� �&X���jA�D0S AG �&�����A�T�� AA�&`����A�P O$'����_E�C�G MAA4'����0H'���mE�A�D B DAGOAD0|'@����F�D�D �G�� AABAH�'̣���F�B�B �B(�A0�D8�G�� 8A0A(B BBBGH�'���*F�B�B �B(�A0�A8�D`� 8A0A(B BBBGHH(� F�B�B �B(�A0�A8�D`� 8A0A(B BBBAH�(�����F�B�B �B(�A0�A8�GP� 8D0A(B BBBEL�(<����F�B�B �B(�A0�A8�G�( 8A0A(B BBBI,0)�����F�D�D �� AEG8`)<����F�A�A �G� B AABK�)����\�)����B�E�J �B(�D0�D8�FP� 8C0A(B BBBKD8F0A(B BBB*L���_E�g Lb40*����uF�A�D �{ ABGaABHh*ԫ��EB�B�B �E(�A0�A8�D`d 8A0A(B BBBA0�*ح��ZL�A�D �o ABEH���@�*����B�I�E �D(�A0�F`l 0A(A BBBAH,+�����F�B�B �B(�D0�D8�G`h 8A0A(B BBBCPx+����P�E�A �D(�G0Z (G� H�D�B�HD(A ABBF�����+`���1F�^�$�+����LA�D�G }AA(,����hF�A�D �n DBI4<,��F�A�D �G ABKiABHt,H���\F�B�B �B(�A0�D8�Dp( 8A0A(B BBBI@�,\����B�J�E �I(�C0�D@� 0A(A BBBGH-ص���F�B�B �B(�D0�D8�D`z 8A0A(B BBBDlP-L���� F�B�B �B(�D0�A8�D�[ 8A0A(B BBBF2�B�I�A�l�F�K�B��-����@�-����F�D�D �v ABI] ARHI FJG(.D���E�A�D@� AAH4D.��oE�E�G ~ AAGJ AAD |.@��fE�O0K AA@�.����F�B�B �A(�A0�DP| 0A(A BBBD�.8���.D��/P�� /L��4/H��!N�QA�LP/\���F�E�B �E(�A0�C8�D�@ 8A0A(B BBBD�/���"E�W�/�����/���@D_ EWH�/���zB�E�D �C(�G0e (C ABBFi(C ABB<0��ZP0\��d0h��`x0d��B�B�B �B(�A0�A8�HP� 8D0A(B BBBH� 8A0A(B BBBE@�0 ���F�E�E �A(�C0�GP� 0A(A BBBG 1���=@41����M�D�E �X ABGH ABM`CB0x14��bE�P�K j CABHDA\�1p��F�E�E �B(�D0�H8�K@� 8A0A(B BBBE\8A0A(B BBBH2 ���F�J�E �E(�D0�C8�G�W 8A0A(B BBBGHX2���jF�E�B �B(�A0�A8�D`� 8A0A(B BBBH$�2���BA�A�G rDA�2���H�2����B�B�G �B(�A0�A8�D@� 8A0A(B BBBGD,3p��8F�A�D �_ CBAK CBH@ AFIHt3h��hB�B�H �D(�A0�P (A BBBHm(D BBB4�3����A�A�D D DAAU MAM(�3���A��I B(N0IA C@$4����G�A�A �OABE���H ���� AH^4h4T��bB�E�H �D(�D0C(A ABB\�4���-F�B�B �E(�A0�C8�J�� 8A0A(B BBBA~�C�R�F�T5\�&F�E�B �E(�D0�D8�G@�HLPLHA@� 8D0A(B BBBF4X54��F�A�A �� ABFAABL�5��OF�B�B �E(�A0�A8�G�~ 8D0A(B BBBE<�5��hK�E�H �D(�D0@(A ABBA���� 6��)J�WG�P<6���O�E�I �E(�A0�A8�D@k 8A0A(B BBBCE�������6L�<�6X��F�L�B �D(�A0�� (A BBBEL�6��F�O�B �B(�A0�A8�G�Q 8A0A(B BBBCH47��_B�B�B �B(�A0�A8�DPC8D0A(B BBB(�7��AJ�A�D dAAK��H�7��@F�E�B �B(�A0�A8�D`� 8A0A(B BBBE�7���L8���M�E�E �D(�H0�� (D BBBAV (D BBBH0\8�����F�G�A �LPR AABHX�8����F�E�D �I(�D0h (D ABBCP (D ABBGW(D ABB�8����9����9����,9����>R`LD9����F�E�E �E(�D0�A8�D@m 8D0A(B BBBH,�98���>F�D�A �oABH�9H���"B�B�E �E(�A0�A8�D�� 8A0A(B BBBG(:,���_HQ F(G0E8F@LHEP\<<:`����F�E�D �A(�J�X (A ABBH|:��1(�:����A�A�G0� AAA8�:�����F�E�D �D(�G�� (A ABBA@�:0����F�E�B �D(�A0�G�� 0A(A BBBGL@;�����F�B�E �D(�A0�e (C BBBHa (C BBBFH�;���F�B�B �B(�A0�A8�D`� 8C0A(B BBBB��;���F�E�B �E(�A0�A8�N�c�`�J�G�F�H�I�G�C�B�B�B�B�B�M�k 8A0A(B BBBE(h<����E�J�GPd AAA@�<h����F�H�G �D(�D0�DpD 0A(A BBBC��<���F�B�B �B(�A0�A8�DP� 8A0A(B BBBG} 8F0A(B BBBDw 8A0A(B BBBG} 8C0A(B BBBG,l=0��pE�A�GP� AAE(�=p���A�A�F@p AAF0�=4���B�D�J �D@} AABK�=���4\>����F�E�L �E(�D0�F8�K@I 8A0A(B BBBD|8C0A(B BBB(p>|���E�A�D0n AAF�> ����>���(p�>����F�B�B �E(�D0�C8�G�� 8A0A(B BBBE��Z�Y�B�b�^�B�M�T��8?� ��F�E�E �E(�A0�A8�J� 8A0A(B BBBG��L�L�D�I���[�R�A�]�e�E�B�I�$�?x��(E�A�D YCAH�?����F�J�D �A(�D0C (D ABBK[(D ABB8@���)J�V�$T@���=E�C�G kAAd|@���R�B�E �D(�C0�B �(A� B�B�B�GF (A BBBCy�(A� B�B�B�4�@h��NF�A�A �J� AABE(A���%E�A�J�� AAG8HA���hF�B�A �D(�J�� (A ABBDH�A���3F�B�B �B(�A0�A8�D`� 8A0A(B BBBF�A���0�A����B�P�A �GPi AABILB4��eB�B�B �E(�D0�A8�G�1 8A0A(B BBBFHhBT���F�J�B �B(�A0�A8�G`Q 8A0A(B BBBH�B���s4�B4���F�A�A �k CBHgCBC���*I�`LC���9B�E�B �B(�A0�C8�G�! 8A0A(B BBBG`lC�'���F�E�J �E(�A0�D8�D@`HJPYHA@j 8C0A(B BBBC�HBPiHA@P�C)��iF�B�B �B(�A0�A8�G�� 8A0A(B BBBA`$D(7��B�E�B �B(�A0�A8�G@{ 8A0A(B BBBGL 8A0A(B BBBJ�D�7�� �D�7��-L�`�D8��4�D8��tF�G�A �p ABGhABEX8�� $ET8��,E�G�G IGD@E\8��HNXEd8���K�� AtE9���E9���E9�� �E�8���E9��3(�E49��oF�A�A �cAB(Fx9��SF�A�D �tQB0F�9�� DF�9��XF�9��PlF�9��vM�B�E �D(�D0�{ (A BFBFA(C BBBA�����$�F�9��,E�G�G IGDt�F�9���Y�B�B �B(�E0�A8�DP�8A0A(B BBBA������PP������~ 8F0A(B BBBC|`G;��B�B�B �B(�D0�D8�G@� 8J0G(B BBBNE 8A0A(B BBBA� 8C0A(B BBBG4�G�<��HF�B�G �D(�G0T(M DBBH�<��4,H�<��SJ�G�G N J�A�ODCAH��LdH=���M�I�D �D(�F0B (A ABBDD(C ABBD����$�HH=���E�D�G zAA�H�=���[u HP �HP>���A�T�� AA< I?��vF�D�G a AADRFAG��H ��4`IL?���F�D�D �h CBE ABF�I�?��IH@�I�?���px�I�@��{I]�IA��DH{�IDA��DH{J|A���H � E<,JB��@F�B�A �A(�G� (A ABBIlJD���K� F�J�D��YH`K AL�J�D��F�G�A �I(�D0$ (D ABBH= (D ABBJ$�J�H���E�C�G �AApKPI���k�E�A �C(�L@� (A ABBHP����H@����h����H@����Y (A ABBI8�K�J���F�E�D �D(�GP} (A ABBC@�K K��GF�E�E �D(�D0�G�� 0A(A BBBD8L,L��}F�E�D �D(�G@W (A ABBA,LLpL���E�A�IPr AAA$|L�L��YE�D�D IAA�LM��9�L4M��0L�LPM���F�B�B �B(�A0�A8�G�1 8A0A(B BBBHM�N��x0M�N���F�B�E �E(�D0�D8�D@P 8A0A(B BBBH� 8F0A(B BBBHD8F0A(B BBB(�M�O���E�A�F@t AAF�M4P���M@P�� N<P���N�P��-L�[0N�P��GE�z ALN�P�� 8`N�P��/F�B�D �A(�DP} (A ABBDl�N�Q���F�B�B �B(�A0�D8�J�% 8A0A(B BBBF��A�P�E�E�H�a�O`Y�� OlY��1J�Z�L<O�Y���F�B�E �E(�D0�K8�J�} 8A0A(B BBBF�O�[�� T�O�[���L�I�A �D(�G0A(C ABBF����H0����D(H ABBH�O\���B�B�E �B(�A0�A8�G`� 8D0A(B BBBEHDP�^�� F�B�B �B(�A0�A8�L�� 8A0A(B BBBKH�P�k��,F�B�B �A(�A0�G� L�@L�D� 0A(A BBBB,�Ppl��qK�A�H �PABI���LQ�l��UF�E�G �D(�G0N (M ABBKD(C ABB,\Q�l���B�A�D �� LBD$�Q`m��SA�R�G vAA�Q�m��fE�s He4�Q�m��8A�A�G [ AAJz AAD,R�n���F�H�D �� CBG$<Rpp��3E�H�D _AAdR�p��4xR�p���F�B�D �D(�D0�(A ABBD�Rq���B�A�A �� ABDW ABF~ ABGH�R�r���B�B�D �D(�D0� (D ABBDU(D ABB(DSHs���A�A�G � AAK0pS�s��B�A�D �G0q AABE<�S�t��KB�B�B �A(�A0�1 (A BBBH\�S�v���B�I�B �B(�A0�A8�J� } 8A0A(B BBBF�� I� _� A� \DT��%B�B�B �B(�D0�A8�J�� 8A0A(B BBBG$�F�d�A�(�T���A�I�D@V AAJ@�Tl����B�B�B �A(�A0�J�� 0A(A BBBE(U؆��A�A�G@� AAF@U̇��(E�^H\U���B�J�B �B(�D0�A8�Dp 8A0A(B BBBB8�U4����M�I�A �� ABAA FBG@�U�����F�D�D �I ABFK DBOACB (V��dX�_I�A�bLV0���MY�jE�hVd���MZ�hF��V����e�V�Uc�hE�\�V8����B�D�A �] ABIo DBKA CBJY DDE� DBE(W�����e�}F�h�P�H�@@Wl����B�B�B �A(�A0�GPl 0A(A BBBEH�W�����B�B�A �A(�D0N (A ABBBV(A ABBL�W�����F�B�B �E(�A0�A8�G�i 8A0A(B BBBEH Xl����B�B�B �B(�D0�A8�G`� 8A0A(B BBBI<lX ����A�D�G0n AAD` DAKUFAH�X�����F�B�B �E(�A0�A8�GPh 8A0A(B BBBF0�X$����B�A�A �G@` AABA4,Y����NF�H�A �j ABDFABtdY؛��|F�B�B �B(�D0�A8�Q�� 8A0A(B BBBF� �A�D�K�T���A�D�L�P�`�Y���F�B�B �B(�D0�A8�G`� 8C0A(B BBBE\ 8H0A(B BBBKP@Z|���MF�B�B �B(�A0�A8�D�I 8A0A(B BBBK�Zx���<�Zt���LB�E�B �A(�A0�& (A BBBH�Z���� E�Z([����zF�A�A �nAB0[ܿ��$D[��9E�D�D iAAl[���H�[����nF�B�B �B(�A0�A8�K�� 8A0A(B BBBD�[ ��7H` HF(�[@��9E�A�G 'CA0\T�� F�A�A �D�� AABCL\0��H`\,���F�B�B �B(�A0�D8�Dp� 8A0A(B BBBF4�\���OE�I�I0T AAC\AA�\���7L�fL]����M�B�E �B(�D0�A8�GPo8A0A(B BBBA������P],��#`d]H��]F�B�B �E(�A0�D8�GP� 8D0A(B BBBGD 8C0A(B BBBHH�]D���F�B�B �A(�A0�l (A BBBAA(F BBBH^����F�B�B �A(�A0�Y (E BBBHA(C BBB$`^���fE�D�D VAA�^��!�^0���^<��<�^h��/WT�^����^���|x_���F�B�B �B(�A0�A8�D` 8A0A(B BBBED 8F0A(B BBBEI8C0A(B BBBH�_���_F�B�B �B(�A0�A8�D`_ 8D0A(B BBBB��_���F�B�B �B(�A0�A8�DPE 8A0A(B BBBG| 8F0A(B BBBE_ 8F0A(B BBBJ\ 8F0A(B BBBA,d`��QF�D�A �tCNH�`��qF�B�B �E(�A0�D8�GP 8A0A(B BBBG�`�KP,�`$�cF�A�D �A CBGH(ad�vF�E�E �D(�D0�C (C BBBDA(F BBB8ta���F�B�A �A(�D0� (A ABBF�a� �a�3�aD�A�V�aH�HbT��B�E�E �B(�A0�A8�G@b 8C0A(E BBBH@Tb���B�E�B �A(�I0�G�� 0A(A BBBG�bD�O0�b���F�A�A �DP� AABA(�bL�dF�D�D �RABHc���F�E�E �E(�D0�A8�G�� 8A0A(B BBBD$XcD�vE�` K] Ce �c��kE�O@P AA@�c�� B�B�B �A(�A0�D�z 0A(A BBBB<�c���J�D�G n I�A�KD AABX��(d�4<d �hJ�D�G o I�A�JDAAB��\tdX�_F�B�E �B(�A0�A8�G���A�[�A�c 8A0A(B BBBF(�dX�JF�A�D �m ABEHe|�F�E�B �E(�A0�D8�J�� 8A0A(B BBBFLe0���&`eL���0teX���wE�D�D0i AAHtAA�e����HI�~�e���t�e���B�B�E �E(�G0�D8�D@p 8A0A(B BBBIT 8F0A(B BBBEP8F0A(B BBB@TfX���B�B�B �A(�A0�G�� 0A(A BBBF�f$���/L�b8�f8���kF�B�B �A(�A0�W(A BBBH�fl���rF�B�E �B(�A0�A8�G�e 8A0A(B BBBIL<g���� F�E�B �B(�A0�A8�G�� 8A0A(B BBBK8�g`���B�B�N �A(�G�K (A ABBEL�g$�� B�B�D �A(�G0� (A ABBHS (C ABBAth����F�B�B �B(�A0�A8�G�� 8A0A(B BBBEp�\�E�E�X�4�E�E�E�^��hL���hH��0�hT��gE�A�D B IAJDAA�h����i|���i��E�R,0i���I�A�C �o ABAP`i���i�B�B �A(�D0�Q (C BBBD������H0�����(�ix ��1B�D�D �^AD$�i� ��0E�F�G MIC8j� ���F�B�A �A(�D0� (A ABBADj8��<XjD��qE�I�L n AAFD FAEDGA4�j���wB�D�D �w ABDg ABA�j���La�jX�j��zB�B�D �D(�G�t (A ABBCH�G�E�E�D�J�j� Hk$ ��]P�mC�H�T,lk` ��qF�D�D �O ABHH�k� ��]B�B�B �B(�D0�D8�Gpl 8A0A(B BBBC,�k���F�A�A �� DBEDl����A�A�A ��ABF���X ���x���H ���L`l����F�B�B �A(�A0�� (A BBBDS (A BBBFH�l<���F�E�B �F(�D0�A8�DP� 8A0A(B BBBDH�l����F�E�E �B(�D0�A8�Gp� 8A0A(B BBBJLHmt���F�E�D �D(�G0s (F ABBHT (C ABBD<�m��3B�J�L �A(�A0�O (C BBBF�m��-\�m0���F�I�B �E(�D0�A8�G@w 8G0A(B BBBGb8A0A(B BBBLLn���F�B�B �B(�D0�A8�D�� 8A0A(B BBBEL�n�"��F�B�B �B(�A0�D8�D�� 8A0A(B BBBJ�n@&��oL&���o'��=E�wL0o<'��\F�B�A �D(�G0� (C ABBC� (F ABBA@�oL)���F�B�E �A(�D0�G@� 0A(A BBBJH�o�+��F�E�E �E(�A0�C8�D@� 8C0A(B BBBEHp�.���F�B�E �B(�D0�A8�Gpg 8A0A(B BBBDd\p06���F�B�B �B(�D0�A8�G`� 8A0A(B BBBH� 8M0A(B BBBN0�px9��RN�D�F YAAE��H ��8�p�:���l�A�A �����P ���C ABJ84q�;��jF�D�D �~ FBDL ABI(pq,=���F�M�A �P ABIx�q�=���F�B�B �B(�A0�A8�J�� 8A0A(B BBBGX�B�D�D�A�B�A�D�B�A�Z�HrdE��� F�B�D �D(�GP0XO`UXFPW (A ABBB(dr�O��KE�D�G � CAC�r�P��8�r�P���WH�r�Q���F�I�E �B(�D0�H8�Gp� 8D0A(B BBBJs�`��E(sa��QJ�A�G vD�A�PHsDa��T�B�J �E(�I0�D8�GP� 8A0A(B BBBHX������H�sb��bF�B�B �H(�A0�A8�D�� 8A0A(B BBBEH�s4f�� F�B�H �B(�A0�D8�DP� 8A0A(B BBBJ(4t�i��YJ�A�G yD�A�H`t,j���F�J�I �D(�D0V (C ABBAR(F ABBh�t�j���B�B�B �B(�A0�A8�G� L�@I�@� 8A0A(B BBBAv�@K�AH�AB�AI�@u�l��),u�l��1J�`F�HHu�l���F�E�F �E(�D0�D8�G`� 8D0A(B BBBHD�uho���E�K�G g(N0H(A H AAAT IHK�u�o��0Hg(�u�o���A�D�G@� AAA@ vLp���b�B�A �D(�G0~ (C ABBJP����dv�p��(@xv�p���F�A�D �e ABMS FBEACBH�v0q��NB�E�B �B(�A0�D8�Dp� 8A0A(B BBBC4w4r���A�F�D G ICJ] AAI@w�r��jA�h@\ws���B�B�E �D(�A0�DP� 0A(A BBBD(�w\u��vF�A�C �V ABE�w�u��HN@�w�u��aB�B�B �A(�D0�G@� 0A(A BBBHT(x�w���F�B�B �B(�A0�A8�D`� 8A0A(B BBBJbhDpFhH`H�x\y��TR�B�B �E(�D0�D8�F@� 8A0A(B BBBHH�xpz���B�E�B �E(�D0�A8�D�� 8A0A(B BBBKTy$}��DB�E�F �E(�D0�D8�GP` 8D0A(B BBBB�XM`QXAP`py���F�B�E �E(�A0�A8�G`"hNpExI�D�E�P`Q 8D0A(B BBBH`�yH���rF�B�B �B(�A0�A8�D`j 8A0A(B BBBJ� 8A0A(B BBBI$8zd���qA�A�G eAA4`z����MF�A�D �n DBIAAB(�zԂ���E�H�D0I AAD8�zH����F�D�E �A(�A0�| (A BBBD{����:Q�R EIH {܃���F�B�E �B(�A0�D8�G` 8A0A(B BBBK l{P���kA�G U ABl�{�����F�E�E �B(�A0�D8�D�� 8A0A(B BBBI��U�O�A���U�O�A�H|̊��F�G�E �E(�D0�C8�DP� 8A0A(B BBBBLL|����AB�B�A �D(�D0e (A ABBH� (A ABBE��|����ZF�E�E �B(�A0�A8�J�@ 8A0A(B BBBH��G�Z�A�Y�F�E�H�J�E�P���D�Z�A���U�S�B�$zRx��������,4��� L|} ���~B�B�J �B(�I0�D8�G�d 8A0A(B BBBFH�}P���8F�B�B �B(�A0�A8�D@� 8D0A(B BBBG~D���A�S4~H���)N�TF�HP~\����B�E�E �J(�I0�F8�DPe 8A0A(B BBBH0�~М��xB�A�D �J�� AABF8�~����F�B�A �A(�G�[ (A ABBFP�����[�B�B �A(�A0�7 (A BBBAP�����H0�����`L���LD ] GcH�|����F�B�B �B(�D0�D8�D@� 8D0A(B BBBD$�0���5E�D�I ZCA�H���KH������F�B�B �B(�A0�A8�D@� 8D0A(B BBBE\T�(���v F�E�E �B(�A0�A8�J�o 8A0A(B BBBI��R�[�B�0��H����F�D�D �D�� AABD��_��@����E�P Ku(������E�I�JPr AAD@H�T���F�B�J �I(�A0�I@b 0A(A BBBAH�� ����F�B�J �E(�D0�D8�G`~ 8A0A(B BBBBd���+�����F<�����}B�D�F �G0` AABIx AABp@�����F�N�N �B(�A0�A8�J�W 8A0A(B BBBG��G�W�A�a�D�V�A������'LȂ���F�E�E �B(�D0�A8�G� 8A0A(B BBBG�t���0,�����E�O�L G DALDFA\`�L���F�E�B �B(�A0�A8�G���I�U�H�k 8A0A(B BBBF�����!E�Wl܃��/F�E�B �B(�A0�D8�D`�hKpQhA`L 8A0A(B BBBD� 8A0A(B BBBAHL�����F�E�E �B(�D0�A8�D` 8A0A(B BBBF����)E�_H��(�� F�E�B �B(�A0�A8�Gp� 8A0A(B BBBG\����:F�E�B �E(�A0�A8�D� 8A0A(B BBBIM�D�S�A�`����!E�W|����_E�g Lb4�� ���F�A�D �T DBK|ABHԅ���.F�B�B �B(�A0�A8�DP� 8D0A(B BBBA �|��: 4�����E�Z Af JXX�T���F�E�E �E(�D0�D8�D`�hDpMxH�I`� 8A0A(B BBBJ4������F�N�A �D0[ AABH�0�+�L��H��(���L<����F�B�E �E(�D0�D8�I�� 8A0A(B BBBK0��`�LE�I�L ` CABDFAL��|�~B�B�B �B(�D0�D8�G� 8A0A(B BBBD,����F�A�H �g ABG@�l�0T�h��F�D�D �D0a AABI0�����E�A�G � CAFoCA����LЈ���F�B�B �A(�A0�� (A BBBC(A EBB$ �L�:E�D�D PUCH�d�UH�m KT h����H�H H|8��`��B�B�E �D(�H0�k (A BBBI`ȉ��jF�I�E �B(�D0�D8�G`} 8A0A(B BBBD� 8F0A(B BBBGd,���DF�B�B �E(�A0�A8�DP` 8C0A(B BBBGJ 8A0A(B BBBL����h0��4�ZE�D�J N QCKDIH(܊`�A�D�L0� AAH8�D�JB�B�A �A(�D`� (A ABBI(D�X�A�A�G0F AAG8p���B�G�E �A(�A0�n(D BBB0��@�CB�A�D �D0E AABDL�\�!F�B�B �B(�A0�D8�J� 8A0A(B BBBEL0�<���� F�B�E �B(�D0�A8�D�# 8A0A(B BBBK(��|��\E�D�G0_ AAG����������@Ԍ����B�B�B �A(�A0�D@q 0A(A BBBAL����SF�E�B �B(�A0�A8�D�� 8A0A(B BBBA@h� ���B�E�E �A(�D0�G@] 0A(A BBBA8��P ���F�K�D �A(�Dp} (A ABBC<�� ���F�G�A �D`nhKpPhA`\ AABD(�T��GH y AHD����-B�B�B �B(�A0�A8�G�� 8A0A(B BBBK���l��cF�E�B �E(�A0�A8�G�j�H�O�B�Q�P�H�L�B�V�V�H�L�D�V�^ 8A0A(B BBBI( �L��1A�A�J�� AAJHL�`��*F�B�B �E(�D0�D8�Dpm 8A0A(B BBBF8��D��{F�B�A �A(�DP (A ABBKHԏ����F�L�I �G(�D0�y (A LBBHA(F BBB\ �����M�A�D �� ABJt CBG� CBDf CBE\ ABA(�����E�A�G �AA����� ������Ԑ���(����AJ�D�G eAAD������ <,����F�E�D �D(�D�\ (A ABBAl��� ����������HN8����F�E�D �D(�D�\ (A ABBA4�D���F�H�I �m ABIZ ABC ����KP(8����7E�A�J bCAd���� x������� ��G��\��F�����qȒ ��ܒ ��9�< ��L�R(�@ ���A�F�G | AAD8�� ���4L�@!��x[�D�G U AAAkAAE��H���!��hF�B�B �B(�A0�A8�D`a 8A0A(B BBBCXГ�#���F�B�D �D(�G0c (A ABBAg (D ABBGD(H ABB,��#��5E�o0H�$���B�D�A �KP� AABD@|��$���F�A�A �E ABH` ABEFCBH��%��|B�E�E �E(�D0�D8�G@r 8D0A(B BBBAD�@%���K�D�D �G0M G�A�B�Oj HABK���$T��%��CA�D�G qDA4|��%��SF�D�G M CAFeAAA��4���%���E�D�G0d AAJD FAEd� &��kB�B�B �B(�A0�A8�Dp� 8D0A(B BBBCdxR�\xApexH�_xAppT�(+��>B�E�E �E(�A0�D8�DP` 8D0A(B BBBI�XN`MXAP�XO`NXBP�XN`MXAP0Ȗ�-��AN�A�G AAIP��(��/��YK�A�D �y�H�B�(�D/���(<��/���E�I�D r DAGh�40��S$|��0���U�n EC EP�,��1��fJ�D�G u AADP��,ԗH1��fJ�D�G u AADP��8��1��7O�D�D �� ABCh���H ���D@��2��@F�B�B �A(�A0�G�{ 0A(A BBBJ,���4��fJ�D�G u AADP��X���4���F�B�A �A(�D0Y (D ABBHD (D DBBHD(G DBB8�5��fK�D�D �v ABDACBJ���LP�L5���O�E�E �E(�D0�D8�G@�8A0A(B BBBB������8���5��FY�D�C �� CBHAFBG���ܙ7��T��6���F�B�B �A(�D0�D@� 0A(A BBBHY 0A(A BBBG8H�d8��lF�E�D �D(�D@I (A ABBA���8��HN8���8��iF�E�A �A(�D0� (D ABBH0ؚ�9���F�G�A �G�� AABEP��:���O�E�B �H(�H0�] (A BBBFA(C BBBF�����\`��:���F�B�B �E(�A0�A8�G`: 8A0A(B BBBA hEpAxC�c`���@��cj�[K�ܛ�@��.�A�� �A��hE�L AG(�dA���K�� APD��A���B�B�B �B(�A0�A8�G� L�,� 8A0A(B BBBF���Y��~H0] K���Y��mH0K E(МLZ���E�I�G`q AAH���Z���K�� A�t[���K�� A4�8\���K�� AP��\���K�� Al��]��1H h���]�� ���]�����]��@���]���B�E�B �D(�I0�G@} 0A(A BBBF8�h^���B�B�D �D(�G�G (A ABBH@��^��,E�fL\�_��$F�B�B �B(�A0�A8�G�J 8A0A(B BBBG0���c��\E�N�D j CAKDFA0�d��DA�D�K N DAMGGAH�8d���B�E�D �D(�D0~ (A ABBIU (F ABBHH`��d��� F�B�B �B(�A0�A8�G�� 8A0A(B BBBK��@n����Ln��ԟXn���Tn�� ��Pn���Ln��$�Xn��#8�tn��#L��n��#(`��n��rA�D�D@a AAA��o����o��I@��Ho���A�D�G B GAJD AAJc GAEL���o���B�B�B �B(�A0�G8�D�} 8A0A(B BBBAH�dt��Fl YH`��t���B�B�D �A(�G0F (A ABBD[(A ABB ���t���A�T�� AAС�u��H��u���B�B�B �I(�D0�D8�D`� 8C0A(B BBBC 0�,v��A�G � AKLT�(w��bM�B�E �I(�H0�� (A BBBEr(A BBB��Hx����Tx��$̢`x��BE�D�D rAA$��x��\E�H�J xGAL��x���F�B�B �B(�A0�A8�D�` 8A0A(B BBBA(l�z���E�A�D0} AAG���z�����z��GY�d CF4̣�z��zb�E�D �SABG���H ����{��&HXH� {��F�B�B �B(�A0�A8�DP� 8A0A(B BBBBh��{��?H`� H����zzKL������B�F�B �B(�D0�A8�G�� 8A0A(B BBBK�����QqH I����IqE I$�8���#H8�T���F�B�B �B(�A0�A8�DP� 8A0A(B BBBG,������F�A�F � ABG4��Ȉ��`F�A�F �] ABClAB,���B�A�A �i ABHH�P���B�B�B �B(�A0�A8�G�@ 8A0A(B BBBEHh�����B�B�I �E(�D0�D8�DPQ 8H0A(B BBBH(��X���Dp�A�A �CB�|��� 0�x����e�O�N n��H ��tAA(��E�L�D������B�B�B �B(�A0�A8�D�