%s %s %s %.0f %s %s Error writing to %s: %s Error closing %s: %s Done saving cookies. .edu.net.org.gov.mil.intDeleted old cookie (to be replaced.)
Stored cookie %s %d%s %s <%s> <%s> [expiry %s] %s %s Syntax error in Set-Cookie: %s at position %d.
PSL: Failed to load any PSL data. Falling back to insecure heuristics. libpsl unable to parse domain name. Falling back to simple heuristics. Cookie coming from %s attempted to set domain to Attempt to fake the path: %s, %s Cannot open cookies file %s: %s �?Length: %s, %s (%s) remaining, %s remaining (unauthoritative) ==> AUTH TLS ... anonymous-wget@Logging in as %s ... Error in server greeting. The server refuses login. Login incorrect. Logged in! ==> PBSZ 0 ... done. ==> PROT %c ... ==> SYST ... done. ==> PWD ... ==> TYPE %c ... done. ==> CWD not needed. changing working directory ==> CWD (%d) %s ... No such directory %s.
==> LIST ... accept: %s ab%s (%s) - Control connection closed. byteData transfer aborted. 425File %s exists. No such file %s. (try:%2d)--%s-- %s %s => %s %s URL: %s [%s] -> "%s" [%d] Removing %s. unlink: %s %s (%s) - %s saved [%s]
.listingRemoved %s. Rejecting %s. ../No matches on pattern %s. %s/%sCreating symlink %s -> %s symlink: %s Skipping directory %s. %s: corrupt time-stamp. Wrote HTML-ized index to %s. Server does not support AUTH TLS. Falling back to FTP. Could not initialize SSL. It will be disabled.Implicit FTPS was specified. Rewriting default port to %d. Error in server response. Closing. Error in server response, closing control connection. Write failed, closing control connection. Server did not accept the 'PBSZ 0' command. Server did not accept the 'PROT %c' command. Server error, can't determine system type.
VMS: I know it and I will use "LIST" as standard list command
UNIX MultiNet: I know it and I will use "LIST" as standard list command
UNIX TYPE L8: I know it and I will use "LIST -a" as standard list command Unknown type `%c', closing control connection. Prepended initial PWD to relative path: pwd: '%s' old: '%s' new: '%s' Using two-step CWD for relative path. Using extra "CWD []" step for VMS server. File has already been retrieved. Cannot initiate PASV transfer. trying to connect to %s port %d couldn't connect to %s port %d: %s
REST failed, starting from scratch. No such file or directory %s.
Lying FTP server found, adjusting. Server does not want to resume the SSL session. Trying with a new one. Could not perform SSL handshake. Resuming SSL session in data connection. %s (%s) - Data connection: %s; FTPS server rejects new SSL sessions in the data connection. LIST returned more data than "LIST -a": I will use "LIST" as standard list command LIST returned less data than "LIST -a": I will use "LIST -a" as standard list command LIST returned the same amount of data of "LIST -a": I will use "LIST -a" as standard list command "LIST -a" failed: I will use "LIST" as standard list command %s: %s, closing control connection. File %s already there; not retrieving. Server does not support AUTH TLS. Server does not like implicit FTPS connections. Removing file due to --delete-after in ftp_loop_internal(): %s (%s) - written to stdout %s[%s]
Using %s as listing tmp file. Error matching %s against %s: %s Composing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s'
Not descending to %s as it is excluded/not-included. Recursion depth %d exceeded max. depth %d. Remote file no newer than local file %s -- not retrieving. Remote file is newer than local file %s -- retrieving.
The sizes do not match (local %s) -- retrieving.
Invalid name of the symlink, skipping. Already have correct symlink %s -> %s
%s: unknown/unsupported file type. Failed to set permissions for %s. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). Wrote HTML-ized index to %s [%s]. |��\��<��t��t��t��t�������t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��t��������������������������������������������������������������������������������������������������������������������D���D��D��\��D��D��D��D��E���D��D��4�����D��D�����D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D��D������?���������������?���?���������������������������?���?����������?���?���?���?���?���?����������������?�����?���?���?���?���?���?���?���?������?���?�����?���?���?���?���?���?����input in flex scanner failedbad buffer in yy_scan_bytes()out of dynamic memory in yyensure_buffer_stack()out of dynamic memory in yy_create_buffer()fatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowout of dynamic memory in yy_get_next_buffer()fatal flex scanner internal error--no action foundout of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()��������������������������������������~���t���j���`���V���L���B���������������������������������������������������������������������������������"������� $R�Y�:.@ I .:$.�R@�!&C&&&&&&&&&&11**********0--10TN,J!-CJYJ�Y��0�-3�2"2T/346N=4/3/24/;466==4/��;�;<�HH�OUB+�O+<�U�<H 5�B~ �I~B�I5I5d5OU5B~M """MI5|5dd��|_�M""""""""""I�|_""""""_������`i��`i`i��""""""%%%%%%%%%%`ii�%%%%%%�w�jjwwww���`ii��%%%%%%88j��88888888888888888888888888888888888888888888888888888888888888888888888888>s��>>>>�������t}}�tst>�s�>y>yyyyyy��}��t��>��>�>AAAAAAAAAA�t��AAAAAA����c���cccc�����AAAAAADDDDD��c���D���c�DDDDDDDDDD��c�DDDDDDc��hg��hgggg����DDDDDDDPPPPP�Pg{�{{{{{{gPPPPPPPPPP��g�PPPPPP�g��������������PPPPPPPSSSSS�����������SSSSSSSSSSS����SSSSSS���}������z����SSSSSSSVVVVV�����V�����,VVVVVVVVVV��.�VVVVVV�������e���eeee�VVVVVVVZ���ZZZZ,�e�.�e��y��ZZZ�Z�Z��ZZZehj�e�j����ZZZZ�Z��ZZZ\\\\\\\\\\���\\\\\\g��������e�����\\\\\\^^^^^^^^^^da^^^^^^/�k/_^knk^�nnnn^^^^^^�kr ^krrrrn���n����� k�� kr��n�r�rn�������Y���r��1�Wr1rvvvvv/�0T�������<vvvvvvvvvv�/�0vvvvvv�<���������vvvvvvvxSxxxxxxx��>Mxx���������������Q�>Mx�xz�Nzzzzzzz11111z�z������N��z�z�����P ?��
no-follow in %s: %d %s: Invalid URL %s: %s codebackgroundlowsrcposterappletareabasebgsoundbodyembedformiframeimginputlayermetaobjectoverlayscripttabletdvideoaudio%s: no base, merge will use "%s". %s: Cannot resolve incomplete link %s. %s: merged link "%s" doesn't parse.
---request begin--- %s---request end--- Failed writing HTTP request: %s. Disabling further reuse of socket %d. Checking for Metalink in HTTP response Processing Content-Type header... Invalid Content-Type header. Ignoring. This is not a valid Link header. Ignoring. No rel value in Link header, skipping. When downloading signature: %s: %s. Unable to read signature content from temporary file. Skipping. Could not create temporary file. Skipping signature download. Invalid pri value. Assuming %d. Unsupported url scheme in %s. Skipping resource. This link header was not used for Metalink No valid metalink references found. Could not find acceptable digest for Metalink resources. Ignoring them. Unknown authentication scheme. Unsupported quality of protection '%s'. Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", qop=auth, nc=00000001, cnonce="%s"Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s"Inserted %s into basic_authed_hosts Disabling SSL due to encountered errors. gmtime failed. This is probably a bug. Cannot convert timestamp to http format. Falling back to time 0 as last modification time. %s, %02d %s %04d %02d:%02d:%02d GMTAuth-without-challenge set, sending Basic credentials. Found %s in basic_authed_hosts. Host %s has not issued a general basic challenge. application/x-www-form-urlencodedBODY data file %s missing: %s Reusing existing connection to [%s]:%d. Reusing existing connection to %s:%d. Failed reading proxy response: %s %s request sent, awaiting response... ---response begin--- %s---response end--- Registered socket %d for persistent reuse. Parsed filename from Content-Disposition: %s Parsed Strict-Transport-Security max-age = %s, includeSubDomains = %s Could not parse String-Transport-Security header Added new HSTS host: %s:%u (max-age: %lu, includeSubdomains: %s) Updated HSTS host: %s:%u (max-age: %lu, includeSubdomains: %s) Unrecognized Content-Encoding: %s Enabling broken server workaround. Will not decompress this GZip file. File %s not modified on server. Omitting download.
No extension found for encoding %d Server ignored If-Modified-Since header for file %s. You might want to add --no-if-modified-since option.
The file is already fully retrieved; nothing to do.
%s has sprung into existence. Warning: wildcards not supported in HTTP. File %s already there; not retrieving.
Spider mode enabled. Check if remote file exists. Required attribute missing from Header received. Username/Password Authentication Failed. Cannot write to temporary WARC file. Unable to establish SSL connection. ERROR: Redirection (%d) without location. Could not find Metalink data in HTTP response. Downloading file using HTTP GET. Metalink headers found. Switching to Metalink mode. Remote file does not exist -- broken link!!! Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file %s -- not retrieving.
The sizes do not match (local %s) -- retrieving. Remote file is newer, retrieving. Remote file exists and could contain links to other resources -- retrieving.
Remote file exists but does not contain any link -- not retrieving.
Remote file exists and could contain further links, but recursion is disabled -- not retrieving.
%s URL:%s [%s/%s] -> "%s" [%d] %s (%s) - Connection closed at byte %s. %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). %s (%s) - written to stdout %s[%s/%s]
%s:%sBasic EOF receivedSkipping %s bytes of body: [] aborting (%s). %.*s] done. .%d%sNo headers, assuming HTTP/0.9Content-TypeContent-Type: %s application/metalink4+xmlContent-DispositionfilenameURL=%s MEDIATYPE=%s NAME=%s PRIORITY=%d rel=%s describedbyapplication/pgp-signaturesiglen=%lu Signature (%s): %s duplicatepriftpsgeoprefThis resource has preference LinkrealmAuth scheme found '%.*s' BasicNTLMAuth param list '%s' Auth param %.*s=%.*s WWW-AuthenticateAuthentication selected: %s authMD5MD5-sessUnsupported algorithm '%s'. %08x00000001, opaque="%s", algorithm="%s"0123456789abcdefHEADGET?truefalse.br.Z.zlibRefererno-cacheCache-ControlPragmaIf-Modified-Sincebytes=%s-linux-gnuWget/%s (%s)User-Agent*/*AcceptAccept-EncodingidentityHostCloseKeep-AliveProxy-ConnectionContent-LengthpostpatchProxyProxy-AuthorizationReusing fd %d. CONNECTproxy responded with: [%s] Malformed status line%s ERROR %d: %s. Proxy tunneling failed: %s[BODY data: %s] [writing BODY file %s ... done] No data received. Read error (%s) in headers. Ignoring response Transfer-EncodingchunkedSet-Cookie(no description)Strict-Transport-SecurityincludeSubDomainsLocationLast-ModifiedX-Archive-Orig-last-modifiedContent-RangeContent-Encodingdeflatex-compressx-gzip.tgz [following]unspecifiedLocation: %s%s application/xhtml+xmltext/css.cssLength: ignoredSTDOUTSaving to: %s %s.tmp--%s-- %s %s --%s-- %s Cannot write to %s (%s). Cannot write to WARC file. Cannot unlink %s (%s). %s: Remote file exists.
%a, %d %b %Y %T%A, %d-%b-%y %T%a %b %d %T %Y%a, %d-%b-%Y %TopaquenonceqopalgorithmSunMonTueWedThuFriSat[%s][%s]:%d_���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���^���p���^��]p���^���^���o���^���o���^���^���^���^���^���^���^���^���^���^���^���^���^���^���U���^���^���^���^���^���^���^���^���^���p���^��]p���^���^���o���^���o���^���^���^���^���^���^���^���^���^���^���^���^���^���^���U���q���q���q��cp��M]���q��(����t�� x�� x���w���t��H{��(���(���(���(���(���(���(���(���(���(���(���(���{�� x��{�� x�� x�� x��(���(���(���(���(���(���(���(����t���t���y�� x��(����t�� x��(����t���y��(��� x���t���t��@y��H{��(���y���t���x���x���x��(���(���(���(���(���(����x��Thu, 01 Jan 1970WGET_ASKPASSSSH_ASKPASSlocalencoding%s: %s: Invalid value %s. bitsvmswindowslowercaseuppercasenocontrolasciiinfquiet%s: %s: Invalid header %s. %s: %s: Invalid number %s. Setting %s (%s) to %s no_proxyHOME%s/.wgetrc%s: Cannot read %s (%s). %s: Error in %s at line %d. SYSTEM_WGETRC/etc/wgetrcpemasn1autoIPv4IPv6posixpcresslv2sslv3tlsv1tlsv1_1tlsv1_2tlsv1_3pfsacceptacceptregexaddhostdiradjustextensionalwaysrestaskpasswordauthnochallengebackupconvertedbackupsbindaddressbodydatabodyfilecacertificatecadirectorycertificatetypecheckcertificatechooseconfigciphersconnecttimeoutcontentdispositioncontentonerrorcontinueconvertfileonlyconvertlinkscrlfilecutdirsdebugdefaultpagedeleteafterdirprefixdirstructdnscachednstimeoutdotbytesdotsinlinedotspacingdotstyleegdfileexcludedirectoriesexcludedomainsfollowftpfollowtagsforcehtmlftppasswdftppasswordftpproxyftpscleardataconnectionftpsfallbacktoftpftpsimplicitftpsresumesslftpuserglobhstsfilehtmlextensionhtmlifyhttpkeepalivehttppasswdhttppasswordhttpproxyhttpsonlyhttpsproxyhttpuserifmodifiedsinceignorecaseignorelengthignoretagsincludedirectoriesinet4onlyinet6onlyinputmetalinkkeepbadhashkeepsessioncookieslimitrateloadcookieslogfileloginmaxredirectmetalinkindexmetalinkoverhttpmethodmirrornoclobbernoconfignoparentnoproxynumtriesoutputdocumentpagerequisitespassiveftppinnedpubkeypostdatapostfilepreferfamilypreferredlocationpreservepermissionsprivatekeyprivatekeytypeprotocoldirectoriesproxypasswdproxypasswordproxyuserquotarandomfilerandomwaitreadtimeoutreclevelrecursiverefererregextyperejectrejectedlogrejectregexrelativeonlyremoteencodingremovelistingreportspeedrestrictfilenamesretrsymlinksretryconnrefusedretryonhttperrorsavecookiessaveheaderssecureprotocolserverresponseshowalldnsentriesshowprogressspanhostsstartposstrictcommentstimestampingtrustservernamesunlinkuseaskpassuseproxyuseragentuseservertimestampsverbosewaitretrywarccdxwarccdxdedupwarccompressionwarcdigestswarcfilewarcheaderwarckeeplogwarcmaxsizewarctempdirxattruse-askpass requires a string or either environment variable WGET_ASKPASS or SSH_ASKPASS to be set. %s: %s: Invalid time period %s %s: %s: Invalid restriction %s, use [unix|vms|windows],[lowercase|uppercase],[nocontrol],[ascii]. %s: %s must only be used once %s: %s: Invalid boolean %s; use `on' or `off'. %s: %s: Invalid %s; use `on', `off' or `quiet'. %s: %s: Invalid WARC header %s. %s: %s: Invalid byte value %s %s: %s: Invalid progress type %s. %s: WGETRC points to %s, which couldn't be accessed because of error: %s. %s: Syntax error in %s at line %d. %s: Unknown command %s in %s at line %d. Parsing system wgetrc file (env SYSTEM_WGETRC) failed. Please check '%s', or specify a different file using --config. Parsing system wgetrc file failed. Please check '%s', or specify a different file using --config. %s: Warning: Both system and user wgetrc point to %s. %s: Invalid --execute command %s l|���}���}���}��4}���}���}���}���}��L}���}���}���}���}���}��d}���}���}���}��|}��$@ �@N@�@u"A�A�@0ApB���C �@�0123456789ABCDEF%s: %s: %s wget-log %s received. Redirecting output to %s. %s: %s; disabling logging. SIGHUPSIGUSR1WTF?!%dd %dh %dm %ds%s/.wget-hsts %*c%s Wgetrc: Locale: Compile: Link: GNU Wget %s built on %s.
%s (env) %s (user) %s (system) /usr/share/locale2015Cannot create pipe Error spawning %s: %d wgetMemory allocation problem no-configExiting due to error in %s %s: illegal option -- `-n%c' dot%s: missing URL POSTbody-databody-filePassword for user %s: Password: Reading HSTS entries from %s %s: %s. Username for '%s%s': Password for '%s%s@%s': No URLs found in %s. Saving HSTS entries to %s Startup: Logging and input file: Download: Directories: HTTP options: HTTPS (SSL/TLS) options: HSTS options: FTP options: FTPS options: WARC options: Recursive download: Recursive accept/reject: accept-regexadjust-extensionappend-outputask-passwordauth-no-challengebackup-convertedbind-addressca-certificateca-directorycertificate-typecheck-certificateconnect-timeoutconvert-file-onlyconvert-linkscontent-dispositioncontent-on-errorcrl-filecut-dirsdefault-pagedirectory-prefixdns-cachedns-timeoutdont-remove-listingdot-styleegd-fileexclude-directoriesexclude-domainsexecutefollow-ftpfollow-tagsforce-directoriesforce-htmlftp-passwordftp-userftps-clear-data-connectionftps-fallback-to-ftpftps-implicitftps-resume-sslhelphost-directorieshsts-filehtml-extensionhttp-keep-alivehttp-passwdhttp-passwordhttp-userhttps-onlyignore-caseignore-lengthignore-tagsinclude-directoriesinet4-onlyinet6-onlyinput-fileinput-metalinkkeep-badhashkeep-session-cookieslimit-rateload-cookieslocal-encodingrejected-logmax-redirectmetalink-indexmetalink-over-httpnono-clobberno-parentoutput-documentoutput-filepage-requisitespassive-ftppost-datapost-fileprefer-familypreferred-locationpreserve-permissionsprivate-keyprivate-key-typeshow-progressprotocol-directoriesproxy__compatproxy-passwdproxy-passwordproxy-userrandom-filerandom-waitread-timeoutregex-typereject-regexrelativeremote-encodingreport-speedrestrict-file-namesretr-symlinksretry-connrefusedretry-on-http-errorsave-cookiessave-headerssecure-protocolserver-responsespan-hostsstart-posstrict-commentsif-modified-sincetrust-server-namesuse-askpassuse-server-timestampsuser-agentversionwarc-cdxwarc-compressionwarc-dedupwarc-digestswarc-filewarc-headerwarc-keep-logwarc-max-sizewarc-tempdirUsage: %s [OPTION]... [URL]... GNU Wget %s, a non-interactive network retriever. Copyright (C) %s Free Software Foundation, Inc. License GPLv3+: GNU GPL version 3 or later <http://www.gnu.org/licenses/gpl.html>. This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law.
Originally written by Hrvoje Niksic <hniksic@xemacs.org>. Please send bug reports and questions to <bug-wget@gnu.org>. Error initializing spawn file actions for use-askpass: %d Error setting spawn file actions for use-askpass: %d Error reading response from command "%s %s": %s Try `%s --help' for more options. Both --no-clobber and --convert-links were specified, only --convert-links will be used. Both --no-clobber and --convert-file-only were specified, only --convert-file-only will be used. Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot specify both --inet4-only and --inet6-only. Cannot specify both -k or --convert-file-only and -O if multiple URLs are given, or in combination with -p or -r. See the manual for details.
WARNING: combining -O with -r or -p will mean that all downloaded content will be placed in the single file you specified.
WARNING: timestamping does nothing in combination with -O. See the manual for details.
WARC output does not work with --no-clobber, --no-clobber will be disabled. WARC output does not work with timestamping, timestamping will be disabled. WARC output does not work with --spider. WARC output does not work with --continue or --start-pos, they will be disabled. Digests are disabled; WARC deduplication will not find duplicate records. Compression does not work with --continue or --start-pos, they will be disabled. Cannot specify both --ask-password and --password. Specifying both --start-pos and --continue is not recommended; --continue will be disabled. You cannot specify both --post-data and --post-file. You cannot use --post-data or --post-file along with --method. --method expects data through --body-data and --body-file options You must specify a method through --method=HTTPMethod to use with --body-data or --body-file. You cannot specify both --body-data and --body-file. DEBUG output created by Wget %s on %s.
-k or -r can be used together with -O only if outputting to a regular file. --convert-links or --convert-file-only can be used together only if outputting to a regular file. ERROR: could not open HSTS store at '%s'. HSTS will be disabled. ERROR: could not open HSTS store. HSTS will be disabled. Removing file due to --delete-after in main(): Unable to parse metalink file %s. Could not download all resources from %s. FINISHED --%s-- Total wall clock time: %s Downloaded: %d files, %s in %s (%s) Download quota of %s EXCEEDED! Mandatory arguments to long options are mandatory for short options too.
-V, --version display the version of Wget and exit -h, --help print this help -b, --background go to background after startup -e, --execute=COMMAND execute a `.wgetrc'-style command -o, --output-file=FILE log messages to FILE -a, --append-output=FILE append messages to FILE -d, --debug print lots of debugging information -q, --quiet quiet (no output) -v, --verbose be verbose (this is the default) -nv, --no-verbose turn off verboseness, without being quiet --report-speed=TYPE output bandwidth as TYPE. TYPE can be bits -i, --input-file=FILE download URLs found in local or external FILE --input-metalink=FILE download files covered in local Metalink FILE -F, --force-html treat input file as HTML -B, --base=URL resolves HTML input-file links (-i -F) relative to URL --config=FILE specify config file to use --no-config do not read any config file --rejected-log=FILE log reasons for URL rejection to FILE -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits) --retry-connrefused retry even if connection is refused --retry-on-http-error=ERRORS comma-separated list of HTTP errors to retry -O, --output-document=FILE write documents to FILE -nc, --no-clobber skip downloads that would download to existing files (overwriting them) --no-netrc don't try to obtain credentials from .netrc -c, --continue resume getting a partially-downloaded file --start-pos=OFFSET start downloading from zero-based position OFFSET --progress=TYPE select progress gauge type --show-progress display the progress bar in any verbosity mode -N, --timestamping don't re-retrieve files unless newer than local --no-if-modified-since don't use conditional if-modified-since get requests in timestamping mode --no-use-server-timestamps don't set the local file's timestamp by the one on the server -S, --server-response print server response --spider don't download anything -T, --timeout=SECONDS set all timeout values to SECONDS --dns-timeout=SECS set the DNS lookup timeout to SECS --connect-timeout=SECS set the connect timeout to SECS --read-timeout=SECS set the read timeout to SECS -w, --wait=SECONDS wait SECONDS between retrievals --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval --random-wait wait from 0.5*WAIT...1.5*WAIT secs between retrievals --no-proxy explicitly turn off proxy -Q, --quota=NUMBER set retrieval quota to NUMBER --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host --limit-rate=RATE limit download rate to RATE --no-dns-cache disable caching DNS lookups --restrict-file-names=OS restrict chars in file names to ones OS allows --ignore-case ignore case when matching files/directories -4, --inet4-only connect only to IPv4 addresses -6, --inet6-only connect only to IPv6 addresses --prefer-family=FAMILY connect first to addresses of specified family, one of IPv6, IPv4, or none --user=USER set both ftp and http user to USER --password=PASS set both ftp and http password to PASS --ask-password prompt for passwords --use-askpass=COMMAND specify credential handler for requesting username and password. If no COMMAND is specified the WGET_ASKPASS or the SSH_ASKPASS environment variable is used. --no-iri turn off IRI support --local-encoding=ENC use ENC as the local encoding for IRIs --remote-encoding=ENC use ENC as the default remote encoding --unlink remove file before clobber --keep-badhash keep files with checksum mismatch (append .badhash) --metalink-index=NUMBER Metalink application/metalink4+xml metaurl ordinal NUMBER --metalink-over-http use Metalink metadata from HTTP response headers --preferred-location preferred location for Metalink resources --xattr turn on storage of metadata in extended file attributes -nd, --no-directories don't create directories -x, --force-directories force creation of directories -nH, --no-host-directories don't create host directories --protocol-directories use protocol name in directories -P, --directory-prefix=PREFIX save files to PREFIX/.. --cut-dirs=NUMBER ignore NUMBER remote directory components --http-user=USER set http user to USER --http-password=PASS set http password to PASS --no-cache disallow server-cached data --default-page=NAME change the default page name (normally this is 'index.html'.) -E, --adjust-extension save HTML/CSS documents with proper extensions --ignore-length ignore 'Content-Length' header field --header=STRING insert STRING among the headers --compression=TYPE choose compression, one of auto, gzip and none. (default: none) --max-redirect maximum redirections allowed per page --proxy-user=USER set USER as proxy username --proxy-password=PASS set PASS as proxy password --referer=URL include 'Referer: URL' header in HTTP request --save-headers save the HTTP headers to file -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION --no-http-keep-alive disable HTTP keep-alive (persistent connections) --no-cookies don't use cookies --load-cookies=FILE load cookies from FILE before session --save-cookies=FILE save cookies to FILE after session --keep-session-cookies load and save session (non-permanent) cookies --post-data=STRING use the POST method; send STRING as the data --post-file=FILE use the POST method; send contents of FILE --method=HTTPMethod use method "HTTPMethod" in the request --body-data=STRING send STRING as data. --method MUST be set --body-file=FILE send contents of FILE. --method MUST be set --content-disposition honor the Content-Disposition header when choosing local file names (EXPERIMENTAL) --content-on-error output the received content on server errors --auth-no-challenge send Basic HTTP authentication information without first waiting for the server's challenge --secure-protocol=PR choose secure protocol, one of auto, SSLv2, SSLv3, TLSv1, TLSv1_1, TLSv1_2 and PFS --https-only only follow secure HTTPS links --no-check-certificate don't validate the server's certificate --certificate=FILE client certificate file --certificate-type=TYPE client certificate type, PEM or DER --private-key=FILE private key file --private-key-type=TYPE private key type, PEM or DER --ca-certificate=FILE file with the bundle of CAs --ca-directory=DIR directory where hash list of CAs is stored --crl-file=FILE file with bundle of CRLs --pinnedpubkey=FILE/HASHES Public key (PEM/DER) file, or any number of base64 encoded sha256 hashes preceded by 'sha256//' and separated by ';', to verify peer against --ciphers=STR Set the priority string (GnuTLS) or cipher list string (OpenSSL) directly. Use with care. This option overrides --secure-protocol. The format and syntax of this string depend on the specific SSL/TLS engine. --no-hsts disable HSTS --hsts-file path of HSTS database (will override default) --ftp-user=USER set ftp user to USER --ftp-password=PASS set ftp password to PASS --no-remove-listing don't remove '.listing' files --no-glob turn off FTP file name globbing --no-passive-ftp disable the "passive" transfer mode --preserve-permissions preserve remote file permissions --retr-symlinks when recursing, get linked-to files (not dir) --ftps-implicit use implicit FTPS (default port is 990) --ftps-resume-ssl resume the SSL/TLS session started in the control connection when opening a data connection --ftps-clear-data-connection cipher the control channel only; all the data will be in plaintext --ftps-fallback-to-ftp fall back to FTP if FTPS is not supported in the target server --warc-file=FILENAME save request/response data to a .warc.gz file --warc-header=STRING insert STRING into the warcinfo record --warc-max-size=NUMBER set maximum size of WARC files to NUMBER --warc-cdx write CDX index files --warc-dedup=FILENAME do not store records listed in this CDX file --no-warc-compression do not compress WARC files with GZIP --no-warc-digests do not calculate SHA1 digests --no-warc-keep-log do not store the log file in a WARC record --warc-tempdir=DIRECTORY location for temporary files created by the WARC writer -r, --recursive specify recursive download -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite) --delete-after delete files locally after downloading them -k, --convert-links make links in downloaded HTML or CSS point to local files --convert-file-only convert the file part of the URLs only (usually known as the basename) --backups=N before writing file X, rotate up to N backup files -K, --backup-converted before converting file X, back up as X.orig -m, --mirror shortcut for -N -r -l inf --no-remove-listing -p, --page-requisites get all images, etc. needed to display HTML page --strict-comments turn on strict (SGML) handling of HTML comments -A, --accept=LIST comma-separated list of accepted extensions -R, --reject=LIST comma-separated list of rejected extensions --accept-regex=REGEX regex matching accepted URLs --reject-regex=REGEX regex matching rejected URLs --regex-type=TYPE regex type (posix|pcre) -D, --domains=LIST comma-separated list of accepted domains --exclude-domains=LIST comma-separated list of rejected domains --follow-ftp follow FTP links from HTML documents --follow-tags=LIST comma-separated list of followed HTML tags --ignore-tags=LIST comma-separated list of ignored HTML tags -H, --span-hosts go to foreign hosts when recursive -L, --relative follow relative links only -I, --include-directories=LIST list of allowed directories --trust-server-names use the name specified by the redirection URL's last component -X, --exclude-directories=LIST list of excluded directories -np, --no-parent don't ascend to the parent directory Email bug reports, questions, discussions to <bug-wget@gnu.org> and/or open issues at https://savannah.gnu.org/bugs/?func=additem&group=wget. �5��p5��`5��85���4���6���4���5���4��|6���K���K���K���K���K���K���K���K���K���K���K���K���K���K���K���K���K���K���K���K���K���K���K���K���K���K��\6��<6���K���K���K���K���K���K���K���K���K���K���K��6���K���K���K���K���K���5���?forceportaccountmacdefdefaultmachine.netrc%s: %s:%d: unknown token "%s" %s: %s:%d: warning: %s token appears before any machine name �t���x��8x��Xv���w���w��v��(w��%dm%s%ds%dh%s%dm%dd%s%dh%dd binarymegagiga %4.*f%c=%ss%3d%% %6sK %*s[ skipping %sK ] %4.*f%s in barnoscroll b/sKb/sMb/sGb/s B/sKB/sMB/sGB/sInvalid dot style specification %s; leaving unchanged. KMG eta %s333333�?@�����X@= ףp�#@�����AY@@�G�z��?�������?Cannot get REALTIME clock frequency: %s ����MbP?e��ADequeuing %s at depth %d Queue count %d, maxcount %d. NoneEnqueuing %s at depth %d [IRI Enqueuing %s with %s Already on the black list. The domain was not accepted. Decided to load it. Decided NOT to load it. SCHEME_HTTPSCHEME_HTTPSSCHEME_FTPSSCHEME_FTPSCHEME_INVALID%s %s %s %i %s %s %s %sSUCCESSBLACKLISTNOTHTTPSNONHTTPABSOLUTEDOMAINPARENTREGEXRULESSPANNEDHOSTROBOTSUNKNOWN%s --delete-afterrecursive rejection criteria--spiderDeciding whether to enqueue "%s". download_child: parent->url is: %s Not following non-HTTPS links. Not following non-HTTP schemes. It doesn't really look like a relative link. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. %s is excluded/not-included through regex. %s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Not following %s because robots.txt forbids it. REASON U_URL U_SCHEME U_HOST U_PORT U_PATH U_PARAMS U_QUERY U_FRAGMENT P_URL P_SCHEME P_HOST P_PORT P_PATH P_PARAMS P_QUERY P_FRAGMENT Already downloaded "%s", reusing it from "%s". Ignoring decision for redirects, decided to load it. Redirection "%s" failed the test. Not descending further; at depth %d, max. %d. Not following due to 'ignore' flag: %s Not following due to 'link inline' flag: %s Removing file due to %s in recursive_retrieve(): Removing %s since it should be rejected. ��������������,���<���L���\���l���|�����������Ignoring malformed line %d disallowCannot open %s: %sAllowingRejecting/robots.txtIgnoring unknown field at line %d %s path %s because of rule %s. Loading robots.txt; please ignore errors. http_proxyhttps_proxyftps_proxyftp_proxy1.2.11%.*f %s%d redirections exceeded. Giving up.
Retrying.
Failed to unlink %s: (%d) %s %s%s%dzlib stream ended unexpectedly after %ld/%ld bytes deferring a %.2f ms sleep (%s/%.2f).
sleeping %.2f ms for %s bytes, adjust %.2f ms zlib read size differs from raw read size (%lu/%lu) Error parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. URL transformed to HTTPS due to an HSTS policy [IRI fallbacking to non-utf8 for %s [Needn't fallback to non-utf8 for %s [Couldn't fallback to non-utf8 for %s sleep_between_retrievals: avg=%f,sleep=%f Removing file due to --delete-after in retrieve_from_file(): Failed to rename %s to %s: (%d) %s ffffff�?@�@�Found no broken links.
Found %d broken links.
Found %d broken link.
%2E%2E:/0123456789ftp://%shttp://%sHTTPS support not compiled inUnsupported scheme %sFailed to unlink %s (%d): %s UTF-8Unhandled errno %d Trying to shorten... New name is %s. *password*-_.!~*'();:&=+$,No errorScheme missingInvalid host nameBad port numberInvalid user nameIPv6 addresses not supportedInvalid IPv6 numeric addresshttp://https://ftp://ftps://Removing %s because of directory danger! Conversion from %s to %s isn't supported Converted file name '%s' (%s) -> '%s' (%s) Incomplete or invalid multibyte sequence encountered Unconvertable multibyte sequence encountered Failed to convert file name '%s' (%s) -> '?' (%s) The name is too long, %lu chars total. Unterminated IPv6 numeric address
Error opening WARC file %s. warcinfoWARC-Typeapplication/warc-fieldsWARC-Record-IDWARC-Filenamesoftware: Wget/%s (%s) robots: %s wget-arguments: %s wb9WARC/1.0 application/octet-streamWARC-Warcinfo-IDWARC-Concurrent-To CDXCould not open WARC file. Loaded %d records from CDX.
Loaded %d record from CDX.
metadatatext/plainresourcerequestrevisitWARC-Refers-ToWARC-ProfileWARC-Truncatedformat: WARC File Format 1.0 conformsTo: http://bibnum.bnf.fr/WARC/WARC_ISO_28500_version1_latestdraft.pdf Error writing warcinfo record to WARC file. Error duplicating WARC file file descriptor. Error opening GZIP stream to WARC file. CDX file does not list checksums. (Missing column 'k'.) CDX file does not list record ids. (Missing column 'u'.) Could not read CDX file %s for deduplication. Could not open temporary WARC manifest file. Could not open temporary WARC log file. Could not open CDX file for output. CDX file does not list original urls. (Missing column 'a'.) metadata://gnu.org/software/wget/warc/MANIFEST.txtCould not open temporary WARC file. metadata://gnu.org/software/wget/warc/wget_arguments.txtmetadata://gnu.org/software/wget/warc/wget.logapplication/http;msgtype=requestFound exact match in CDX file. Saving revisit record to WARC. http://netpreserve.org/warc/1.0/revisit/identical-payload-digestapplication/http;msgtype=response%s %s %s %s %d %s %s - %s %s %s Failed to set xattr %s. user.xdg.origin.urluser.xdg.referrer.url*?[]aprintf%Y-%m-%d %H:%M:%Sutime(%s): %s Unlinking %s (symlink). Failed to Fopen file %s Failed to get FD for file %s htm%.*f%cfork/dev/nullError while matching %s: %d %.0f%.1f%.1g%.3fpathconf%02x;sha256//-----BEGIN PUBLIC KEY----- -----END PUBLIC KEY-----%s: %s: Failed to allocate enough memory; memory exhausted. Failed to unlink symlink %s: %s Failed to stat file %s, (check permissions) File %s changed since the last check. Security check failed.Failed to open file %s, reason :%s Failed to stat file %s, error: %s Trying to open file %s but it changed since last check. Security check failed.Continuing in background, pid %d. Output will be written to %s. Failed to redirect stdin to /dev/null. Failed to redirect stdout to /dev/null. Failed to redirect stderr to /dev/null. Invalid regular expression %s, %s Skipping key with wrong size (%d/%d): %s �������������������������������������������>���?456789:;<=�������
������ !"#$%&'()*+,-./0123�����ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/KMGTPEP?�����Afffff�#@����Mb@? -cares+digest+gpgme+https+ipv6+iri+large-file+metalink+nls+ntlm+opie+psl+ssl/gnutlsEncoding %s isn't valid charset=ASCIIutf-8idn_encode failed (%d): %s URI encoding = %s URI content encoding = %s converted '%s' (%s) -> '%s' (%s) logging suppressed, strings may contain password locale_to_utf8: locale is unset %s%s%s.badhashRenaming %s to %s. Storing to %s Metalink/HTTPMetalink/XMLRetrieving from Metalink %s .# --trust-server-names %s --directory-prefix %s Counted metalink file %u Planned metalink file %s Trusted metalink file %s Current metalink file %s Cleaned metalink file %s Secured metalink file %s Planned metalink file: %s Ordinal number %d: %s Processing metaurl %s... .meta#No checksums found. Computing size for %s Declared size: %lld Computed size: %lld Size mismatch for file %s. Size matches. md2md4md5sha1sha-1sha224sha-224sha256sha-256sha384sha-384sha512sha-512Computing checksum for %s Declared hash: %s Computed hash: %s Checksum matches. GPGME data_new_from_fd: %s GPGME new: %s Verifying signature %s: %s GPGME set_protocol: %s GPGME data_new_from_mem: %s GPGME op_verify: %s GPGME op_verify_result: NULL Checking signature %s GPGME: %s Secured metalink file: %s -O not supported for metalink download. Ignoring. Processing metalink file %s... [--trust-server-names %s, --directory-prefix=%s] Searching application/metalink4+xml ordinal number %d... Rejecting metaurl file %s. Unsafe name. Failed to download %s. Skipping metaurl. Unable to parse metaurl file %s. Metaurls processing returned with error. Resource type %s not supported, ignoring... Previous resource failed, continue with next resource. Could not open downloaded file. File size not declared. Skipping check. Could not get downloaded file's size. Ignoring unsupported checksum type %s. Checksum mismatch for file %s. Could not open downloaded file for signature verification. Signature validation succeeded. Invalid signature. Rejecting resource. Data matches signature, but signature is not trusted. File %s retrieved but size does not match. File %s retrieved but checksum does not match. File %s retrieved but signature does not match. Failed to download %s. Skipping resource. Rejecting metalink file. Unsafe name. gcc -I/usr/include/p11-kit-1 -DHAVE_LIBGNUTLS -DNDEBUG -O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protection -Wl,-z,relro -Wl,-z,now -specs=/usr/lib/rpm/redhat/redhat-hardened-ld -lpcre -luuid -lidn2 -L/usr/lib64 -lgpgme -lmetalink -lnettle -lgnutls -lz -lpsl ftp-opie.o gnutls.o http-ntlm.o ../lib/libgnu.a gcc -DHAVE_CONFIG_H -DSYSTEM_WGETRC="/etc/wgetrc" -DLOCALEDIR="/usr/share/locale" -I. -I../lib -I../lib -I/usr/include/p11-kit-1 -DHAVE_LIBGNUTLS -DNDEBUG -O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protection1.19.5wrote %s to STORE (unknown)GnuTLS: %s /etc/ssl/certsLoaded CA certificate '%s' Loaded CRL file '%s' Certificates loaded: %d NORMAL:-VERS-SSL3.0PFS:-VERS-SSL3.0NORMAL:-RSA:-VERS-SSL3.0ERRORWARNINGNo certificate found The certificate has expired Certificate must be X.509 GnuTLS: received alert [%u]: %s GnuTLS: *** REHANDSHAKE while reading GnuTLS: *** re-authentication while reading ERROR: Cannot open directory %s. WARNING: Failed to open cert %s: (%d). ERROR: Failed to open cert %s: (%d). ERROR: Failed to load CRL file '%s': (%d) ERROR: GnuTLS requires the key and the cert to be of the same type. NORMAL:-VERS-TLS-ALL:+VERS-SSL3.0NORMAL:-VERS-SSL3.0:-VERS-TLS1.0NORMAL:-VERS-SSL3.0:-VERS-TLS1.0:-VERS-TLS1.1NORMAL:-VERS-SSL3.0:+VERS-TLS1.3:-VERS-TLS1.0:-VERS-TLS1.1:-VERS-TLS1.2GnuTLS: unimplemented 'secure-protocol' option value %u SSL session has already been resumed. Continuing. WARNING: Could not save SSL session data for socket %d %s: No certificate presented by %s. %s: The certificate of %s is not trusted. %s: The certificate of %s hasn't got a known issuer. %s: The certificate of %s has been revoked. %s: The certificate signer of %s was not a CA. %s: The certificate of %s was signed using an insecure algorithm. %s: The certificate of %s is not yet activated. %s: The certificate of %s has expired. Error initializing X509 certificate: %s Error parsing certificate: %s The certificate has not yet been activated The certificate's owner does not match hostname %s The public key does not match pinned public key! L���l���l�����������̜���������NTLM Received a type-2 NTLM message. Unexpected empty NTLM message. Empty NTLM message, starting transaction. Creating a type-1 NTLM message. NTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%s%sCreating a type-3 NTLM message. NTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c��%c%c�%c%cH���H���p���H���H���KGS!@#$%ABCDEFGHIJKLMNOPQRSTUVWXYZ234567�����������������������������������������������������������