invalid type, Data base error The Subject's Distinguished Name is as follows
emailAddress type needs to be of type IA5STRING
The string contains characters that are illegal for the ASN.1 type %s:unknown object type in 'policy' configuration The %s field needed to be supplied and was missing The mandatory %s field was missing The %s field does not exist in the CA certificate, the 'policy' is misconfigured The %s field is different between CA certificate (%s) and the request (%s) %s:invalid type in 'policy' configuration Everything appears to be ok, creating and signing the certificate Extra configuration file found ERROR: adding extensions in section %s Successfully added extensions from file. Successfully added extensions from config ERROR: adding extensions from request The subject name appears to be ok, checking data base for clashes ERROR:There is already a certificate for %s ERROR:Serial number %s has already been issued, check the database/serial_file for corruption Certificate is to be certified until CERTIFICATE WILL NOT BE CERTIFIED: I/O error CERTIFICATE WILL NOT BE CERTIFIED The matching entry has the following details Error reading certificate request in %s Check that the request matches the signature Certificate request and CA private key do not match Signature verification problems.... Signature did not match the certificate request Invalid global string mask setting %s CA certificate and CA private key do not match Invalid certificate options: "%s" Invalid extension copy option: "%s" there needs to be defined a directory for new certificate to be placed in entry %d: not revoked yet, but has a revocation date entry %d: invalid expiry date entry %d: bad serial number length (%d) entry %d: bad char 0%o '%c' in serial number %d entries loaded from the database No entries found to mark expired Done. %d entries marked as expired Successfully loaded extensions file %s Error Loading extension section %s start date is invalid, it should be YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ end date is invalid, it should be YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ cannot lookup how many days to certify for error generating serial number error while loading serial number unable to find 'section' for %s no name/value pairs found in %s unable to load Netscape SPKAC structure Netscape SPKAC structure not found in %s Check that the SPKAC request matches the signature error unpacking SPKAC public key signature verification failed on SPKAC public key Signature did not match the certificate
%d out of %d certificate requests certified, commit? [y/n]CERTIFICATION CANCELED: I/O error Write out database with %d new entries certificate file name too long Error Loading CRL extension section %s error while loading CRL number cannot lookup how long until the next CRL is issued Verbose output during processingThe particular CA definition to useUse arg instead of request's subjectInput characters are UTF8 (default ASCII)If reading serial fails, create a new random serialAlways create a random serial; do not store itEnable support for multivalued RDNsYYMMDDHHMMSSZ cert notAfter (overrides -days)Number of days to certify the cert formd to use; see openssl help for listPrivate key file format (PEM or ENGINE)Key to decode the private key if it is encryptedSign a cert with the key associated with itThe input PEM encoded cert request(s)Where to put the output file(s)Signature parameter in n:v formDo not print the generated certificateDon't add the EMAIL field to the DNmsie modifications to handle all those universal stringsDays until the next CRL is dueHours until the next CRL is dueSeconds until the next CRL is dueThe last argument, requests to processFile contains a self signed cert to signFile contains DN and signed public key and challengeAdd a Valid(not-revoked) DB entry about a cert (given in file)Extension section (override value in config file)Configuration file with X509v3 extensions to addShows cert status given the serial numberCRL extension section (override value in config file)the hold instruction, an OID. Sets revocation reason to certificateHoldsets compromise time to val and the revocation reason to keyCompromisesets compromise time to val and the revocation reason to CACompromiseLoad the file(s) into the random number generatorWrite random data to the specified fileUse engine, possibly a hardware device0123456789ABCDEFUNKNOWNOpenSSL cipher name: %s Error in cipher list 0x%02X,0x%02X - %s - Even more verboseOnly supported ciphersTLS1 modeTLS1.1 modeTLS1.2 modeTLS1.3 modestdnameShow standard cipher namespskconvertciphersuitesError setting TLSv1.3 ciphersuites 0x%02X,0x%02X,0x%02X,0x%02X - Verbose listing of the SSL/TLS ciphersinclude ciphersuites requiring PSKinclude ciphersuites requiring SRPConvert standard name into OpenSSL nameConfigure the TLSv1.3 ciphersuites to useDX���W��tY��\Y��LY��<Y��,Y��Y��Y���X���X���X���X���W���W���X��rbInvalid key %s Invalid id %s Invalid OID %s recipient certificate fileNo key specified key param bufferapps/cms.cNo secret key id signing key fileError reading S/MIME message Can't read content file %s Error writing certs to %s Can't open receipt file %s Bad input format for receipt Error reading receipt signer certificateError creating CMS structure Verification successful Verification failure Error writing signers to %s Signer %d: No Receipt Request Signed Content ID: Receipts From List: : First Tier : All Unknown (%d) Receipts To: To: %s%sFrom: %s%sSubject: %s%sValid options are: outformInput fileOutput fileEncrypt messageDecrypt encrypted messageSign messagesign_receiptresignResign a signed messageVerify signed messageverify_retcodeverify_receiptcmsoutOutput CMS structuredata_outdata_createdigest_verifydigest_createuncompressEncryptedData_decryptEncryptedData_encryptdebug_decryptasciicrlfnointernnoverifynocertsnoattrnodetachUse opaque signingnosmimecapbinaryUse subject key identifiernosigsno_content_verifyno_attr_verifyEnable CMS streamingSame as -streamnoindefDisable CMS streamingcrlfeolreceipt_request_printPrint CMS Receipt Requestreceipt_request_allreceipt_request_firstrctformReceipt file formatOther certificates fileTrusted certificates fileno-CAfileno-CApathcontentsecretkeysecretkeyidpwri_passwordecontent_typeTo addressFrom addressSubjectSigner certificate filerecipcertsoutCertificate output fileinkeyreceipt_request_fromreceipt_request_toAny supported ciphercertificate chain purposeverify_nameverification policy nameverify_depthchain depth limitauth_levelattimeverification epoch timeverify_hostnameexpected peer hostnameverify_emailexpected peer emailverify_ipexpected peer IP addressignore_criticalissuer_checks(deprecated)crl_checkcrl_check_allcheck full chain revocationpolicy_checkperform rfc5280 policy checksexplicit_policyinhibit_anyinhibit_mapx509_strictextended_crlenable extended CRL featuresuse_deltasuse delta CRLspolicy_printcheck_ss_sigcheck root CA self-signaturestrusted_firstsuiteB_128_onlySuite B 128-bit-only modesuiteB_128suiteB_192Suite B 192-bit-only modepartial_chainno_alt_chainsno_check_timeallow_proxy_certsaes128-wrapUse AES128 to wrap keyaes192-wrapUse AES192 to wrap keyaes256-wrapUse AES256 to wrap keydes3-wrapUse 3DES-EDE to wrap keyInvalid key (supplied twice) %s Invalid id (supplied twice) %s Invalid OID (supplied twice) %s Illegal -inkey without -signer No Signed Receipts Recipients Signed receipts only allowed with -sign Multiple signers or keys not allowed No signer certificate specified No recipient certificate or key specified No recipient(s) certificate(s) specified No operation option (-encrypt|-decrypt|-sign|-verify|...) specified. receipt signer certificate fileBad input format for CMS file Signed Receipt Request Creation Error Error decrypting CMS using secret key Error decrypting CMS using private key Error decrypting CMS using password Error decrypting CMS structure Receipt Request Parse Error Bad output format for CMS file Usage: %s [options] cert.pem... cert.pem... recipient certs for encryption Input format SMIME (default), PEM or DEROutput format SMIME (default), PEM or DERGenerate a signed receipt for the messageInclude or delete text MIME headersDon't search certificates in message for signerDon't verify signers certificateDon't include signers certificate when signingDon't include any signed attributesOmit the SMIMECapabilities attributeDon't translate message to textDon't verify message signatureUse CRLF as EOL termination instead of CR onlyFor the -cmsout operation do not output the parsed CMS structuretrusted certificates directoryDo not load the default certificates fileDo not load certificates from the default certificates directorySupply or override content for detached signatureFor the -cmsout operation print out all fields of the CMS structureRecipient cert file for decryptionDigest algorithm to use when signing or resigningInput private key (if not signer or recipient)Input private key format (PEM or ENGINE)Set public key parameters as n:v pairsadds policy to the acceptable policy setchain authentication security levelpermit unhandled critical extensionscheck leaf certificate revocationset policy variable require-explicit-policyset policy variable inhibit-any-policyset policy variable inhibit-policy-mappingdisable certificate compatibility work-aroundsprint policy processing diagnosticssearch trust store first (default)Suite B 128-bit mode allowing 192-bit algorithmsaccept chains anchored by intermediate trust-store CAsignore certificate validity timeallow the use of proxy certificatesUse engine e, possibly a hardware deviceMissing CRL signing key CRL signing keyError creating delta CRL issuer=crlNumber=<NONE>%08lx lastUpdate=nextUpdate=NONE%s Fingerprint=%02X%cunable to write CRL Input format; default PEMInput file - default stdinOutput format - default PEMoutput file - default stdoutPrint issuer DNlastupdateSet lastUpdate fieldnextupdateSet nextUpdate fieldNo CRL outputPrint the crl fingerprintPrint CRL numberbadsiggendeltaVerify CRL signaturePrint hash valuenameoptAny supported digestError initialising X509 store Error getting CRL issuer certificate Error getting CRL issuer public key CRL signing Private key to useCorrupt last byte of loaded CRL signature (for test)Other CRL to compare/diff to the Input oneVerify CRL using certificates in dirVerify CRL using certificates in file namePrint out a text format versionVarious certificate name optionsPrint old-style (MD5) hash value!x���w��tz��dz��Tz��Dz��,z��z���y���y���y���y���y���y���y���y��ly��Ty��Dy��4y��$y��y��y���x���x���x���x��unable to load CRL error opening the file, %s error reading the file, %s error loading certificates unable to write pkcs7 object Input format - DER or PEMOutput format - DER or PEMnocrl����Z���t���d���|���T���D���4������No crl to load, just certs from '-certfile'File of chain of certs to a trusted CA; can be repeatedRSA-%-25sRead Error in %s Verified OK Verification Failure Error Verifying Data Signature bufferError Signing Data \ *%s apps/dgst.c-%s%s(%s)= etaonrishdlcupfmI/O bufferSupported digests: MAC parameter error "%s" Error generating key Error getting context Error setting context Error setting digest signature bufferList digestsSign digest using private keyprverifyFile with signature to verifyPrint as hex dumpPrint in binary formPrint debug infofips-fingerprinthmacCreate hashed MAC with keymacoptengine_impl%s: Can only sign or verify one file. No signature to verify: use the -signature option MAC and Signing key cannot both be specified Key type not supported for this operation Error opening signature file %s Error reading signature file %s Usage: %s [options] [file...] file... files to digest (default is stdin) Print the digest with separating colonsPrint the digest in coreutils formatOutput to filename rather than stdoutVerify a signature using public keyVerify a signature using private keyKey file format (PEM or ENGINE)Compute HMAC with the key used in OpenSSL-FIPS fingerprintCreate MAC (not necessarily HMAC)MAC algorithm parameters in n:v form or keyAlso use engine given by -engine for digest operationsunable to load DH parameters WARNING: q value is invalid WARNING: j value is invalid print a BNstatic DH *get_dh%d(void) { dhpdhg return dh; } apps/dhparam.cUsage: %s [flags] [numbits] Input format, DER or PEMOutput format, DER or PEMCheck the DH parametersPrint C codedsaparamgenerator may not be chosen for DSA parameters Generating DSA parameters, %d bit long prime Generating DH parameters, %d bit long safe prime, generator %d This is going to take a long time unable to load DSA parameters WARNING: p value is not prime WARNING: p value is not a safe prime WARNING: q value is not a prime WARNING: unable to check the generator value WARNING: the g value is not a generator DH parameters appear to be ok. ERROR: Invalid parameters generated DH *dh = DH_new(); BIGNUM *p, *g;
if (dh == NULL) return NULL; p = BN_bin2bn(dhp_%d, sizeof(dhp_%d), NULL); g = BN_bin2bn(dhg_%d, sizeof(dhg_%d), NULL); if (p == NULL || g == NULL || !DH_set0_pqg(dh, p, NULL, g)) { DH_free(dh); BN_free(p); BN_free(g); return NULL; } if (!DH_set_length(dh, %ld)) { DH_free(dh); return NULL; } unable to write DH parameters Print a text form of the DH parametersDon't output any DH parametersGenerate parameters using 2 as the generator valueGenerate parameters using 5 as the generator valueRead or generate DSA parameters, convert to DH.+* Error getting passwords read DSA key Public Keyunable to load Key Public Key=writing DSA key unable to write private key apps/dsa.cInput format, DER PEM PVKOutput format, DER PEM PVKInput keyDon't print key outPrint the key in textPrint the DSA public valuepubinpuboutpassoutpvk-strongpvk-weakpvk-noneDon't enforce PVK encodingPVK form impossible with public key input bad output format specified for outfile Expect a public key in input fileOutput public key, not privateOutput file pass phrase sourceEnable 'Strong' PVK encoding level (default)Enable 'Weak' PVK encoding level����\���������|���ܜ��̜����������������������|���l���\���L���������,���Error allocating DSA object This could take some time BN spacedsapdsaqdsagapps/dsaparam.cPrint as textOutput C codeNo outputgenkeyGenerate a DSA keyWarning: It is not recommended to use more than %d bit for DSA keys. Your key size is %d! Larger key size may behave not as expected. Error allocating BN_GENCB object Error, DSA key generation failed static DSA *get_dsa%d(void) { DSA *dsa = DSA_new(); BIGNUM *p, *q, *g;
if (dsa == NULL) return NULL; if (!DSA_set0_pqg(dsa, p = BN_bin2bn(dsap_%d, sizeof(dsap_%d), NULL), q = BN_bin2bn(dsaq_%d, sizeof(dsaq_%d), NULL), g = BN_bin2bn(dsag_%d, sizeof(dsag_%d), NULL))) { DSA_free(dsa); BN_free(p); BN_free(q); BN_free(g); return NULL; } return dsa; } unable to write DSA parameters .+* read EC key EC Key valid. EC Key Invalid! writing EC key apps/ec.cPrint the keyparam_outno_publiccheck key consistencyparam_encconv_formnamed_curveuncompressedhybrid����X�������p���H���(���������������ا��ȧ��������������`���(���x������@���Print the elliptic curve parametersexclude public key from private keySpecifies the way the ec parameters are encodedSpecifies the point conversion form CURVE DESCRIPTION NOT AVAILABLEusing curve name prime192v1 instead of secp192r1 using curve name prime256v1 instead of secp256r1 unable to load elliptic curve parameters checking elliptic curve parameters: Can only handle X9.62 prime fields EC_GROUP *get_ec_group_%d(void) { int ok = 0; EC_GROUP *group = NULL; EC_POINT *point = NULL; BIGNUM *tmp_1 = NULL; BIGNUM *tmp_2 = NULL; BIGNUM *tmp_3 = NULL;
if ((tmp_1 = BN_bin2bn(ec_gen_%d, sizeof(ec_gen_%d), tmp_1)) == NULL) goto err; point = EC_POINT_bn2point(group, tmp_1, NULL, NULL); if (point == NULL) goto err; if ((tmp_2 = BN_bin2bn(ec_order_%d, sizeof(ec_order_%d), tmp_2)) == NULL) goto err; if ((tmp_3 = BN_bin2bn(ec_cofactor_%d, sizeof(ec_cofactor_%d), tmp_3)) == NULL) goto err; if (!EC_GROUP_set_generator(group, point, tmp_2, tmp_3)) goto err; ok = 1; err: BN_free(tmp_1); BN_free(tmp_2); BN_free(tmp_3); EC_POINT_free(point); if (!ok) { EC_GROUP_free(group); return NULL; } return (group); } unable to write elliptic curve parameters unable to set group when generating key Input format - default PEM (DER or PEM)Print the ec parameters in text formPrint a 'C' function creating the parametersPrints a list of all curve 'short names'If 'explicit' parameters are chosen do not use the seedUse the ec parameters with specified 'short name'list curvesapps/ecparam.c %-10s: secp192r1secp256r1unknown curve name (%s) unable to create curve (%s) Can't allocate BNBN bufferec_pec_aec_bec_genec_orderec_cofactor /* build generator */ unable to generate key Input file - default stdinOutput file - default stdoutValidate the ec parameterslist_curvesno_seedDo not print the ec parameterGenerate ec keyhex string is too long, ignoring excess hex string is too short, padding with zero bytes to length %s: AEAD ciphers not supported *** WARNING : deprecated key derivation used. Using -iter or -pbkdf2 would be better. warning: iv not used by this cipher Disable standard block paddingBase64 encode/decode, depending on encryption flagUsed with -[base64|a] to specify base64 buffer as a single lineUse specified digest to create a key from the passphraseSpecify the iteration count and force use of PBKDF2Use password-based key derivation function 2non-hex digit base64zlib%s is not a known cipher Supported ciphers: %s Can't read key from %s Extra arguments given. %s XTS ciphers not supported bufsize=%d strbufevp bufferencryptiondecryptionenter %s %s password:bad password read invalid hex salt value error writing output file error reading input file bad magic number PKCS5_PBKDF2_HMAC failed EVP_BytesToKey failed invalid hex iv value iv undefined invalid hex key value Error setting cipher %s salt=key=iv =bad decrypt bytes read : %8ju bytes written: %8ju apps/enc.c%s: zero length password List ciphersAlias for -listPassphrase sourceEncryptDecryptPrint the iv/keyPrint the iv/key and exitVerbose outputnopadUse salt in the KDF (default)nosaltDo not use salt in the KDFSame as option -abufsizeBuffer sizePassphrasekfileRead passphrase from fileRaw key, in hexSalt, in hexivIV in hexpbkdf2Don't encryptUse zlib as the 'encryption'Salted__engine bufferapps/engine.cSTORE(%s)[Success]: %s [Failure]: %s <no description>Loaded: (%s) %s RAND [%s] [ available ] [ unavailable ] description buffer%s%s(input flags): <no flags> [Internal] STRINGNUMERIC|NO_INPUT<0x%04X> <illegal flags!> engine... Engines to load vvvvttprepost[Error]: internal stack error [Error]: command name too long %s: Cannot mix flags and engine names. Usage: %s [options] engine... List 'control commands' For each specified engineAlso display each command's descriptionAlso add the input flags for each commandAlso show internal input flagsList the capabilities of specified engineCheck that specified engine is availableDisplay error trace for unavailable enginesRun command against the ENGINE before loading itRun command against the ENGINE after loading itCommands are like "SO_PATH:/lib/libdriver.so"%lx errnum Error number Usage: %s [options] errnum... Generating DSA key, %d bits apps/gendsa.cunable to load DSA parameter file Usage: %s [args] dsaparam-file Output the key to the specified fileEncrypt the output with any supported cipherAlgorithm already set! Algorithm %s not found Parameters already set! Can't open parameter file %s Error initializing context %s: No keytype specified. Error generating parameters Bad format specified for key Error writing key Error printing key apps/genpkey.coutput format (DER or PEM)paramfileParameters fileThe public key algorithmpkeyoptgenparamGenerate parameters, not keyPrint the in textError initializing %s context Error reading parameter file %s %s: Error setting %s parameter: %s: cipher mode not supported Set the public key algorithm option as opt:valueCipher to use to encrypt the keyOrder of options may be important! See the documentation. D����������|��l��\�������|��d��T�����e is %s (0x%s) apps/genrsa.cUse 3 for the E valueF4f4Specify number of primesWarning: It is not recommended to use more than %d bit for RSA keys. Your key size is %d! Larger key size may behave not as expected. Generating RSA private key, %d bit long modulus (%d primes) Use F4 (0x10001) for the E valueOutput the key to specified filetoseqOutput NS Sequence file%s: Error reading certs file %s %s: Error reading sequence file %s \��<��������������%.*sapps/ocsp.c%s: GET HTTP/1.POST Error parsing OCSP requestError creating connect BIO Error creating SSL context. Error connecting BIO Can't get connection fd Timeout on connect HostUnexpected retry condition Timeout on request Select error (core dumped)%s Error parsing URL issuer certificateError Creating OCSP request Error reading OCSP request Error setting up accept BIOError starting acceptresponder certificateresponder private keyresponder other certificateschild PID arrayfatal: waitpid(): %sfatal: RAND_poll() failedterminating on signal: %dindex file changed, reloadingsigner private keysigner certificatesError signing OCSP request assertion failed: bnError reading OCSP response Responder Error: %s (%d) validator certificateError parsing response Nonce Verify error Response Verify Failure Response verify OK ERROR: No Status found. This Update: Next Update: Reason: %s Revocation Time: Output filenameResponder URLPort to run responder onignore_errDon't verify response at allAdd OCSP nonce to requestno_nonceresp_no_certsresp_key_idno_signature_verifyno_cert_verifyno_chainDon't chain verify responseno_cert_checksno_explicittrust_otherno_internreq_textPrint text form of requestresp_textPrint text form of responsereqinrespinVAfileValidator certificates filesign_otherverify_othervalidity_periodstatus_ageMaximum status age in secondssignkeyreqoutrespoutPath to use in OCSP requestIssuer certificateCertificate to checkSerial number to checkindexCertificate status index filenminnrequestndaysrsignerrotherrmdrsigoptkey=value header to addInvalid request -- bad URL: %sInvalid request -- bad HTTP version: %sInvalid request -- bad URL encoding: %sCould not allocate base64 bio: %sInvalid request -- bad HTTP verb: %sError querying OCSP responder No issuer certificate specified Error converting serial number %s Missing = in header key=value %s: Digest must be before -cert or -serial Error loading responder certificate Responder mode requires certificate, key, and CA. fatal: error detaching from parent process group: %sfatal: internal error: no matching child slot for pid: %ldchild process: %ld, exit status: %dchild process: %ld, term signal %d%swaiting for OCSP client connections...error reloading updated index: %sNeed an OCSP request for this operation! Error loading signer certificate WARNING: no nonce in response WARNING: Status times invalid. fatal: internal error: no free child slotsConnection timeout (in seconds) to the OCSP responderTCP/IP hostname:port to connect toIgnore error on OCSP request or response and continue runningDon't add OCSP nonce to requestDon't include any certificates in responseIdentify response by signing certificate key IDrun multiple responder processesDon't include any certificates in signed requestDon't check signature on responseDon't check signing certificateDon't do additional checks on signing certificateDo not explicitly check the chain, just verify the rootDon't verify additional certificatesDon't search certificates contained in response for signerCorrupt last byte of loaded OSCP response signature (for test)Print text form of request and responseFile with the DER-encoded requestFile with the DER-encoded responseCertificate to sign OCSP request withAdditional certificates to include in signed requestAdditional certificates to search for signerTrusted certificates directoryMaximum validity discrepancy in secondsPrivate key to sign OCSP request withOutput file for the DER-encoded requestOutput file for the DER-encoded responseNumber of minutes before next updateNumber of requests to accept (default unlimited)Number of days before next updateResponder certificate to sign responses withResponder key to sign responses withOther certificates to include in responseDigest Algorithm to use in signature of OCSP responseOCSP response signature parameter in n:v formAny supported digest algorithm (sha1,sha256, ... )HTTP/1.0 200 OK Content-type: application/ocsp-response Content-Length: %d
no-quitbye
%-*sExternalBuiltin(none)Name: %s Alias for: %s Type: %s Algorithm OID: %s PEM string: %s Disabled algorithms: EC2M HEARTBEATS MDC2 SM2 SM4 SSL3 %s %s %s * %s %c --helpUsage: %s Standard commands<undefined>%s => %s OpenSSL> OPENSSL_CONFapps/openssl.cconfig filename bufferOPENSSL_DEBUG_MEMORYOPENSSL_FIPSFIPS mode not supported. Can't parse (no memory?) Usage: help [options] help [command] List in one columnList of standard commandsdigest-commandsdigest-algorithmscipher-commandsList of cipher commandscipher-algorithmsList of cipher algorithmspublic-key-algorithmsList of public key algorithmspublic-key-methodsList of public key methodsdisabledList of disabled featuresmissing-helpasn1parsecmscrl2pkcs7dgstdhparamecparamerrstrgendsagenpkeygenrsanseqocsppasswdpkcs12pkcs8pkeyparampkeyutlrehashrsautls_clients_servers_timesess_idsmimespeedstoreutlx509md2md4gostsha224sha512-224sha512-256sha3-224sha3-256sha3-384sha3-512shake128shake256rmd160blake2b512blake2s256sm3aes-128-cbcaes-128-ecbaes-192-cbcaes-192-ecbaes-256-cbcaes-256-ecbaria-128-cbcaria-128-cfbaria-128-ctraria-128-ecbaria-128-ofbaria-128-cfb1aria-128-cfb8aria-192-cbcaria-192-cfbaria-192-ctraria-192-ecbaria-192-ofbaria-192-cfb1aria-192-cfb8aria-256-cbcaria-256-cfbaria-256-ctraria-256-ecbaria-256-ofbaria-256-cfb1aria-256-cfb8camellia-128-cbccamellia-128-ecbcamellia-192-cbccamellia-192-ecbcamellia-256-cbccamellia-256-ecbdes3desxidearc4rc4-40rc2bfcastrc5des-ecbdes-ededes-ede3des-cbcdes-ede-cbcdes-ede3-cbcdes-cfbdes-ede-cfbdes-ede3-cfbdes-ofbdes-ede-ofbdes-ede3-ofbidea-cbcidea-ecbidea-cfbidea-ofbseed-cbcseed-ecbseed-cfbseed-ofbrc2-cbcrc2-ecbrc2-cfbrc2-ofbrc2-64-cbcrc2-40-cbcbf-cbcbf-ecbbf-cfbbf-ofbcast5-cbccast5-ecbcast5-cfbcast5-ofbcast-cbcrc5-cbcrc5-ecbrc5-cfbrc5-ofbInvalid command '%s'; type "help" for a list.
Message Digest commands (see the `dgst' command for more details)
Cipher commands (see the `enc' command for more details) FATAL: Startup failure (dev note: apps_startup() failed) FATAL: Startup failure (dev note: prog_init() failed) List of message digest commandsList of message digest algorithmsList missing detailed help stringsList options for specified command,��l��� ��� ��� ��� ��������������t��������4��rounds=$./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzapps/passwd.capr1salt bufferrounds=%u%s %s Password: Read passwords from fileNo warningsFormat output as tablereverseSwitch table columnsUse provided saltRead passwords from stdinMD5-based password algorithmaixmd5Warning: truncating password to %u characters %s: Can't combine -in and -stdin Never verify when reading password from terminalSHA512-based password algorithmSHA256-based password algorithmMD5-based password algorithm, Apache variantAIX MD5-based password algorithmStandard Unix password algorithm (default), <unsupported parameters>, %s, %s, Iteration %ld, PRF %s, Iteration %ldapps/pkcs12.c%02X <Unsupported tag %d> %s: <No Attributes> %s: <Empty Attributes> <No Values> Key bag Bag AttributesKey AttributesShrouded Keybag: Certificate bag Safe Contents bag PKCS7 Data PKCS7 Encrypted data: Enter MAC Password:Can't read Password Nothing to do! certificates from certfileError %s getting chain. Enter Export Password:Enter Import Password:MAC: , Iteration %ld nokeysDon't output private keyskeyexSet MS key exchange typekeysigSet MS key signature typeDon't output certificatesclcertscacertsOnly output CA certificatesAdd certificate chaintwopassnomacverDon't verify MACdescertcertpbeOutput PKCS12 filenoiterUse MAC iterationnomaciterDon't use MAC iterationnomacDon't generate MACLMKnodesDon't encrypt private keysmacalgkeypbePrivate key if not infileLoad certs from fileUse name as friendly nameCSPMicrosoft CSP namecanameInput filenamePEM-format directory of CA'sPEM-format file of CA's, Salt length: %d, Cost(N): %ld, Block size(r): %ld, Parallelism(p): %ldWarning unsupported bag type: Option -twopass cannot be used with -passout or -password Option -twopass cannot be used with -passin or -password No certificate matches private key MAC length: %ld, salt length: %ld Mac verify error: invalid password? Warning: using broken algorithm Error outputting keys and certificates Only output client certificatesDon't output anything, just verifyPrint info about PKCS#12 structureSeparate MAC, encryption passwordsEncrypt output with 3DES (default RC2-40)Certificate PBE algorithm (default RC2-40)Don't use encryption iterationAdd local machine keyset attribute to private keyDigest algorithm used in MAC (default SHA1)Private key PBE algorithm (default 3DES)Use name as CA friendly name (can be repeated)Set import/export password sourceunable to load PKCS7 object Don't output encoded dataprint_certsxE��4E��hG��XG��XE��HG��8G��(G��G��G���F���E��Print full details of certificatesPrint out all fields of the PKCS7 structurePrint_certs print any certs or crl in the input%s: Unknown PBE algorithm %s %s: Unknown PRF algorithm %s Error converting key Error setting PBE algorithm Enter Encryption Password:Error encrypting key Error reading key Enter Password:Error decrypting key apps/pkcs8.cInput format (DER or PEM)Output format (DER or PEM)topk8Output PKCS8 fileUse 1 as iteration countnocryptv2Use PKCS#5 v2.0 and cipherUse PKCS#5 v1.5 and cipherv2prfSpecify the iteration counttraditionalscryptUse scrypt algorithmscrypt_NSet scrypt N parameterscrypt_rSet scrypt r parameterscrypt_pSet scrypt p parameterUse or expect unencrypted private keySet the PRF algorithm to use with PKCS#5 v2.0use traditional format private keyKey is valid Key is invalid Detailed error: %s apps/pkey.ctext_pubOutput in plaintext as wellDon't output the keyCheck key consistencypubcheckCheck public key consistency�Q���Q���T���T���Q���T���T��hT��XT��HT��pR���S���S���S��8T��T��T���S���S��Read public key from input (default is private key)Only output public key componentsUse traditional format for private keysError reading parameters Parameters are valid Parameters are invalid Print parameters as textCheck key param consistency�U���U��0W�� W��W��W���V���V�� V��Don't output encoded parametersapps/pkeyutl.cPeer KeyError reading peer key %s Can't open signature file %s Error reading signature data Error reading input Data buffer outputPublic Key operation error Key derivation failed Input is a public keycertinasn1parse the output datahexdumpHex dump outputVerify with public keyverifyrecoverderiveDerive shared secretkdfUse KDF algorithmkdflenKDF algorithm output lengthsigfileInput private key filepeerkeypeerformPeer key format - default PEM%s: no KDF length given (-kdflen parameter). %s: no private key given (-inkey parameter). %s: no peer key given (-peerkey parameter). A private key is needed for this operation The given KDF "%s" is unknown. %s: Error initializing context %s: Error setting up peer key %s: Can't set parameter "%s": %s: Signature file specified for non verify %s: No signature file specified for verify Error: The input data looks too long to be a hash Signature Verified Successfully Signature Verification Failure Input is a cert with a public keySign input data with private keyVerify with public key, recover original dataReverse the order of the input bufferEncrypt input data with public keyDecrypt input data with private keySignature file (verify operation only)Peer key file used in key derivationPrivate key format - default PEMPublic key options as opt:valueAlso use engine given by -engine for crypto operationsisis not%s: No prime specified Specify the number of bits. Out of memory. Failed to generate prime. apps/prime.cFailed to process value (%s) (%s) %s prime Hex outputgenerateGenerate a primeSize of number in bitssafeNumber of checks�`���`��@b��0b�� b��b���a��a��Usage: %s [options] [number...] number Number to check for primality When used with -generate, generate a safe primeUsage: %s [flags] num Base64 encode outputHex encode outputapps/rehash.ccollision buckethash bucketSkipping %s, can't write Doing %s Skipping %s, out of memory %s%s%slink %s -> %s %s%s%n%08x.%s%d%s: Can't unlink %s, %s %s: Can't symlink %s, %s unlink %s compatDo not remove existing linkscrtcer%s: warning: skipping duplicate %s in %s %s: error: hash table overflow for %s %s: error: skipping %s, cannot open file %s: warning: skipping %s,it does not contain exactly one certificate or CRL Usage: %s [options] [cert-directory...] Create both new- and old-style hash linksUse old-style hash to generate links@s��Zr��s��`s��s���r���r��apps/req.cparam:Unknown algorithm %.*s Error setting RSA keysize %s '%s' too long %s [%s]:weird input :-( Can't find keygen engine %s Serial number supplied twice input_passwordoutput_passwordreq_extensionsdefault_bitsGenerating an EC private key Generating a %s private key Error Generating Key default_keyfileencrypt_rsa_keyencrypt_key----- unable to load X509 request promptdistinguished_nameunable to get '%s' section _min_maxDN defaultDN valueAttribute defaultAttribute valueError adding attribute Modifying Request's Subject old subject=ERROR: cannot modify subject new subject=Error getting public key Error printing certificate Modulus=unavailable Modulus=Wrong Algorithm typeunable to write X509 request Private key to useKey file formatOutput public keyNew requestRequest template filekeyoutFile to send the key toPrivate key password sourcenewkeySpecify as type:bitsnewhdrRSA modulusVerify signature on REQDon't encrypt the output keyDo not output REQreqoptVarious request text optionsText form of request(Required by some CA's)Set or modify request subjectOutput the request's subjectset_serialSerial number to useaddextreqextsprecertkeygen_engineKey Type does not match parameters Internal error: can't find key algorithm Error allocating keygen context Error initializing keygen context string is too short, it needs to be at least %d bytes long string is too long, it needs to be no more than %d bytes long Ignoring -days; not generating a certificate Using additional configuration from command line Error Loading command line extensions Error Loading request extension section %s private key length is too short, it needs to be at least %d bits, not %ld Warning: It is not recommended to use more than %d bit for RSA keys. Your key size is %ld! Larger key size may behave not as expected. Warning: It is not recommended to use more than %d bit for DSA keys. Your key size is %ld! Larger key size may behave not as expected. writing new private key to stdout you need to specify a private key unable to find '%s' in config error, no objects specified in config file You are about to be asked to enter information that will be incorporated into your certificate request. What you are about to enter is what is called a Distinguished Name or a DN. There are quite a few fields but you can leave some blank For some fields there will be a default value, If you enter '.', the field will be left blank.
Please enter the following 'extra' attributes to be sent with your certificate request No template, please set one up. problems making Certificate Request Error adding poison extension Cannot modify certificate subject Error printing certificate request unable to write X509 certificate writing new private key to '%s' Do not ask anything during request generationOutput "NEW" in the header linesOutput a x509 structure instead of a cert requestNumber of days cert is valid forAdditional cert extension key=value pair (may be given more than once)Cert extension section (override value in config file)Request extension section (override value in config file)Add a poison extension (implies -new)Specify engine to be used for key generation operationsRSA key ok RSA key error: %s writing RSA key unable to write key apps/rsa.cInput format, one of DER PEMOutput a public keyRSAPublicKey_inInput is an RSAPublicKeyRSAPublicKey_outOutput is an RSAPublicKeyPrint the RSA key modulusVerify key consistencyOnly private keys can be checked Output format, one of DER PEM PVK����l���ܡ��̡������������������|���l���\���L���<���,���������������������ܠ��D���Error getting RSA key hold rsa keyoutput rsa keyRSA operation error apps/rsautl.cInput is an RSA publicUse SSL v2 paddingrawUse no paddingpkcsoaepUse PKCS#1 OAEPSign with private keyx931Use ANSI X9.31 paddingEncrypt with public keyDecrypt with private keyInput is a cert carrying an RSA public keyUse PKCS#1 v1.5 padding (default)Run output through asn1parse; useful with -verifyOCSP response: no response sent response parse error SRP parameters: N= g=SRP param N and g rejected. SRP password bufferSRP userapps/s_client.cSERVERINFO FOR EXTENSION %dpsk_client_cb created identity '%s' len=%d created PSK len=%ld Error in PSK client callback hexdecode NOT--- Certificate chain %2d s: i:Server certificate --- SCTs present (%i) SCT validation status: %s
--- --- New, %s, Cipher is %s Server public key is %d bit Compression: %s Expansion: %s Next protocol: (%d) ALPN protocol: No ALPN negotiated Early data was not sent Early data was rejected Early data was accepted Verify return code: %ld (%s) Keying material exporter: Label: '%s' Length: %i bytes export key Error Keying material: --- Reused, Can't use SSL_get_servername mail.example.comlocalhost%s: out of memory cbufsbufmbufNot a hex number '%s' %s: Can't use both -4 and -6 Can't use -sctp without DTLS client certificate fileclient certificate chainError loading CRL Error adding CRL Error setting verify params Error loading CA names Error setting SRTP profile Error parsing -alpn argument Error setting ALPN Unable to set SRP username Can't open session file %s Can't set session connect:errno=%d CONNECTED(%08X) Turned on non blocking io getsockname:errno=%d Failed to set MTU LHLO %s EHLO %s STARTTLSSTLS BIO_read failed . CAPABILITY . STARTTLS AUTH TLS <proceedCONNECT %s HTTP/1.0
%s: HTTP CONNECT failed: %s %*s %dSTARTTLS not supported: %sSTARTTLS negotiation failed: MySQL packet too short. MySQL packet is broken. CAPABILITIES 382STARTTLS failed: %s"STARTTLS"NCONF_load_bio failed Error on line %ld NCONF_get_string failed ASN1_generate_nconf failed Unexpected LDAP response No MessageID Not ExtendedResponse Not LDAPResult Cannot open early data file Error writing early data CONNECTION ESTABLISHED bad select %d write A BLOCK write R BLOCK write X BLOCK shutdown write:errno=%d DONE read A BLOCK read W BLOCK read R BLOCK read X BLOCK CONNECTION CLOSED BY SERVER read:errno=%d closed RENEGOTIATING KEYUPDATE TIMEOUT occurred usageselectormtypesmtppop3imapftpxmppxmpp-servertelnetircmysqlpostgreslmtpnntpsieveldapUse -connect insteadbindproxyunixUse IPv4 onlyUse IPv6 onlyPEM format directory of CA'sPEM format file of CA'srequestCAfiledane_tlsa_domainDANE TLSA base domaindane_tlsa_rrdatadane_ee_no_namechecksreconnectshowcertsExtra outputmsgShow protocol messagesmsgfilenbio_testMore ssl protocol testingstatePrint the ssl statesNo s_client outputno_ign_eofDon't ignore input eofstarttlsxmpphostsess_outFile to write SSL session tosess_inFile to read SSL session fromuse_srtpkeymatexportkeymatexportlenmaxfraglenfallback_scsvSend the fallback SCSVCRL file to usecrl_downloadCRLformverify_return_errorverify_quietbriefprexitsecurity_debugsecurity_debug_verbosechainCApathverifyCApathbuild_chainBuild certificate chainchainCAfileverifyCAfilenocommandsnoservernametlsextdebugserverinfoalpnasyncssl_configmax_send_fragMaximum Size of send frames split_send_fragmax_pipelinesread_bufno_ssl3Just disable SSLv3no_tls1Just disable TLSv1no_tls1_1Just disable TLSv1.1no_tls1_2Just disable TLSv1.2no_tls1_3Just disable TLSv1.3bugsTurn on SSL bug compatibilityno_compUse SSL/TLS-level compressionno_ticketserverpreflegacy_renegotiationDisable all renegotiation.no_resumption_on_renegno_legacy_server_connectallow_no_dhe_kexprioritize_chachaclient_sigalgsmin_protocolmax_protocolrecord_paddingdebug_broken_protocolno_middleboxxkeykey for Extended certificatesxcertxchainxchain_buildxcertformxkeyformJust use TLSv1Just use TLSv1.1Just use TLSv1.2Just use TLSv1.3dtlsUse any version of DTLSmtuSet the link layer MTUdtls1Just use DTLSv1dtls1_2Just use DTLSv1.2sctpUse SCTPsctp_label_bugEnable SCTP label length bugnbioUse non-blocking IOPSK identityPSK in hex (without 0x)psk_sessionsrpuserSRP authentication for 'user'srppassPassword for 'user'srp_lateusersrp_moregroupssrp_strengthMinimal length in bits for Nnextprotonegssl_client_enginenoctctlogfileCT log list CONF filekeylogfileWrite TLS secrets to fileFile to send as early dataenable_phaClient_identity ====================================== ====================================== SRP param N and g are not known params, going to check deeper. Protocols advertised by server: NULL received PSK identity hint, continuing anyway Received PSK identity hint '%s' Could not convert PSK key '%s' to buffer psk buffer of callback is too small (%d) for key (%ld) Error finding suitable ciphersuite no peer certificate available --- SSL handshake has read %ju bytes and written %ju bytes Secure Renegotiation IS%s supported SRTP Extension negotiated, profile=%s Error writing session file %s --- Post-Handshake New Session Ticket arrived: %s: Intermixed protocol flags (unix and internet domains) %s: Intermixed protocol flags (internet and unix domains) Cannot supply multiple protocol flags Cannot supply both a protocol flag and '-no_<prot>' Error getting client auth engine SRP minimal length for N is %d %s: Max Fragment Len %u is out of permitted values%s: Can't use -servername and -noservername together %s: Can't use -dane_tlsa_domain and -noservername together %s: must not provide both -connect option and target parameter Cannot supply -nextprotoneg with TLSv1.3 %s: -proxy requires use of -connect or target parameter %s: -proxy argument malformed or ambiguous %s: -connect argument or target parameter malformed or ambiguous %s: -bind argument parameter malformed or ambiguous Can't use unix sockets and datagrams together Error parsing -nextprotoneg argument client certificate private key fileError using configuration "%s" %s: Max send fragment size %u is out of permitted range %s: Split send fragment size %u is out of permitted range %s: Max pipelines %u is out of permitted range %s: Max Fragment Length code %u is out of permitted values Error loading store locations Error setting client auth engine PSK key given, setting client callback Can't open PSK session file %s Can't read PSK session file %s Warning: Unable to add custom extension %u, skipping %s: Error enabling DANE TLSA authentication. Unable to set TLS servername extension. %s: DANE TLSA authentication requires at least one -dane_tlsa_rrdata option. %s: warning: bad TLSA %s field in: %s %s: warning: unusable TLSA rrdata: %s %s: warning: error loading TLSA rrdata: %s %s: Failed to import any TLSA records. %s: DANE TLSA authentication requires the -dane_tlsa_domain option. MTU too small. Must be at least %ld Didn't find STARTTLS in server response, trying anyway... <stream:stream xmlns:stream='http://etherx.jabber.org/streams' xmlns='jabber:%s' to='%s' version='1.0'><starttls xmlns='urn:ietf:params:xml:ns:xmpp-tls'<starttls xmlns="urn:ietf:params:xml:ns:xmpp-tls"<starttls xmlns='urn:ietf:params:xml:ns:xmpp-tls'/>%s: HTTP CONNECT failed, insufficient response from proxy (got %d octets) %s: HTTP CONNECT failed, incorrect response from proxy Timeout waiting for response (%d seconds). Server does not support STARTTLS. MySQL packet length does not match. Only MySQL protocol version 10 is supported. Cannot confirm server version. MySQL server handshake packet is broken. MySQL server does not support SSL. ldap_ExtendedResponse_parse failed STARTTLS failed, LDAP Result Code: %i drop connection and then reconnect TCP/IP where to connect (default is :4433)bind local address for connectionConnect to via specified proxy to the real serverConnect over the specified Unix-domain socketTurn on peer certificate verificationCertificate file to use, PEM format assumedCertificate format (PEM or DER) PEM defaultPrivate key file to use, if not in -cert fileKey format (PEM, DER or engine) PEM defaultPrivate key file pass phrase sourcePEM format file of CA names to send to the serverDANE TLSA rrdata presentation formDisable name checks when matching DANE-EE(3) TLSA recordsDrop and re-make the connection with the same Session-IDShow all certificates sent by the serverFile to send output of -msg or -trace, instead of stdoutConvert LF from terminal into CRLFIgnore input eof (default when -quiet)Use the appropriate STARTTLS command before starting TLSAlias of -name option for "-starttls xmpp[-server]"Offer SRTP key management with a colon-separated profile listExport keying material using labelExport len bytes of keying material (default 20)Enable Maximum Fragment Length Negotiation (len values: 512, 1024, 2048 and 4096)Hostname to use for "-starttls lmtp", "-starttls smtp" or "-starttls xmpp[-server]"Download CRL from distribution pointsCRL format (PEM or DER) PEM is defaultClose connection on verification errorRestrict verify output to errorsRestrict output to brief summary of connection parametersPrint session information when the program exitsEnable security debug messagesOutput more security debug outputCertificate chain file (in PEM format)Use dir as certificate store path to build CA certificate chainUse dir as certificate store path to verify CA certificateCA file for certificate chain (PEM format)CA file for certificate verification (PEM format)Do not use interactive command lettersSet TLS extension servername (SNI) in ClientHello (default)Do not send the server name (SNI) extension in the ClientHelloHex dump of all TLS extensions receivedRequest certificate status from servertypes Send empty ClientHello extensions (comma-separated numbers)Enable ALPN extension, considering named protocols supported (comma-separated list)Support asynchronous operationUse specified configuration fileSize used to split data for encrypt pipelinesMaximum number of encrypt/decrypt pipelines to be usedDefault read buffer size to be used for connectionsDisable SSL/TLS compression (default)Disable use of TLS session ticketsUse server's cipher preferencesEnable use of legacy renegotiation (dangerous)Allow initial connection to servers that don't support RIDisallow session resumption on renegotiationDisallow initial connection to servers that don't support RIIn TLSv1.3 allow non-(ec)dhe based key exchange on resumptionPrioritize ChaCha ciphers when preferred by clientsEnforce strict certificate checks as per TLS standardSignature algorithms to support (colon-separated list)Signature algorithms to support for client certificate authentication (colon-separated list)Groups to advertise (colon-separated list)Elliptic curve used for ECDHE (server-side only)Specify TLSv1.2 and below cipher list to be usedSpecify TLSv1.3 ciphersuites to be usedSpecify the minimum protocol version to be usedSpecify the maximum protocol version to be usedBlock size to pad TLS 1.3 records to.Perform all sorts of protocol violations for testing purposesDisable TLSv1.3 middlebox compat modecert for Extended certificateschain for Extended certificatesbuild certificate chain for the extended certificatesformat of Extended certificate (PEM or DER) PEM default format of Extended certificate's key (PEM or DER) PEM defaultEnable send/receive timeout on DTLS connectionsFile to read PSK SSL session fromSRP username into second ClientHello messageTolerate other than the known g N values.Enable NPN extension, considering named protocols supported (comma-separated list)Specify engine to be used for client certificate operationsRequest and parse SCTs (also enables OCSP stapling)Do not request or parse SCTs (default)Enable post-handshake-authenticationW� ��&�������c��c�����������e��W�%��O������#�����������b���������#��������}��q��W���������������������/ ��!��.��.��.%4ld items in the session cache %4ld client connects (SSL_connect()) %4ld client renegotiates (SSL_connect()) %4ld client connects that finished %4ld server accepts (SSL_accept()) %4ld server renegotiates (SSL_accept()) %4ld server accepts that finished %4ld cache full overflows (%ld allowed) Error setting session id context Error clearing SSL connection Error waiting for client response HTTP/1.0 200 ok Content-type: text/html
<HTML><BODY BGCOLOR="#ffffff"> Ciphers supported in s_server binary --- Ciphers common between both SSL end points: no client certificate available HTTP/1.0 200 ok Content-type: text/plain
'%s' is an invalid file name cert_status: Cannot open OCSP response file cert_status: Error reading OCSP response cert_status: can't parse AIA URL cert_status: no AIA and no default responder URL cert_status: Can't retrieve issuer certificate. cert_status: error querying responder cert_status: ocsp response sent: SRP parameters set: username = "%s" info="%s" Error: client did not send PSK identity PSK warning: client identity not what we expected (got '%s' expected '%s') ALPN protocols advertised by the client: Out of memory adding to external cache Unexpected session encoding length New session added to external cache %s: -port argument malformed or ambiguous %s: -accept argument malformed or ambiguous verify depth is %d, must return a certificate Invalid value for max_early_data Invalid value for recv_max_early_data Can't use -HTTP, -www or -WWW with DTLS Can only use -listen with DTLS Can only use --stateless with TLS Can't use -early_data in combination with -www, -WWW, -HTTP, or -rev server certificate private key filesecond server certificate private key filesecond server certificate filesecond certificate private key filesecond server certificate chainwarning: id_prefix is too long, only one new session will be possible Setting secondary ctx parameters Using default temp DH parameters Error setting temp DH parameters PSK key given, setting server callback error setting PSK identity hint to context error setting session id context Cannot initialize SRP verifier file "%s":ret=%d TCP/IP port to listen on for connections (default is 4433)TCP/IP optional host and port to listen on for connections (default is *:4433)Unix domain socket to accept onFor -unix, unlink existing socket firstTurn on peer certificate verification, must have a certCertificate file to use; default is server.pemTerminate after #num connectionsPEM serverinfo file for certificatePrivate Key if not in -cert; default is server.pemKey format (PEM, DER or ENGINE) PEM defaultSecond certificate file to use (usually for DSA)Second certificate format (PEM or DER) PEM defaultSecond private key file to use (usually for DSA)Second key format (PEM, DER or ENGINE) PEM defaultSecond private key file pass phrase sourceTest with the non-blocking test bioDon't use any certificates (Anon-DH)Disable caching and tickets if ephemeral (EC)DH is usedRespond to a 'GET /' with a status pageRespond to a 'GET with the file ./pathServername for HostName TLS extensionmismatch send fatal alert (default warning alert)Certificate file to use for servername; default isserver2.pem-Private Key file to use for servername if not in -cert2Like -WWW but ./path includes HTTP headersGenerate SSL/TLS session IDs prefixed by argcertificate chain file in PEM formatsecond certificate chain file in PEM formatuse dir as certificate store path to build CA certificate chainuse dir as certificate store path to verify CA certificateDisable internal cache, setup and use external cacheNo verify output except verify errorsignore input eof (default when -quiet)Print more output in certificate status callbackStatus request responder timeoutFile containing DER encoded OCSP ResponsePrint output from SSL/TLS security frameworkPrint more output from SSL/TLS security frameworkact as a simple test server which just sends back with the received text reversedConfigure SSL_CTX using the configuration 'val'A seed string for a default user saltListen for a DTLS ClientHello with a cookie and then connectSet the advertised protocols for the NPN extension (comma-separated list)Set the advertised protocols for the ALPN extension (comma-separated list)The maximum number of bytes of early data as advertised in ticketsThe maximum number of bytes of early data (hard limit)The number of TLSv1.3 session tickets that a server will automatically issueSwitch on anti-replay protection (default)Switch off anti-replay protection%4ld session cache hits %4ld session cache misses %4ld session cache timeouts %4ld callback cache hits (NONE)Client certificate Shared ciphers:%s CIPHER is %s NEXTPROTO is Reused session-id Renegotiation is DISABLED apps/s_server.cserver bufferUnable to create BIO Error reading early data Early data received: No early data received
End of early data shutdown accept socket SSL_do_handshake -> %d Failed to initiate requestLets print some clear text LOOKUP renego during write LOOKUP done %s LOOKUP not successful Write BLOCK (Async) Write BLOCK ERROR ERROR - memory ERROR - unable to connect LOOKUP during accept %s DELAY verify error:%s LOOKUP renego during read Read BLOCK (Async) Read BLOCK CONNECTION CLOSED shutting down SSL server www bufferGET /stats GET /renegcertSSL_renegotiate -> %d SSL_do_handshake() Retval %d <pre> <>&%-11s:%-25s </pre></BODY></HTML>
GET /'%s' contains '..' or ':' '%s' is an invalid path '%s' is a directory Error opening '%s' FILE:%s .html.php.htmrwrite W BLOCK GET /renegserver rev bufferCONNECTION FAILURE LOOKUP renego during accept CLOSEcert_status: callback called cert_status: AIA URL: %s SRP username = "%s" User %s doesn't exist \x%02xHostname in TLS extension: "Switching server context. psk_server_cb identity_len=%d identity=%s PSK client identity found fetched PSK len=%ld Error in PSK server callback ALPN protocols selected: Lookup session: cache hit Lookup session: cache miss get sessionError encoding session get session bufferserver2.pemserver.pemserver certificate fileserver certificate chainerror setting 'id_prefix' id_prefix '%s' set. Setting temp DH parameters unlinkSet session ID contextnacceptdcertDH parameters file to usedcertformdkeydkeyformdpassPrint more outputPrint the SSL statesnocertNo server outputno_resume_ephemeralwwwWWWservername_fatalcert2key2HTTPid_prefixdcert_chainno_cacheDisable session cacheext_cacheDo not ignore input eofstatus_verbosestatus_timeoutstatus_urlStatus request fallback URLstatus_fileOperate in asynchronous modePSK identity to expectpsk_hintPSK identity hint to usesrpvfileThe verifier file for SRPsrpuserseedJust talk TLSv1Just talk TLSv1.1just talk TLSv1.2just talk TLSv1.3Use any DTLS versionEnable timeoutsSet link layer MTUlistenstatelessRequire TLSv1.3 cookiesJust talk DTLSv1Just talk DTLSv1.2no_dheDisable ephemeral DHrecv_max_early_dataAttempt to read early datanum_ticketsno_anti_replay6��d��������d��,��6��6�����d��,��8�����������8�������������8��localhost:4433%s: verify depth is %d %s: -www option is too long SSL_CIPHERUnable to get connection startingcafileJust time new connectionsJust time connection reuseCollecting connection statistics for %d seconds
%d connections in %.2fs; %.2f connections/user sec, bytes read %ld %d connections in %ld real seconds, %ld bytes read per connection
Now timing with session id reuse.Where to connect as post:port (default is localhost:4433)Cert file to use, PEM format assumedFile with key, PEM; default is -cert fileTurn on peer certificate verification, set depthSeconds to collect data, default 30Fetch specified page from the site09���8��0=�� =��=��=���<���<���<���<���<���<���<��p<��`<��P<��<��9���9���9��GET %s HTTP/1.0
unable to load SSL_SESSION Context too long Error setting id context No certificate present unable to write SSL_SESSION unable to write X509 Print ssl session id detailsOutput certificate Set the session ID contextOutput format - default PEM (PEM, DER or NSS)Don't output the encoded session info@���?���B���?��xB��hB��XB��HB��8B��(B��x@��apps/smime.cpk7outOutput PKCS#7 structurenochain%s: Must have -signer before -inkey Bad input format for PKCS#7 file Error creating PKCS#7 structure Error decrypting PKCS#7 structure Bad output format for PKCS#7 file Recipient certificate file for decryptionset PKCS7_NOCHAIN so certificates contained in the message are not used as untrusted CAsFailure in the job Failure in the select RSA sign failure RSA verify failure ECDSA sign failure ECDSA verify failure EdDSA sign failure EdDSA verify failure +DT:%s:%d:%d +DTP:%d:%s:%s:%d +R:%d:%s:%f %d %s's in %.2fs EVP error! rsa512dsa512ecdhp224+R1:%ld:%d:%.2f +R2:%ld:%d:%.2f +R3:%ld:%u:%.2f +R4:%ld:%u:%.2f +R5:%ld:%u:%.2f +R6:%ld:%u:%.2f +R7:%ld:%d:%.2f +R8:%ld:%u:%s:%.2f +R9:%ld:%u:%s:%.2f :%d%7d bytes:%.2f %11.2f %s: too many async_jobs %s: Maximum offset is %d shaopensslaescamelliaecdsaecdheddsa%s: Unknown algorithm %s %s is not an AEAD cipher array of loopargsECDH secret aECDH secret bfd buffer for do_multipipe failure Forked child %d dup failed Got: %s from %d +F:+F2:+F3:+F4:+F5:+F6:+H:0123456789abmultiblock input buffermultiblock output bufferevp_cipher keyapps/speed.cevp+H+F:%d:%stype %-24s %11.2fk EVP_CIPHER_CTX_new failure
EVP_CipherInit_ex failure privateECDH EC params init failure. ECDH keygen failure. ECDH key generation failure. ECDH computation failure. EdDSA failure. options: %s type +F:%u:%s%-13s+F2:%u:%u:%f:%f +F3:%u:%u:%f:%f +F4:%u:%u:%f:%f %30sop op/s +F5:%u:%u:%f:%f +F6:%u:%u:%s:%f:%f ECDSA failure. Ed25519Ed448nistp224nistp256nistp384nistp521X25519X448ed25519ed448ecdhp256ecdhp384ecdhp521ecdhx25519ecdhx448ecdsap224ecdsap256ecdsap384ecdsap521rsa1024rsa2048rsa3072rsa4096rsa7680rsa15360dsa1024dsa2048whirlpoolripemdripemd160aes-128-igeaes-192-igeaes-256-igeblowfishcast5ghashmdc2hmac(md5)des cbcdes ede3idea cbcseed cbcrc2 cbcrc5-32/12 cbcblowfish cbccast cbcaes-128 cbcaes-192 cbcaes-256 cbccamellia-128 cbccamellia-192 cbccamellia-256 cbcaes-128 igeaes-192 igeaes-256 igeaeadmbmrRun benchmarks in parallelasync_jobselapsedmisalignToo many fds in ASYNC_WAIT_CTX Error: max_fd (%d) must be smaller than FD_SETSIZE (%d). Decrease the value of async_jobs Doing %s for %ds on %d size blocks: Doing %u bits %s %s's for %ds: %ld %u bits private RSA's in %.2fs %ld %u bits public RSA's in %.2fs %ld %u bits DSA signs in %.2fs %ld %u bits DSA verify in %.2fs %ld %u bits ECDSA signs in %.2fs %ld %u bits ECDSA verify in %.2fs %ld %u-bits ECDH ops in %.2fs %ld %u bits %s signs in %.2fs %ld %u bits %s verify in %.2fs %s: %s is an unknown cipher or digest %s: async_jobs specified but async not supported -aead can be used only with an AEAD cipher -mb can be used only with a multi-block capable cipher %s is not a multi-block capable Async mode is not supported with -mbError creating the ASYNC job pool Error creating the ASYNC_WAIT_CTX Don't understand line '%s' from child %d Unknown type '%s' from child %d You have chosen to measure elapsed time instead of user CPU time. internal error loading RSA key number %d HMAC malloc failure, exiting...Async mode is not supported with %s The 'numbers' are in 1000s of bytes per second processed. Generate multi-prime RSA key for %s RSA sign failure. No RSA sign will be done. RSA verify failure. No RSA verify will be done. DSA sign failure. No DSA sign will be done. DSA verify failure. No DSA verify will be done. ECDSA verify failure. No ECDSA verify will be done. WARNING: the error queue contains previous unhandled errors. Unhandled error in the error queue during ECDH init. ECDH computations don't match. EdDSA verify failure. No EdDSA verify will be done. The 'numbers' are in 1000s of bytes per second processed.%18ssign verify sign/s verify/s rsa %4u bits %8.6fs %8.6fs %8.1f %8.1f dsa %4u bits %8.6fs %8.6fs %8.1f %8.1f %30ssign verify sign/s verify/s %4u bits ecdsa (%s) %8.4fs %8.4fs %8.1f %8.1f %4u bits ecdh (%s) %8.4fs %8.1f %4u bits EdDSA (%s) %8.4fs %8.4fs %8.1f %8.1f ECDSA sign failure. No ECDSA sign will be done. EdDSA sign failure. No EdDSA sign will be done. Async mode is not supported, exiting...Usage: %s [options] ciphers... Use EVP-named cipher or digestTime decryption instead of encryption (only EVP)Benchmark EVP-named AEAD cipher in TLS-like sequenceEnable (tls1>=1) multi-block mode on EVP-named cipherProduce machine readable outputEnable async mode and start specified number of jobsUse wall-clock time instead of CPU user time as divisorSpecify number of primes (for RSA only)Run benchmarks for specified amount of secondsRun [non-PKI] benchmarks on custom-sized bufferUse specified offset to mis-align buffers @�<This is a key...4Vx����4Vx����Vx����4x����4V4Vx����4Vx����Vx����44Vx����4Vx����Vx����4x����4V4Vx����4Vx����Vx����44Vx����4Vx����>`��- �!� @@ @��@@�@�?apps/spkac.cSPKAC=%s Can't find SPKAC called "%s" Error loading SPKAC Signature OK Signature Failure challengeChallenge stringAlternative SPKAC nameDon't print SPKACVerify SPKAC signaturespksect���@�� ��@������������������������x����`��Create SPKAC using private keyPrivate key file format - default PEM (PEM, DER, or ENGINE)Specify the name of an SPKAC-dedicated section of configurationValidating user="%s" srp_verifier="%s" srp_usersalt="%s" g="%s" N="%s" assertion failed: srp_usersalt != NULLInternal error validating SRP verifier Creating user="%s" g="%s" N="%s" Internal error creating SRP verifier gNid=%s salt ="%s" verifier ="%s" %s: Only one of -add/-delete/-modify/-list -srpvfile and -configfile cannot be specified together. Exactly one of the options -add, -delete, -modify -list must be specified. -passin, -passout arguments only valid with one user. trying to read default_srp in srp trying to read srpvfile in section "%s" Trying to read SRP verifier file "%s" No g and N value for index "%s" Database has no g N information. user "%s" does not exist, ignored. t Cannot create srp verifier for user "%s", operation abandoned . user "%s" does not exist, operation ignored. user "%s" already updated, operation ignored. Verifying password for user "%s" Invalid password for user "%s", operation abandoned. Cannot create srp verifier for user "%s", operation abandoned. user "%s" does not exist, operation ignored. t SRP terminating with code %d. The particular srp definition to useModify the srp verifier of an existing userDelete user from verifier fileSet g and N values to be used for new verifierAdditional info to be set for userPass %s apps/srp.c%s "%s" %d = "%s" User entryg N entryNeed at least one user. default_srpDatabase initialised Default g and NStarting user processing Processing user "%s" List all users user "%s" reactivated. row pointersfailed to update srpvfile Password for user "%s" ok. user "%s" revoked. t User procession done. Trying to update srpvfile. Temporary srpvfile created. srpvfile updated. User errors %d. Talk a lot while doing thingsThe srp verifier file nameAdd a user and srp verifiermodifydeleteList usersuserinfo%*sCouldn't open file or uri %s %d: %s: %s %d: %s !!! Unknown code Total found: %d %s: criterion already given. %s: subject already given. %s: issuer already given. %s: alias already given. apps/storeutl.cNo PEM output, just statusSearch for certificates onlySearch for keys onlycrlsSearch for CRLs onlySearch by subjectSearch by aliasRecurse through names%s: the store scheme doesn't support the given search criteria. ERROR: OSSL_STORE_load() returned NULL without eof or error indications This is an error in the loader %s: only one search type can be given. %s: can't parse subject argument. %s: can't parse issuer argument. %s: serial number already given. %s: can't parse serial number argument. %s: fingerprint already given. %s: can't parse fingerprint argument. %s: can't parse alias argument. %s: No URI given, nothing to do... %s: Unknown extra parameters after URI %s: both -issuer and -serial must be given. Usage: %s [options] uri Valid options are: Print a text form of the objectsSearch by issuer and serial, issuer nameSearch by issuer and serial, serial numberSearch by public key fingerprint, given in hex���h��������x��h��X��H��8�����������x��8��������x��digest bufferapps/ts.cError getting password. cannot convert %s to OID nonce buffercould not create nonce could not create query Verification: invalid digest string Error loading directory %s Error loading file %s FAILEDResponse is not generated. Response has been generated. Typical uses: orConfiguration fileGenerate a TS queryFile to hashDigest (as a hex string)tspolicyPolicy OID to useDo not include a noncePut cert request into querytoken_inInput is a PKCS#7 filetoken_outOutput is a PKCS#7 fileOutput text (not DER)Generate a TS replyqueryfileFile containing a TS queryFile with signer CA chainVerify a TS responsePath to trusted CA filesFile with trusted CA certsuntrustedFile with untrusted certsbad digest, %d bytes must be specified Warning: could not open file %s for reading, using serial number: 1 unable to load number from %s Error during serial number generation.could not save serial number to %s ts -query [-rand file...] [-config file] [-data file] [-digest hexstring] [-tspolicy oid] [-no_nonce] [-cert] [-in file] [-out file] [-text]ts -reply [-config file] [-section tsa_section] [-queryfile file] [-passin password] [-signer tsa_cert.pem] [-inkey private_key.pem] [-chain certs_file.pem] [-tspolicy oid] [-in file] [-token_in] [-out file] [-token_out] [-text] [-engine id]ts -verify -CApath dir -CAfile file.pem -untrusted file.pem [-data file] [-digest hexstring] [-queryfile file] -in file [-token_in] [[options specific to 'ts -verify']]Section to use within config fileFile with private key for reply Options specific to 'ts -verify': [CRL path] %s: OK Chain:depth=%d: (untrusted)Recognized usages: %-10s %s Recognized verify names: %-10s untrusted certificatesother CRLsCRLfileshow_chain%serror %d at %d depth lookup: %s error %s: X.509 store context allocation failed error %s: X.509 store context initialization failed error %s: verification failed %s: Cannot use -trusted with -CAfile or -CApath Print extra information about the operations being performed.A directory of trusted certificatesA file of trusted certificatesA file of untrusted certificatesFile containing one or more CRL's (in PEM format) to loadAttempt to download CRL information for this certificateDisplay information about the certificate chainExtra parameters given. %s (Library: %s) options: Seeding source: os-specificengines: Show all dataShow build dateShow configuration directoryShow engines directoryShow compiler flags usedShow target build platformShow random seeding optionsShow library versionOpenSSL 1.1.1k FIPS 25 Mar 2021Show some internal datatype options�������<���$���������������������\���4���error with certificate to be certified - should be self signed error with certificate - error %d at depth %d %s %s: Invalid trust object value %s %s: Invalid reject object value %s need to specify a CAkey if using the CA command We need a private key to sign with Error obtaining CA X509 public key no request key file specified Generating certificate request No extensions matched with %s Input format - default PEM (one of DER or PEM)Output format - default PEM (one of DER or PEM)Private key password/pass-phrase sourcePrint out certificate purposesPrint the certificate fingerprintPrint OCSP hash values for the subject name and public keyClear all certificate extensionsTrust certificate for a given purposeReject certificate for a given purposeHow long till expiry of a signed certificate - def 30 daysCheck whether the cert expires in the next arg secondsOutput a certification request objectInput is a certificate request, sign and outputSet the CA certificate, must be PEM formatThe CA key, must be PEM format; if not in CAfileCreate serial number file if it does not existPrint the certificate in text formPrint various X509V3 extensionsFile with X509V3 extensions to addSection from config file to useVarious certificate text optionsCheck certificate matches hostCheck certificate matches emailCheck certificate matches ipaddrForce the Key to put inside certificateIncrement current certificate serial numberClears all the prohibited or rejected uses of the certificateCorrupt last byte of certificate signature (for test)Print old-style (MD5) subject hash valuePrint old-style (MD5) issuer hash valuepreserve existing dates when signing%s: Unknown parameter %s Forced keySignature verification error CA CertificateSET x509v3 extension 3SET.ex32.99999.3serial=<No Alias> Certificate purposes: %s%s : Yes (WARNING code=%d) No Yes CA/* * Subject: * Issuer: x509 name bufferthe_subject_namethe_public_keythe_certificateapps/x509.cnotBefore=notAfter=Getting Private key Getting CA Private Key CA Private Keyserial# bufferadd_word failure Getting request Private Key request keyNo extensions in certificate Invalid extension names: %s UNDEFCertificate will expire Certificate will not expire unable to write certificate Print serial number valuePrint subject hash valueissuer_hashPrint issuer hash valueSynonym for -subject_hashPrint subject DNPrint email address(es)Set notBefore fieldSet notAfter fieldBoth Before and After datesOutput the public keyOutput certificate aliasNo output, just statusNo certificate outputocspidocsp_uriPrint OCSP Responder URL(s)trustoutOutput a trusted certificateclrtrustClear all trusted purposesclrextaddtrustaddrejectsetaliasSet certificate aliascheckendExit 1 if so, 0 if notSelf sign cert with argx509toreqCAkeyCAcreateserialCAserialSerial filePrint out C code formscertoptcheckhostcheckemailcheckipCAformCA format - default PEMCAkeyformCA key format - default PEMforce_pubkeynext_serialclrrejectsubject_hash_oldissuer_hash_oldpreserve_datesRANDFILECan't load %s into RNG apps/app_rand.cCannot write random bytes: https not supported GETError loading %s from %s apps/apps.c%s Policies: <empty> %s: Can't load %s: Error on line %ld of config file "%s" config inputoid_sectionargv spacepass phraseOut of memory User interface error aborted! copycopyall
0x000x%02X, }; unsigned char %s[%d] = { };
0x%02X, autoenabling auto ENGINE support dynamicSO_PATHLOADinvalid engine "%s" SET_USER_INTERFACEcan't use that engine engine "%s" set. file name too long %s.%sunable to rename %s to %s %s.attr%s.attr.%sunable to open '%s' unique_subject = %s TrueFalseRequire explicit Policy: %s AuthorityUserNPN bufferpass:env:file:Can't open file %s fd:Can't open BIO for stdin HARNESS_OSSL_PREFIXwbappendingreadingwriting(doing something)Can't open %s, %s Can't open %s for %s, %s unable to load certificate http://no keyfile specified no engine specified cannot load %s from engine unable to load %s ')fstat('new DBallocate async fdsesc_2253esc_2254esc_ctrlesc_msbuse_quoteignore_typeshow_typedump_alldump_nostrdump_dersep_comma_plussep_comma_plus_spacesep_semi_plus_spacesep_multilinedn_revnofnamesnamelnamespace_eqdump_unknownRFC2253onelineca_defaultcompatibleno_headerno_versionno_serialno_signameno_validityno_subjectno_issuerno_pubkeyno_extensionsno_sigdumpno_auxno_attributesext_defaultext_errorext_parseext_dumpError loading PKCS12 file for %s Passphrase callback error for %s Mac verify error (wrong password?) in PKCS12 file for %s OpenSSL application user interfaceproblem loading oid section %s problem creating object %s=%s %s: Could not allocate %d bytes for %s static unsigned char %s_%d[] = {error converting serial to ASN.1 format error converting number from bin to BIGNUM error creating serial number index:(%ld,%ld,%ld) error creating name index:(%ld,%ld,%ld) name is expected to be in the format /type0=value0/type1=value1/type2=... where characters may be escaped by \. This name is not in that format: '%s' %s: Hit end of string before finding the equals. %s: escape character at end of string %s: Skipping unknown attribute "%s" %s: No value provided for Subject Attribute %s, skipped Hostname %s does%s match certificate Email %s does%s match certificate IP %s does%s match certificate Can't read environment variable %s Can't access file descriptor %s Invalid password argument "%s" Error reading password from BIO assertion failed: mode == 'a' || mode == 'r' || mode == 'w'bad input format specified for %s bad input format specified for input crl bad input format specified for key file %s: Can't open "%s" for writing, %s Error configuring OpenSSL modules �8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8��apps/bf_prefix.cPrefix filter0xa hexadecimal0Xan octalvaloutfile+intulongPEM|DER|ENGINEPEM|DERuintmaxparmNSSnsspvkP12p12PKCS12%s: Unrecognized flag %s %s: Value must be one of: --%s: Option -%s needs a value %s: Not a directory: %s %s: Invalid Policy %s %s: Invalid purpose %s %s: Invalid verify name %s (No additional info)%s %s PEM/DERmsblobhttp%s: Can't parse "%s" as %s number %s: Can't parse "%s" as a number %s: Bad format "%s"; must be pem or der %s: Bad format "%s"; must be one of: %s: Value "%s" outside integer range %s: Option -%s does not take a value %s: Non-positive number "%s" for -%s %s: Invalid number "%s" for -%s %s: Invalid format "%s" for -%s %s: Option unknown option -%s %s: Internal error setting purpose %s Usage: %s [options] Valid options are: p`��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��p`��Pa���`��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa���`��Pa���`��Pa��Pa��Pa��Pa��Pa��Pa���`���`��Pa��Pa��Pa��Pa��Pa��Pa���`��Pa��Pa��Pa��Pa��Pa��Pa��Pa���`��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa��Pa���`��Pa��Pa��Pa��Pa��Pa��a��Pa��a��Pa�� a��Pa��Pa��@a��Pa��0a���b���c���c���c���c���c���c���c���c���c���c���c���c���c���c���c���c���c���c���b��xc���c���c��8c���c���c���c���c��Xc���b���c���a���c���c��c���c���c���c���c���c���c���c���c���c���c���c���c���c���c���c���c���b��xc���c���c��8c���c���c���c���c��Xc���b���c���a���c���c��c���c��(k���i���i���i���i���i���i���i���i���i���i���i���i���i���i���i���i���i���i���i���i���i��Xj��Xj���i���i���i���i���i���i��hi���i���i���i���i���i���i���i��8j���i���i���i���i���i���i���i���i���i���i���i���i���i��Xj���i���i��Xj���i���i���i���i���i���i���i���j���i���j���i���i���i���i��k��<k��o���n���n��\n��,n��n���m���m���m��k��lm��Lm��,m��m���l���l���l���l��ll��Ll��,l��l���k���k���k���k��tk��k��Dk���m��<k��----- RSA-PSSECDSAgost2001gost2012_256gost2012_512Shared Requested Signature Algorithms: +%s+0x%02Xprepend certSecurity callback: Version=%s%s=%s, bits=%d digest=%s, algorithm=%s scheme=unknown(0x%04x), security bits=%d scheme=%sNOT OKNOT OK %s: %s Suite B: not tested TLSA hex data buffer0123456789abcdefdepth=%d <no cert> verify error:num=%d:%s issuer= verify return:%d error setting certificate error setting private key Client Certificate Types: UNKNOWN (%d),Peer signing digest: %s Peer signature type: %s ansiX962_compressed_primeansiX962_compressed_char2unknown(%d)groups to printSupported Elliptic Groups: 0x%04Xapps/s_cb.c Shared Elliptic groups: Server Temp Key: RSA, %d bits DH, %d bits ECDH, %s, %d bits SSL_connectSSL_acceptundefinedreadwriteSSL3 alert %s:%s:%s %s:failed in %s %s:error in %s >>><<<, ???, warning, fatal, ChangeCipherSpec, ApplicationData, Alert, Handshake%s %s%s [length %04lx]%s%s
%02xmemory full Failed getting peer address assertion failed: length != 0cookie generate bufferMissing filename Server CertificateServer KeyServer Chain%s: Error adding xcert %s: Key already specified %s: Chain already specified matched EE certificatesigned the certificatematched TA certificate...Verification: OK Verified peername: %s Verification error: %s Protocol version: %s assertion failed: num == 2Client cipher list: Ciphersuite: %s Peer certificate: Hash used: %s Signature type: %s No peer certificate Error with command: "%s %s" Error with command: "%s" Error finishing context Error writing keylog file %s Supported CiphersuiteShared CiphersuiteCheck CiphersuiteTemp DH key bitsSupported CurveShared CurveCheck CurveSupported Signature AlgorithmShared Signature AlgorithmCheck Signature AlgorithmSignature Algorithm maskCertificate chain EE keyCertificate chain CA keyPeer Chain EE keyPeer Chain CA keyCertificate chain CA digestPeer chain CA digestSSL compressionSession ticketOverall ValiditySign with EE keyEE signatureCA signatureEE key parametersCA key parametersExplicitly sign with EE keyIssuer NameCertificate TypeMD5SHA1SHA224SHA256SHA384SHA512anonymousrsa_pkcs1_sha1ecdsa_sha1rsa_pkcs1_sha256ecdsa_secp256r1_sha256rsa_pkcs1_sha384ecdsa_secp384r1_sha384rsa_pkcs1_sha512ecdsa_secp521r1_sha512rsa_pss_rsae_sha256rsa_pss_rsae_sha384rsa_pss_rsae_sha512rsa_pss_pss_sha256rsa_pss_pss_sha384rsa_pss_pss_sha512gostr34102001gostr34102012_256gostr34102012_512server namemax fragment lengthclient certificate URLtrusted CA keystruncated HMACstatus requestuser mappingclient authzserver authzcert typesupported_groupsEC point formatssignature algorithmsuse SRTPheartbeatsession ticketrenegotiation infosigned certificate timestampsTLS paddingnext protocolencrypt-then-macextended master secretkey sharesupported versionspsk kex modescertificate authoritiespost handshake auth, HelloRequest, ClientHello, ServerHello, HelloVerifyRequest, NewSessionTicket, EndOfEarlyData, EncryptedExtensions, Certificate, ServerKeyExchange, CertificateRequest, ServerHelloDone, CertificateVerify, ClientKeyExchange, Finished, CertificateUrl, CertificateStatus, SupplementalData, KeyUpdate, NextProto, MessageHash close_notify end_of_early_data unexpected_message bad_record_mac decryption_failed record_overflow decompression_failure handshake_failure bad_certificate unsupported_certificate certificate_revoked certificate_expired certificate_unknown illegal_parameter unknown_ca access_denied decode_error decrypt_error export_restriction protocol_version insufficient_security internal_error inappropriate_fallback user_canceled no_renegotiation missing_extension unsupported_extension certificate_unobtainable unrecognized_name bad_certificate_hash_value unknown_psk_identity certificate_requiredSSL 3.0TLS 1.1TLS 1.2TLS 1.3DTLS 1.0DTLS 1.0 (bad)RSA signRSA fixed DHDSS fixed DHECDSA signRSA fixed ECDHECDSA fixed ECDHGOST01 SignGOST12 Signs_cb.c:security_callback_debug op=0x%xKeylog callback is invoked without valid file! Checking cert chain %d: Subject: %s: %zu-byte buffer too large to hexencode unable to get certificate from '%s' unable to get private key from '%s' Private key does not match the certificate public key error setting certificate chain error building certificate chain Supported Elliptic Curve Point Formats: read from %p [%p] (%lu bytes => %ld (0x%lX)) write to %p [%p] (%lu bytes => %ld (0x%lX)) TLS %s extension "%s" (id=%d), len=%d error setting random cookie secret %s: Error initialising xcert DANE TLSA %d %d %d %s%s %s at depth %d # SSL/TLS secrets log file, generated by OpenSSL --- No %s certificate CA names sent --- Acceptable %s certificate CA names application layer protocol negotiation bad_certificate_status_response�k���k���l���k���k���k���k���k���k��tl��,l���k���k��tl��,l���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k��k���k���k��Ck���k���k���k���k���k���k��k���j���k���k��k���j���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���k���~�����~��T������������~���IPv4 IPv6 unix apps/s_socket.cACCEPT %s:%s ACCEPT [%s]:%s ACCEPT assertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(ai)) && (type == 0 || type == BIO_ADDRINFO_socktype(ai)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(ai))Can't bind %saddress for %s%s%s assertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(res)) && (type == 0 || type == BIO_ADDRINFO_socktype(res)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(res));�x����N��(��������ا��@��������8��� ���h ������P����h��@x��T���h���H���(��0���x��������G��phQ����V��xW��LH\���l��(�l��L8x����~��X��4���������h���hx����8����(���h�����H����غ��0X�������������D(������������px�����������x�����08�X���8��8�4��������������D��X��������X"��$#��@x%����%���8&��x,��h(@����F��P �I��� XJ��� �J��!�K��l!XM���!xQ��,"R���"�S���"�g��|#�g���#�l��$x���$~��%���P%����d%�����%x���&��X&���l&�����&����'(����'����'(����'H����'����(���((X���`(ج���(8����(H���)����|)h����)ȱ��8*(���t*��+(�X+���+�,�<,��,h����,H����,H���H-�����-�����-����$.���.8����.��4/h��\/(���/����/]��X08]��l0H]���08_���0(c���0�t��L1���18����18���D2(���p2X����2���2H���D3ؔ���3(����3(����3����44ؘ��h4(����4����4���X5���5���5H��@6���h6�����6����68����6����07H���d7X����7����7���@88���l8�����88����8����9(���@9����l9���9����9��:x��4:��h:����:8���:���;X��8;��t;����;H���;���<���`<����<8 ���<� ��=x��P=���=����=X��>���@>X��\>���x>x���>H���>8��?�p��h?xv���?8x��@�y��`@z���@�z���@X{��AX����A8����A����8Bؚ���B���Bh���Cȝ��8C����pCس���C(���D���\DX����D���E8��(E���tE���E��F��(F(�hFH�|Fx�F��F��G��$G�8G����G(����GH����Gh����G����0H����|H�����H(����HH����Hh����H����I8���$IH���8IX���tIh����I���J���dJ����J����JH��Kx��$K��dKH���K���K���L���\Lh���L� ���L���lM����M����M���M� ���MX��0N��hN����N����Nx��0OX��xO����O����O���P���PPX��|P����P����P���8Q���LQx���Q����Q����Q ���Q8 ���Qh ��R� ��(R� ��<R�#��tR�$���R�%��S�'��`S�'��tS(���S(���S((���S�(���S�)��T�*��HT,���T�,���T�/��UH2��DUx5���U�5���U�5���Ux7��V�7��(V�7��\V�8���V�:���Vh<��4W�<��HWh=���W�=���W�=���W>��XH>��<Xx>��dX�>���X�@���XA���X�A��TY�B��xYD���YE���YxE��Z�E��ZF��4Z�F���Z�I���ZJ���ZxJ��,[8K��x[�K���[�L���[HM��\�M��X\�N���\hR���\xR���\hW�� ]xW��4]�W��H]�W��\]�W��t]�Z���]h[���]�]��l^H^���^�^���^(c��_�c��(_�e���_hf���_8i��`j��P`xk���`�m���`�n��(a�p��taXr���as��bt��Lbw���b�w���b�y��4c(z��hcxz���c�z���c�z���c({���cH|��<dx~��hdH����d�����d����\e���e����eh����eX���4fH����f��g8���hg�����gzRx�����/D$4��SFJw�?:*3$"\�B���SLt����� F�I�B �B(�A0�A8�G�� 8A0A(B BBBCL����2B�E�B �B(�D0�C8�G�� 8A0A(B BBBG4���CB�D�D �Q ABB_ABLL����B�B�B �B(�A0�A8�G�A 8A0A(B BBBD��x����B�E�E �E(�K0�A8�DP�XH`HhGpGxG�G�A�H�H�G�G�G�H�H�G�G�G�M�G�dPW 8D0A(B BBBGH8���BF�B�B �B(�A0�G8�D`[ 8D0A(B BBBH0�����B�D�A �GP AABE�����9F�B�B �B(�A0�A8�G� L�%� 8A0A(B BBBJ��%H�%X�%B�%��%K�%H�%G�%G�%D�%G�%G�%B�%B�%G�%G�%G�%E�&E�&G�&G�&G�&M�&A�&s�%?�%H�%H�%G�%G�%D�%G�%B�%J�%A�%G�%G�%G�%E�&E�&G�&G�&G�&M�&A�&s�%��%E�%B�%H�%A�%G�%B�%D�%G�%A�%G�%G�%G�%E�&E�&G�&G�&G�&G�&G�&t�%V�%E�%H�%H�%A�%G�%B�%D�%G�%A�%G�%G�%G�%E�&E�&G�&G�&G�&G�&G�&t�%t �������L����vF�B�B �E(�D0�D8�I�W 8A0A(B BBBG$�H��<E�F�G eCAL`���B�B�E �A(�A0�| (D BBBGf (D BBBHDd����B�B�E �H(�H0�A8�D@�8A0A(B BBBH�h���B�H�A �D(�F0z (F ABBFh(C ABB4����gB�A�K � FBKACBp0���/F�H�B �B(�A0�D8�I�� 8A0A(B BBBK�%�G�B�B�f�F�K�U�B�L��4��E F�E�E �B(�D0�D8�I�� 8A0A(B BBBCL��>��;F�I�E �B(�H0�C8�Fp� 8A0A(B BBBB8D�C���F�K�D �R ABF` JBLH�$D���F�B�E �B(�D0�D8�G�� 8A0A(B BBBA���H���F�E�E �I(�A0�C8�J���C�G�G�E�B�d�� 8A0A(B BBBE��M�B�B�E�B�`� \�W���E�G x AA`�DX���F�L�H �E(�D0�C8�F� 8A0A(B BBBK��J�U�B�\��c���F�I�E �E(�D0�H8�I�c 8A0A(B BBBEh�L�Q�A� D �i���E�G x AAph j��BF�L�H �E(�D0�C8�F�) 8A0A(B BBBAS�Q�T�A���J�N�A�\� �q���F�L�E �E(�D0�A8�N�� 8A0A(B BBBHo�O�X�A�\< xy���F�L�E �E(�D0�C8�I�� 8A0A(B BBBG#�K�M�A�L� ���� B�F�B �D(�D0�� (F BBBGv (C BBBI8� �����F�A�D �Z ABHZ JBJp(<����F�B�B �B(�D0�C8�G�� 8A0A(B BBBAO�I�]�A���L�_�B�H�����rB�E�H �E(�A0�A8�DPd 8A0A(B BBBH(����E�D�J�w AADL`����B�B�B �B(�D0�A8�G� 8A0A(B BBBCLd����r F�B�B �E(�D0�A8�G�� 8A0A(B BBBF<�Я��"F�I�A �A(�G�^ (A ABBDT�����bF�I�E �D(�A0�FP� 0A(A BBBE�XL`TXAP(L س���E�D�D0l AAE@x \���tF�B�B �A(�A0�DPL 0A(A BBBD\� �����F�L�B �E(�D0�A8�K�) 8A0A(B BBBD��L�S�A� ����E�G j AI`@����F�B�B �E(�D0�A8�D�K 8A0A(B BBBC��g�K�A�L�`����F�I�E �E(�A0�C8�KPi 8C0A(B BBBC�������(����A�A�D�� AAAH\��6E�p$d���{B�E�D �A(�D04�����B�A�A �J�