�(H��1�H��H�5�Q.�E��H�C(H��H�muH�EH��P0H�{(H����H�W����[���H�C(H�/u�R0H�{(f.�H���3���H�|$H�����H�r�(H�5�#H�8�j�����fDH�EH��P0��f��R0H�{(H�������I�|$�vo��������f�H���H�|$�t����H���(H�8�9o���h����,w�H�=�����H��H�C(�4���@�+�H�������4���DH�t$ H��苐�H�C0H������H�5'P.H���?��I��H����H�@���t8H�5�K.H��t,L�%�K.��I��I�4$H��tL���ۄ��u�I�D$H�ChI�m�M���I�EL��P0�>���@H��(H�8�Qn��������Dv�H�|$�_���H��(H�8�+n���S����v�����f�� ���f.���H��H�wH�����H��H�� 鄆�@��H��H�wH�H��H�� �d��@��H��H�wH�����H��H�� �4Q�@��H��H�wH�H��H�� �Q�@��H��H�wHH��H�� �9Q�f���H��H�wHH��H�� �Ƀ�f���H��H�wHH��H�� ��[�f���SH��H���WdH�%(H�D$1�H���(H�$�����G��uH��1�H�5%H��賂��t_H���(1�H��H�01��Z�H��tDH�(u H�PH��R0H���(H�{ 1�H�$H�01��iZ�H�L$dH3%(uKH��[�1���@H�q�(H�5� H�8�f�1���fDH�Q�(H�5�H�8�f�1����d�f�ATUSH��L���M����I�$H��HLJ�HLJ�I�$H����H���(L��H�8�<��I�,$H��tZH����L�%��(� ��f��tgH�{ I�4$1�1�H���sY�H��t�H�mtfH�(u H�PH��R0H��1�[]A\�@I�D$L��P0�I�D$L��P0�j����H�mu H�EH��P0H�������[]A\�H�UH�D$H��R0H�D$�ff.�H��(H��W�dH�%(H�D$1��GH�$H�OH��T$�H�L$1ɈD$�i�H�t$dH34%(uH��(��Oc�ff.�@��ATUSH�� dH�%(H�D$1��G����H��H�=l���H�D$H���H�5�K.H��譎�H��H����H��H�=G1��L�H�+I����M����H�|$L��� ��H�|$��H�5ZK.H���R��H��H����H��H�=�1��K�H�+I����M��t^L��H�|$趘�H�t$H��t^H�U(H�=�1��jK�H�|$H�/uCH�WH�D$�R0H�D$�0@H�a�(H�8�Yi��ueH�|$H��t H�/uH�G�P01�H�L$dH3%(��H�� []A\��H�CH��P0M��������H�CH��P0�9������p����fDH���(H�8��h���t�����p�H�t$����f.�H���(H�5bH�8�b�1��W����>a�ff.���ATI��UH��SH��H� H��t H��Յ���H�{(H��t L��Յ���H�{0H��t L��Յ���H�{8H��t L��Յ���H�{@H��t L��Յ���H�{xH��t L��Յ�uoH���H��t L��Յ�uZH���H��t L��Յ�uEH�{HH��t L��Յ�u3H���H��t L��Յ�uH���1�H��t[L��H��]A\��@[]A\�ff.����g �H�H;=��(tH���(1�H�01��(U��H�H����SH���tHH���(1�H�01��T��H��H��tOH�1�H�P�H�H��t ��[�DH�G�P0��[�DH�i�(1�H�H�}�(H�01��T��H��묻�����@H��H���(H�5^H�8�`�1�H���ff.�@���W��~uS�GH����uJH�3�(1�H�01��7T�H��tH�(tH�C �CH�C [��H�PH��R0��@H�)�(H�5rH�8�j`�1�[�fD�K���ff.�H��Lcǃ�u�+�09�wtH9�tL���u��0��fD1��DH)�H�����j�f.�H��t_SH�GH�����t*� y1�[��{H��y�H�+u H�CH��P0�����[�H�PH���(H�5�H�81����H�+u��˃������G��~H�HH�� �؉���[���ff.���SH��H��H�5�H�� dH�%(H�D$1�H�L$H�T$�{i��twL�D$�C D��I���L�D$ ЈC H�CH;-�(t;H�L$H��1�H��H�5�D.�z�H�t$dH34%(u"H�� [��H���f.�1����\��SA�Ѕ�uH��tSH� ��H�n1�H�5LD.�'z�H��H��tGH�1�H�P�H�H��t��[�f.�H�G�P0��[�DH�I�(1�H�01��Q�H��봻�����Ð���W��~M�G��uH� 1�H�51E.1��y�f.�H��H���(H�5�H�8��]�1�H����������W��~M�G��uH� 1�H�51C.1��Jy�f.�H��H�5�(H�5~H�8�v]�1�H�����S������W��~M�G��uH� 1�H�5�C.1���x�f.�H��H���(H�5H�8�]�1�H���������W��~M�G��uH� 1�H�5�B.1��x�f.�H��H�u�(H�5�H�8�\�1�H����������W��~M�G��uH� 1�H�5D.1��*x�f.�H��H��(H�5^H�8�V\�1�H�����3������W��~E�G��uH� H�5C.�.��fDH��H���(H�5H�8�[�1�H��������ff.���H�OH�pH��H�q t1�H���z������H����y���H�OH�pH��H�q t1�H���D������H���D���AUATUSH��H��L�-�(�WI�E����D�gE��u`H��H����I�H��H���tH��~!H�CH��D��[]A\A]�D��p�H��u=I�}H�5kA������[�H��D��[]A\A]�f�H�5�H��A�������Z��A���H�5-H��A������Z��ff.�f����W��~=�G��uH��d�DH��H�5�(H�5~H�8�vZ�1�H�����S�����S�W�����G��uYH�8H��t8H�1�(H�0�ю�H��H��t H��[�@H�Q�(H�8�_��t��g�H�1�(H��H�[��H���(H�5�1�H�8��Y��fDH�y�(H�5"1�H�8�Y��fD���W��~E�G��uH��(H� H�0�+��H��H�-�(H�5vH�8�nY�1�H�����K���ff.���ATUSH��0�WdH�%(H�D$(1����y�GH�����K1��d���H��H����H���w�H�mA��t6E����t;H��(H�H�L$(dH3%(�~H��0[]A\�H�EH��P0�@H�D$�{`��1�1�H�5@.H���:t�H��� H�(u H�PH��R0H�{ 1�H�5T@.1�� t�H�|$H���o���H�T$ H�t$H�D$�Kz�H�D$H��tH�(���1��9���f�H�{ 1�H��H�2�H�5�?.�s�H����H�(�D���H�PH��R0�5���f�H�y�(H�5�H�8�W�1�����H�Y�(H�5H�8�W�1����H�PH��R01�����H�T$ H�t$H�|$���������d�����U�f���USH���W�����GH������H�^�(H9Gt@H�5 �(�4��H��tZ�C]H�߈C_�p��xGH�{ H��1�1�[H�5H>.]�r�f�H���H��t,�m��~�H�d�(H�5[H�8�V�H��1�[]�@1�H������H��H��t�H���~t�H�mtG��y��̐H��(H�5bH�8�ZV���H���(H�5�H�8�:V���H�U�D$H��R0�D$�ff.����AWAVAUATUSH���WdH�%(H��$�1�Ƅ$�HDŽ$�HDŽ$�DŽ$������GI������H���(H9G��H�5��(跃�H����A�]��A�_�PL���������1�1�H�5�<.L���p�H����H�(��I� 1�H�5�:.1���p�H��H���ZI�8�QI����CH���k�H��$�H�+�o�j�H��H���H��$�I���H�L$PH�D$(H�5:'1�H��$���^����H�D$PH�@H)�$�I���H�D$H����H�b�(I�81�H�01���G�H�D$0H����f�H�D$PI�8�H*D$�AY��H�� �H,�H����H�L$LH�\$8A�H��H�L$H�L$`H�L$H�L$XH�L$ ��L)�M�H���i��$�H��$��%�������I�81�I��H��H��H�5S;.�No�H��I�������I�.M�nu I�FL���P0I�8L9l$|�H�]�(1�H�01���F�I��H����L�D$H�L$H��1�H�T$ H�5%�}]����I�,$uI�D$L��P0H�D$`H���|H)�I�8A�����H���H������i���U���H�|�(H�5sH�8�R�D1�H��$�dH3%(H����H�Ĩ[]A\A]A^A_�f.�H�PH��R0�?����H�CH��P0�!h�H��H��������1�L�����H��H��t�H���6p�H�+�����I����g����H�a�(H�5�1�H�8�R��E���H���(H�5�1�H�8��Q��%���H�=Y1��������DH�i�(H�51�H�8�Q����H�S�D$H��R0�D$�]����D$LL)l$H�\$8H�$���$�H�D$I�8��$�H���H�T$PH�JH�B H�H�H�L$ H9��8H�D$`L�t$LH�\$8E1�H�D$H�D$XH�\$H�D$L�t$�1�A�H��H�� H�5�8.�l�H��I�������I�.M�nu I�FL���P0H���(I�81�M샄$�H�01��D�I��H����L�D$H�L$H��1�H�T$H�5e �Z���LI�mu I�EL��P0H�|$`�LL9��H�\$I�8L�t$0H���H�5�5.1�L����k�I�L��H��H�Q�H�L$I�H��uI�F�P0H���7���H�+u H�CH��P0�D$��$�H�|$(�j�H������f�H�\$8H�T$xH�t$pH�|$h�Gy�L�t$0I�81�H�X�H�5^5.L���6k�H�T$xH�t$pH�|$hH���q�I�H�Q�H�L$I�H��uH�|$0H�G�P0H�������H�m�����H�EH��P0�v���@Hc�$�H�$�L)�E1�DŽ$��D$L��$�I�8L9��#H��H9l$ ���H�\$H�\$81�A�H� ˫H��H�5i6.�dj�H��H���������LeH�mu H�EH��P0Ƅ$�L9d$��I�8�:���H�\$8��$�H��$�����������D$I�81퉄$����I�,$H�\$8�n���I�D$L��P0�^���I�mH�\$8�N���I�EL��P0�?��������E1������7L�H�0�(H�5�H�8��M�����H�\$���f���AWAVAUATUSH��H��HdH�%(H�D$81��G�D$�����o���H��H�L$H�T$1�H�5(��h���2H���(H9C��H�5B�(H���j{�H��� H�|$H��{]���T$���!�������L�%)�(I�4$1���X���V����H�F�(1�H��H�01��G@�H���.H�(u H�PH��R0H�|$��K�I��H���E1�H�t$ �H�Ǻ�|��I�$�_H��I�$uI�D$L��P0L�d$ �D$4D�l$(D�|$,L��Lct$0�D$�XV�H����H��H�D$H�{ 1�H���(H�01��?�L�D$I�(��H���hH�(u H�PH��R0H�{xH��tH�CxH�/uH�G�P0H���H�CxHǃ�H��tHǃ�H�/uH�G�P0H�{8H��tD��L���������E����H�{ D��H�z�1�H�52.�g�I��H����H�@�����L��D��H�=n�1���}�H���H����H�{8D�D$L��1�H�'6H�5�2.�f�H��I��������LH�{xH��tH�CxH�/uH�G�P0L�{xL��Hǃ��wT�I9��pL���H�{0H��t!M��u 1�E��@��H�sp���������H�l$�@fDH���H��� �Ka������H���(H�5�H�8�-J�D1�H�L$8dH3%(H���H��H[]A\A]A^A_�L�%)�(I�4$��U���X��1�1�H�5G1.H���e�H���6H�(u H�PH��R0H�{xH��tH�CxH�/uH�G�P0H���H�CxHǃ�H��tHǃ�H�/uH�G�P0H�{8H��t)1�1�H�5}/.�d�H����H�(u H�PH��R0H�{ A�1�1�H�/tH�5#/.�d�H�|$H��H���mH�D$H�/�ZH�G�P0H��tNH�{0�����I�4$�H����T��xH�{0H�sp�����������H�muH�EH��P0fDH�|$H���Z���H�/�P���H�G1�P0�D���f.�H� �(H�5R1�H�8�HH�����H�=�����f�1�H���v�I��H����H���f�I�,$�������������f.�L�%�(�I�4$��S���C����MH�|$H�/��H��1�H�5b-.1��[c�H��H�D$H��������m���DH�9�(H�5�1�H�8�xG��M���H��(H�5�H�81��x�����I�T$�D$L��R0�D$�1����H�G�P0�f���@I�PH�D$L��R0H�D$�����H�=)�����_����H���(H�T$H�5�H�81��+x��6���fDH���D��H�=�1��xy�H���H����������H��������Z���f�H�=��D������H�PH�4�(H�5�H�81��w�I�/�����I�GL���P0���I�/�������H�w�(H�5�H�8�F����H��I�$�u���I�D$L��P0�e����@D���AVAUATUSH��H�� dH�%(H�D$1��G��� D�gE���5H��1�H�T$H�5���a���GH�|$� �(H���(H9C��H�5p�(H���s�H���H�{0��H�l$H�E�{\L�m�H�{P� 1�A�L�� H����|�H������{\H�l$tDL�CPM��t;H��1�H� �FH�L�H�51+.�`�H�|$H��H�/��H��tuH�l$1��{X���{YA����A��A��@H���H�����[������H�$�(H�5�H�8�eD�1����,�������f�1�H�L$dH3%(�6H�� []A\A]A^�D�{X���E1��{YA��H�ChH���&H��H����CpH��H�|$H�/uH�G�P0H��t�H���H���pH��H���%R���%H�EH��H�mu H�EH��P0H�CH9��E �tOH��������/���E��t:H���(H�{ 1�H�01���6�H��� ���H�(uH�PH��R0f.�H���H��tHǃ�H�/uH�G�P0H�{8H��t)1�1�H�58).�^�H�������H�(u H�PH��R0L���M����D����E1�����1�H����H��H���Z���H���`�H�m�7�������:���f.�H�)�(H�5r�H�8�jB�1�����1��*�H���H���!Hǃ��i���f��{Y�CXH�l$�E���A��������H�M1�H��A�� E1���y�H�l$H���A�������H���(H�{0H��1�H�01��F5�H������fDH�a�(H�5 �H�8�A�1��M���H�m�=���H�EH��P0�.���fDH�=���<�������H�U�D$H��R0�D$���f�H�G�P0�j���E1�����@H�mH�D$����H�UH��R0H�D$����O?�ff.�@H��tkUH��SH��H��H�WH�6H��H)�H��x-H9�|(H��H9�~EH��e|�H��tH]H��[]�DH��H��H�H�����H����1��s�H����@��SH���G`�q��x{H�����H�C�H�S��H��H���H�C�H�C�H�H�S�H�BH�C�tH���.�H���H��tHǃ�H�/uH�G�P0H�CH��[H��@��f�[�ff.���H���(H����H���(H����AWAVAUATUSH��(H�oH����H;-��(I�����g����H� ��(H�a�(H��H��E1�H�01���2�H��H���K�����BL�}�U M������A�D$ �?���g���_�у� ����H�E0L�mH��@LE�M����A�L$ D�M A��A��A��A��A��A��E��A��uCE�Ѿ L��L$M��D�D$D�$L��L�T$�LI�D�$D�D$H���L$�����1�A��u3��D����A�D��� w�� t)�� ��I9�~0H��H�Q��u�A�D < w� u�A��L9�}A��u�A�A�D$ E �A��A�����A �E�D$ H��(H��[]A\A]A^A_�@H� ��(�d���@A�DMf�� �k����y������@u������t��������E�M�oL���5w�I��H�����P ������� �$I�N0I�~H��@HE�<��<��� �M ��L��H��� ��L�E0H�uH��@IE�H��P�H�mu H�EH��P0A�d$ �A�V M��M��@��L���у� ��u@��tz�Ѓ�<� <�=���UH�u,H�ED��@HE�B�<� ����tBI�W�1�H���Dx�H��H����H�m�9�S A�L$ H��L�{�у� �P���f�L�}���J���L�mH�P���������tjA�|� ������A��H�Q���@H�H��H��� ���������1�����f.�E��L�T$��E������f.�fA�|U ���@���`H�EHH��B�<8 ������N4�fDH�mu�H�EH��1�P0���A���T����A�| ���1���f�A��D�$I���s�1�1�D�$H��I��uR�@��t{A�D��� ���� �,�� �I9��:A����A��u2fA�PH��f�H��H�q��u�A�D �ǃ� vfA�<H����DA��H�����A�DM�ǃ� w-�� u�� fA�PA��H���A����A��u���fA�<PH���@�� ���� �K���A�|5 ����tWH��A��A����A����A�� �8����A�H���$���@���7A�|� ����u�A��H��먐A��tzA���:���A�� �7���H�muH�EH�T$H��L�$�P0H�T$L�$L�Ɖ�L�$��\�L�$H��L���0*�H�������E�D$ A��A���b���@A� ����fD� fA�P�a����A� �V���fDI�~H����H�uH�����L�Ҿ L���C�H��t0���1�H������A�T���� w� ��I9��E1�E1����fA�|u ���l����� f�7�t���� �i����A�A��}������uOH�EHH��fB�<x ������fDH�EHH�����H�u/H�EG��@HE����H�EH��P0���H�u.H�EF��@HE��@A�TE�f�� �����"���H���(H�5��H�8��7����E1�A��������������SH��H��H��H���H��0dH�%(H�D$(1�H�L$L�L$H�D$ H�ygL�D$�D$H�D$H��WH�D$1��X��1���t�T$H�t$H���'�H�\$(dH3%(uH��0[��5�@AVAUATUSH��H�� H�8dH�%(H�D$1�H�D$H�D$H�����{_H���EH��~"f�����_ ���H*��Y��H,�H9kH��HM{��@�H��H���q�{^��H��(H�0H�{ 1�1�H���)�H�mI��u H�EH��P0M���0I�D$����.�{^H�HH���H���HD�H���(H�5N�H�81��|g�H�|$H��t H�/uH�G�P0H�|$H��t H�/uH�G�P0M��tI�,$uI�D$L��P0�����H�L$dH3%(�vH�� []A\A]A^ÐH�Q�(H�0�����H���(1�H�01�� )�I��H��t�H��H�L$H�T$1�H�5*��?���y���H�D$H�H�D$H�I�,$�`���I�D$L��P0�P���DE1������L��1��A�H�{8H��I��H�}�(@��H9G�gM����H� G�(H�ؿ(E1�L��H�01��P(�I��L�������������H�{xH��tH�CxH�/uH�G�P0Hǃ�I�Ff�L�sxH��~f�f��1��I*��H*��^��{_���uMI�,$uI�D$L��P0����o����H� 9�(�M���@H�=u���������H���f.�H�|$L���3'�I��H������H�@���tlH�|$H�/uH�G�P0H���H��tHǃ�H�/uH�G�P0H�t$L��H�=v�1��nf�H����5���f���L����#�I�����H�PH�C�(H�5��H�81���d�I�m�;���I�EL��P0�,����1���AUATUSH��H��8�WdH�%(H�D$(1�H�D$����H�D$ ���2�G����H���(H��1�H�L$H�5[��ZN����H��(H9C�iH�5��(H����`�H����H�{8�^H���������H�l$H���PL���H�{xH��L���z�H�D$ H���l�x �bH+hH���WE1�f�H��H����������tLM���H�|$ H��JH�/uH�G�P0H�{xH��L����H�D$ H���UH+hH���H�D$ M����H��t3H��L���!@��� H�|$ H��tH�D$ H�/uH�G�P0H�:�(L��H�8�&�H�D$ H����I�,$��I�D$L��P0H�D$ �n@H���H��� �CH�������H��(H�5��H�8�%1�1��3�1��Y�I��H�����DH�|$ H��tH�/uH�G�P0�1�H�L$(dH3%(�H��8[]A\A]��H��L���?��x H�|$ ���H�|$ H��tH�/uH�G�P0M��t�I�,$u�I�D$L��P01��D�31���+�����H�|$ H��t�H�/u��DH���(H�5B�H�8�:0�1��E���H�{ 1�H�5�.1���K�H��H������H�{8H�}�(H9G�cH��(H� �(E1�H��H�01��]#�I��H�mu H�EH��P0L������������H�{xH���H�������H�D$ H���H�|$ L���7d�H�D$ H�������H���H���{���Hǃ�H�/�f���H�G�P0H�D$ �U���H�=�������A����1�H���n��H��H���"���H��� M�H�mtS�����������fDH����������H�D$ ���DH�y�(H�5"�H�8�.�1�����H�U�D$H��R0�D$�@�H�����I�����I�,$H�D$�����I�T$L��R0H�D$�m����,�fD��L��AWI��L)�AVLc�H�AUM��I��ATUSH��(L��L�D$H�D$�������H�D$����������8 ���xL9��0���������L� ���� u����c���N�8 ��H+D$H�I����H��H��([]A\A]A^A_�f.�A�C M�{� ��M�cHA�$�D$I����I�G�L��I��H)�H�D$H9���szH����L$L�������H��t]H9�vXI��~G��%���?�4�A�9�uH��I9��f��u��4A�9�t�L9��KJ�40H9�w�f��L$L��H����O��H����H+D$H�|$`H�I��H�H��(H�����[]A\A]A^A_�fDL��e����8 ���i����f�8 ���\���@�L� �z���H+D$H��(H�[]I��A\A]A^A_����E����� L��M��L�������H��t?L)�H�I��H��H��([]A\A]A^A_�I�S0M�CH�@ID�I���Z���D�4H���H�D$`H�|$H�8H��(H�����[]A\A]A^A_�H�l$����f.�H+D$H�I��L�뇉�L��L�|$�]���f�8 ������8 �����ff.�AWAVAUI��ATUSH��H��8dH�%(H�D$(1�H�M�(H9G��H�5�(�Y�H����H���^������H�D$ L�{x1�E1�H�D$H�D$H�D$ ���ZL�{xM��t M�wM����1�H���R��y��9+��u�M��tI�,$tIH��tH�mu H�EH��P01�H�T$(dH3%(H����H��8[]A\A]A^A_�I�,$u��I�D$L��P0�H���H�����@��� ���H���(H�5��1�H�8��)��f�H���L��H���^�H�mI��H�EH�D$u H�EH��P0M���<A�G ����M�w1� �TI�W0M�GH�@LE�A�O H��H�S@�sZ�{[�t$��������I��H��M��M�I��_�ZYH����H�D$ H�(M��xHD$L9��SH9�}dM����H��H��L��H�L$�d�H��H����H��L���37�H�L$���H�UHT$H�muH�EH�L$H��P0H�L$1�L9���I�/u I�GL���P0H�{xH��tH�CxH�/uH�G�P0H�CxE1�Hǃ����fDA�G H���H�D$I�� �����M�GH���fD1�H���^��H��H�������H���E�H�muH�U�D$H��R0�D$���������@L��H��L���rc�H��H������M��u`�I�/�V���I�GL���P0�G����L���(���t�A�G ��1�H�L$��H�L$H��I���_����M������I�,$uI�D$L��P0M��u����DH�TM��xH�t$J�L-H�H)�L9�HM�H��H+D$H���H��jI9WdL��M�������H��L���>5���cH�+u H�CH��P0H�g�(L��H�8�D�H��H��tKI�,$�S���I�D$L��P0�C���H��L���6b�I�/H��u I�GL���P0H���x���M������I�,$����E1�����fDH�{xH��tH�CxH�/uH�G�P0H���H�CxHǃ�H��tHǃ�H�/uH�G�P0H����M��t^H��L���:4�������H�m����H�EH��P0��I�L��H+T$���H�mu H�EH��P0I�,$�����=���1�� �I��H��u�����I�,$I������������#�M�������H��(H�H���ff.�@��SH��H���WdH�%(H�D$1�H�$������~e�G��u>H��H��H�5J�1��j@��1���tH�4$H�����H�L$dH3%(u@H��[�H�i�(H�5��H�8�$�1���fDH�I�(H�5��H�8�$�1����"���USH���W����GH�������G_H���(H9G��H�Q�(1�H�01���H��H��thH�@������{ ��H�{tH��H��[]ÐH�+u H�CH��P0H���H��tHDž�H�/uH�G�P0�E]�E_1�H��H��[]�f�H������t���H��H��t׀{ �����H���*����o���1��DH�!�(H�5j�1�H�8�`#��P���H��(H�5��1�H�8�@#��0���H�PH�}�(H�5��H�81��|T�H�+�M���H�CH��1�P0������H�hH��H��tH���1��D��H�GhH��tH�GhH�(t1��f�H��H�PH��R01�H���ff.���S1���0H��H��t1��Z�H�CH��tH��[�fDH�+u H�CH��P0[� �f.�ATL�g8UH��L��S��5��E0H��tAL��H���&��u"H��L���*��uH���E0[]A\�@H�+u H�CH��P01�H��[]A\�fD��SH��H�� dH�%(H�D$1��H�D$��H��H�L$H�T$1�H�5��=�����{I���T$����H�|$H��x>��ub��tg��u H�{ H�|$H�{�n+�H�t$dH34%(��H�� [�@����H�q�(H�5b�H�8�!�1��fDH��uۃ�u�H�{H�|$�1��@H���(H�5:�H�8�� �1��fDH�q�(H�5<�H�8� �1��]���H�Q�(H�5��H�81���Q�1��;���f�H�)�(H��H�5�H�81���Q�1�������f�AVAUATUSH��H�o dH�%(H�D$1�H�GH9���H�WH��H)�L�,�H��xH9�HO�H��M�d�H�SXM��H�D$E�4$�M��A�$�sJ�{KP�RV�E�4$ZL��H��Y�HH�HCH����B�H�L$dH3%(uH��[]A\A]A^�@1�1��7Y��������SH�G�H��H�W��H��H�G�H�G�H�H�W�H�BH�G��GHH�H��t ���H�CH�{8�+.�H�{XH��tH�CXH�/��H�{`H��tH�C`H�/tqH�{PH��tH�CPH�/tJH�{hH��tH�ChH�/t#H�{ptH���L �H�CH��[H��@��H�G�P0���H�G�P0��H�G�P0��H�G�P0�\���ff.��H��H��(H�5��H�8�F�1�H���ff.�@���H~>�IuH�y�(H��@H��H���(H�5��H�8��1�H�����fD���H~>�IuH�ɫ(H��@H��H�e�(H�50�H�8��1�H�����3������H~>�IuH�y�(H��@H��H��(H�5��H�8�V�1�H����������H~>�IuH�)�(H��@H��H�ŧ(H�5��H�8��1�H�������ATUH��SH�H��H����H��I��H��H9�s;H�ZH��������?H9�wpI�<$H�4���!�H��twH�]I�$1�[]A\�1�H9�w�f�f���H*��Yğ�H*�f/�r�H��H��H�H�� H�H��H�\�DH��(H�5 �H�8�2��������������ff.�@��SH�w(1�H���GIH������1҅�x\H�{8��*�H�{XH��tH�CXH�/tgH�{`H��tH�C`H�/t@H�{PH��tH�CPH�/tH�ʨ(H�H��H��[�fDH�G�P0���H�G�P0��H�G�P0�ff.�@ATUH��H��8S�G���.�H��tzL�`H�u(H�}H��L���-�����xIH�u1�L��H���H4�H��H�t3H�P�1�H�H��t ��[]A\�H�CH��P0��[]A\��H�H��H�u H�CH��P0������ATI��USH��H�PH������� �H�S`I��H��H��t'H���(H�����L��H�0�'1�I�,$H����H���'�} �TL�eH�CH��������L)�H9����{0H�K �:I�H9���H�sH9��@H�S(1�H�4�H��H)��+3�H����LcL�cL;c ~L�c H�EH�X�H�]H��u/H�EH��P0H��[]A\�DI�D$L��P0�?����1�H��[]A\�fDH�s(H�{�����x5H�CH�K H�sH9��Z����DH��(H�5��H�8�:�H�mu H�EH��P0H�����H��[]A\�f.�H�S`H�H������H���} �����H�����������H9�tCH�������u�H�CH�K ���f�H)�H�<�1�H����H�CH�s���DH�{8H���!���J������ff.�@��AVAUATUSH��H��H��H��H��0dH�%(H�D$(1�H�L$L�L$I��H���H�D$ H�D$H���H�D$1�H�$H�D$�9����H�|$L�%�(L9���H����H�G����t�?�H��H���������H�$L9�tH��tH�@����Z�CHL�k8L���x&�H�{XH��tH�CXH�/uH�G�P0H�{`H��tH�C`H�/uH�G�P0H�{PH��tH�CPH�/uH�G�P0H����H���mA�H�CXH����}�CK�SJ�} uH�C`H��SJ����H�<$H�C H�kL�s(H��tL9�t� �H����1�L��H���������L��� �����C0�H�C1�f�SHH�L$(dH3%(�8H��0[]A\A]A^�@H�-����@1�������f�CJH�=��(L��H�5=1���H�CPH���%���D�����널1�L��H������x��C0H�4$H��H�C����H���;����f�< ��< t,H�M�(H�T$H�5c�H�81���F���������D�E������< uĀ}������@�KK�-���H�PH�5��H� �(H�81��F��6���H�PH�5�����l�}�k����i���ff.�f���USH���H��H�F���t_�~ H��y.�{IupH�nH��~ H������H��x(H��H��[]���@H��H�t$�;��H�t$��t�H��1�[]�f�H�PH�E�(H�56�H�81���E���f�H� �(H�5��H�8�J���H��(H�5��H�8�*�����USH��H��H�-<�(dH�%(H�D$1��HH�,$�H��1�H�5��H���Z/�����{I�H�<$�A����H�$H9�ufH�kH����H9k ~*�{0tH���=�����xaH�s(H�{H�������xMH�k H����H�L$dH3%(��H��[]�fDH�@H�5��H�PH��(H�81��D�1��@H���(H�<$H�0��H��H����V����(�H��u�H���(H��H�5��H�81��;D�1��k���@H�y�(H�5"�H�8��1��J���H�Y�(H�5$�H�8��1��*������ff.���USH��H��H�-��(dH�%(H�D$1��HH�,$��H��1�H�5��H���-��t|�{Iu`�{0tH��������xdH�<$��?��uaH�$H9���H�����H����H�L$dH3%(��H��[]�f.�H�y�(H�5D�H�8��1��fDH�I�(H�<$H�0�=�H��H���u��O'�H��t�1��fDH�)�(H�5��H�8�j�1��n���H�@H�5�H�PH��(H�81��B�1��D�����@��USH��H��H�-L�(dH�%(H�D$1��HH�,$�.H��1�H�5��H���j,�����{I�(H�<$�>����H�$H9�u~H�KH�C H)�H���HI�S0��t?��uHH�CH��H�4�H�H�K�3�H�L$dH3%(�H��[]�H9�u H����H�����x&H�K�H�@H�5��H�PH���(H�81��A�1��@H���(H�<$H�0��H��H�����H�KH�C H)�H���1���H9��4����#���fDH�y�(H�5"�H�8��1��5���H�Y�(H�5$�H�8��1�����H���;�H�S H�S����fD�3%�H�������1����� �ff.���S�H���IH�����0t ����x]H��(H9CtXH�!�(H��1�H�01���H��H��t2H�@�����H�{t H��[�DH�+u H�CH��P01�H��[ÐH��H������a�H��H��u�1���DH�I�(H�5�1�H�8���fDH�)�(H�5��1�H�8�h����H�PH���(H�5�H�81��?�H�+�h���1��m������H~^�Iu0H�PH��tH��(H�0�B��H�)�(H��@H��H���(H�5`�H�8�� �1�H�����c����H~H�I��@�C���AUATUSH���I��H�FH��H������QH�~�F�1�H���%�I��H���1�H��H������I�$�zH��I�$uI�D$L��P0L�mL�����I��H����M�mH�s(H�{L�������H�{J��L���E �L���m��H�}(L�k H�G���th�C�H����H���H�u0H�-ř(H�CH9�t'H�F��� �+H�{hH�������x1H�EH��H��[]A\A]�f�H�PH�5u�H��(H�81��=�1�H��[]A\A]��H�HH�CH�5�H�PH�֖(H�81��\=�H��1�[]A\A]��H���(H�5\�H�8���1��fDH�H�sh�V���H��I�$�v���I�D$L��P01��f�����K!�H���N���H�+�(H�5�H�8�l��3����L����1������H�PH�5��������H~>�IuH��G��H��H�ŕ(H�5��H�8��1�H���������H~V�Iu(�0tH�W H�w��-���k�H��H�]�(H�5(�H�8� �1�H�����+�ff.���UH��SH���~���H����H�}hH��H��tQ�d7�I��H��tlH�UXH�MH��tO1�H��H�=7��<�H�+uH�SH�D$H��R0H�D$H��[]�DL�1�(H�UXH�MI�H��u�H��(��H��1�[]����H� H��H��tH���1��DUSH��H��� x �<���xPH�k1�A�����H�߾.H���LA�H���uH�H��H��[]��H��H��H�pH��[]�D�1���@AUATUSH��H�GH�VH�lH��������H9���H��H�<�I���3A�I��H����1�H��H��H���'"�H��tVH�CH��L��I��H)�H���"�H��u�1D��.u�/H�����u�H��L��L)�H���+�L��H�D$���H�D$H��[]A\A]����H��1�[]A\A]�fDAVAUATI��H��H�5U�USH��PdH�%(H�D$H1�H�D$@H�L$H�T$PH�D$@PH�D$@PH�D$@P1�L�L$@L�D$8�$&�H�� ���%H�|$�H�5��L���#�H��H����H�t$(H��1��'�H�߃���f���H=PK��H�D$(H��1�H�p�'�H�߃���6��=�H�߉���=�DLc���H��H����H�t$Ll$(H��������H9��BH�|$�H��H��HD�1����I��H��� H���!4�H�t$(1�H��I����&����H�T$H�پL�����H��I����H�D$L9�� L�H�|$t�ZH�D$H��H�D$L��H�|$�+� �/���$H�=����/�7����/I��H����H�5�.H���R0�I�,$H���tH���(����CH����1���L��H��H�52���H�+H��u H�CH��P0I�mu&I�EL��P0�H�=y�/H�5��1��#7�1�H�L$HdH3%(H����H��P[]A\A]A^�D�S�H��uH�=/�/L��H�5����6��H��1��&���@H�t$L���S��I�mH��u��]���@��H�=��/1�1�L��H�5Z��6��[���@���H��H���D���H�P�(L��H�5�H�81��L6��&����H�5w�H�=Z�1��������fDI�D$L��P0�|���H���(H�5 �H�8��I�m�������f.���H��(���tH�5"fH�=��1��y��H�=��/H�5���F��S����H����I�mu I�EL��P0H�=��/L��H�5J�1��o5��I���f.�H�����2���H�����������)�f���ATUH��H��H�5d�SH��dH�%(H�D$1�H����!���(H�<$H�� x�$������H�<$H�uA�����1�L�gH�^H�����H�<$H��tO�G ������ ����������H�O0�@H�WHH��HD<�/��H�����HE�L��H���>�H��H��tpH�} H�����I��H��t4H�+u H�CH��P0H�<$H�/uH�G�P0H�}L���_����@DH��(H��H�8�v�H�+uH�CH��P0fDH�<$H�/uH�G�P01�H�L$dH3%(�|H��[]A\Ä�u\H�GHf�<X/���)�����t4H�O0�@H�WHH��HD</�������H�GH����H�GH��f.�H�O0�@H�WHH��HD���(����SH���=�H�{H��tH�/tTH�{H��tH�/t5H�{ H��tH�/tH�CH��[H��@��DH�G�P0���H�G�P0���H�G�P0��AWAVAUI��ATUH��H��SH�����H����H�}H��H������H�+I����M�����=��-��H�-��-L�5���;f�I�}H�����H�+I��u H�CH��P0M����H���}t^H��L��L��1����H��H��u�I�,$uI�D$L��P0@1�H��[]A\A]A^A_��H�CH��P0�J���f�I�$H�P��I�$H��u�I�T$�D$L��R0�D$�DI�,$uI�D$L��P01��E��H��[��]A\A]A^A_���SH��H��H�5��H��dH�%(H�D$1�H������t^H�$H�s H�{�]�����tI��t$1���@��� �H�L$dH3%(u*H��[�H�$H�=�/H�5K�1���0��1��������AUATUSH��H��H�5+�H��(dH�%(H�D$1�H�T$�K���#H�T$H�s H�{���A�Ņ��H�|$�����3���H��H����H�{H�����H�mI��u H�EH��P0M����A����L��H�=��1����H��I�,$uI�D$L��P0H����H�{ H���y �H�mI����M����H�{L�����H��H��tNH�pH�x �A1�H�+u=H�SH�D$H��R0H�D$�'DH��H�=��/H�5ܽ1��X/��1�H�L$dH3%(uLH��([]A\A]�H�EH��P0M���k���H��(H��º/L��H�=��1����H���������ff.�f�AWAVAUATI��H��USH��H�t$(H�T$H�L$ dH�%(H�D$x1���H����I�|$H��H�����H�+I����M���z�=��-�)H���-L�|$H�$H�D$@H�D$0H�$H�t$H�=��1��X��I��H���VH�=�(�8~I�t$L��/1�H�=˼�U!�I�|$ L����I��H���<H�$�X�݃��zE1�I�.��H�D$H��t���I�|$L����H��H����1�L�����H�D$����H�|$��I��H����H���0)�I��H����H�����H�x�#4�I��H����A�L�¾��u�KD�B�A�F�uI�΄�t.��H��I�N< u��B� A�F< u�A�FI�N�uI�΄�uҍuHc�� L��L�D$f��u��L�D$I��L�����M���*L���t(�L��H���i(�1�H��A������H���A��I�mH���3I�.�f�H�L�-6�(H�P�H�H���_L9��iL��L�|$H���mH�\$ H���_1��W��H�H��LL�|$I�/��I�.u I�FL���P01�H�L$xdH3%(H����H�Ĉ[]A\A]A^A_ÐI�FL���P0���H�CH��P0�2����H���h'�H��I���-�H�� ��A�H�D$8H��%���H��H ����H�t$8H9���M��t,A�NH�ʁ����L��H��H �H)�L)�HH�H����H��I�~���H��H��tBH�@H;�(�����H�muH��P0H�m�(H�T$H�5 �H�81���*��H�+��L�|$1�I�/����I�GL���P0���fDI�.u I�FL���P0H�$H�$�8�?���L��L�|$H�T$(H�=��/H�5�1��l*��f.�A�~ @���"I�FH�P�@�� ��I�vH@������I��H��� I�|$ H�����I�mH��uH�D$I�EL��P0H�T$H������H�B�������H��H�T$��(�H�T$H�����H����H�����H�T$�I��H�����H����D��H�|$0f���G�T$@D��A����A��G(��?D�l$H�T$D���D$`�����T$L��� ��������P���D$T�T$P��I��H����D����v �H����I������*����L�-Ʉ(1�H�CH��P0L9������I�mM���6���I�EL��P0�'����H�т(�����L�-x�(I�EL��H�+t�I�mM������f.�I�F0I�vH@��@HE��/���I�FL���P0���f�I�EL��P0I�.������f.�L���h��������I�FA�~ H�P�@�� �����fDH�=A�/H�5Ķ��������H�=��o��I�������H�t$H�=��1������H���(H�5ڸH�8�2��I�m�����I�EL��P0����H���(��������H�t$H�=F�1�������1�����$��I�GL���P0����D��SH��H��H�5�H�� dH�%(H�D$1�H�T$���tTH�t$H�L$H�T$H�����H��t8H�(t"H�D$H�L$dH3%(u!H�� [��H�PH��R0��@1������ff.�@��SH��H��H�5��H��dH�%(H�D$1�H���"��1���tH�4$1�1�H���Z���H�L$dH3%(uH��[����ff.�@��AUATUH��H��H�53�SH��(dH�%(H�D$1�H�T$H�D$����iH�t$�~ xH��������MH�t$H�L$H�T$H�����H��H���H�|$��H����H���p'�H��H�5��H��I���;������T$H�|$��u^H�T$1�H�����H�+H��u H�CH��P0H�|$H����H�'(�����H�/��H�G�P0�����I��H��tSH�MH�uI���/1�H�=�����I�mH��u I�EL��P0H��tH��H�=��1����H��H��uKH�+u H�CH��P0H�|$H��t H�/uH�G�P01�H�L$dH3%(H��udH��([]A\A]ÐL��H��H�5����H�mA��u H�EH��P0E��u�H�|$����H�t$H��1�H�=g��B�H�|$�������AWAVAUI��ATI��H�w UH��H��SH��H�L��������Ã�t�H����[]A\A]A^A_�DH�u�/L��1�H�=Ӳ���I��H��teH�} H�����I�.A��tAE��xKt�H�MH�uM��/H�=��1���G��I�EH��u�fD1��s����I�FL���P0E��y�������Y������UH��H��H�5E�S1�H��(dH�%(H�D$1�H��H�T$H�$H�D$�y��t%H�t$H�T$H�����������tE��t H��H�\$dH3%(u~H��([]�fDH�5)~(H�=ձ1���H����fDH�T$H�5~(H�=��1��v�H�|$H��H�/u�H�G�P0��H��H�=��1��G�H���o�������f.���SH��H��H�55�H�� dH�%(H�D$1�H��H�T$H�$H�D$�l��tHH�t$H�T$H�������t��t-��t��uXH�|$H�/t8H�1}(H�H��� �1�H�t$dH34%(uH�� [��H�G�P0H��|(����H�%���H�wH��t;H�OH��tH�yuH�=��1����D�/H�={�1�����DH�=M���ff.��AWAVAUATUSH��H�$H��H�5�dH�%(H��$�1�I���� �H����H�ǺH����I�����L���������H�|$`L����H������H�����T$`H��%�H��H �H=PK��D�d$l�l$p�p�I��H��������D��L����A���H��H �D��H��H �1�H�H)�H�H�\$@�I�����H��$�L��L�t$H�D$HH�$���H�����H=PK��L�d$XL����L�����H���"L���<$�L���D$�0$�L���D$�$$�L���D$�$�L���D$���L��H�D$ ���L��H�D$(���L��H�D$0��#�L������#�L������#�L���L����ž�Hc��r��H����L�����H�D$8��H����f��A�DN�M��f���!L�4$K�,&f�L��I���&�A�F�I9�u�M���EL9��}DI��L9�toL����%���u�L�t$L���u��I�m��H�=K�/L��H�5ͫ1����E1�H��$�dH3%(L���H�Ę[]A\A]A^A_�1�H��N�D$��H�<$1�L����H��H�����x xH��������4H�t$1�H��/H�=r��}��H����T$H��H�=[��t$(�L$,Q�L$0QH�L$`H�t$XL�D$PL�1H�L$HH��1��b�H�� H��H����H��H��L���t�H�mA����H�+��E����L��H�D$H����H����G���L�t$��H����L�����H��v(��������H�t$HL��H�=��1�������@L�������Y���L��E1����H�=��/L��1�H�5?��=��I����I�EL��P0�����H�CH��P0�5����H�EH��P0H�+� �����f.���H�=t����H��u(��H�=\�H��d��H� oH�C�PP��H�����HD������fD���I��H�������H�=ȳ/L��H�5[�1��o��{���f.�L������d���H�,$E1����L�����I�mu I�EL��P0H�m�.���H�EH��E1�P0������t"H�cr(��H�5��H�81����L���@��I�m���I�EL��P0�������L�t$�������AWI��H�=��AVAUATUSH��H��H���dH�%(H��$�1��C���H��w(1�H�L$H��H�5�������H�\$�{ �L�sM����H�L��L�d$ A������YfD����H�+u H�CH��P0H�|$H��E��1Ҿ/�Q �H��H�����H�|$H��1��$�H��H��tPL��H���������u�H�|$H�/��H�+u;H�CH��P0������/DH�=��/H�5��� ��H�|$H�/uH�G�P0�����H��$�dH3%(���gH���[]A\A]A^A_�H���`����t�H�\$������D$8%�=�t(H�+�ifDH�=1�/H�55��}���k����{ xH�߉L$���L$������H�=�/H�މL$�W��L$H��I���BH�M�g I�_�L$L9���H�|$H�uH�W�"�H�������H�|$�L$I�G�W ��A�Ѓ�A�� @���@����E���/L�G,��@H�wDL��HD�B�<�/��t`H�ƺ/1��L$H�=X����H��H���x���I��L$H�/uH�G�P0�L$I�_H�|$�1�1�� �H�|$�L$I�GH�/�K���H�G�L$�P0�L$�7���H�CH��P0���E����L�G.��@H�wFL��HD�fB�<r/���F���H�����I��H�������H�=z�/H��H����L$��������s���E��t,L�G/��@H�wGL��HD�B�<2/�����H�WHH������H�WHH����H�WHH���s������H�G�P0�)���D��SH�=�-H�� dH�%(H�D$1��������H�,r(���-/���-/����-/������H�=q�-���H��H����H��s(1�H�=��H�0���H�y�/H��tlH�H��H�5��H���&��xRH�[�-H�5��H��H�I�-���x0�k �H�$�/H��tH�H��H�5L�H������yD1�H�L$dH3%(H����H�� [Ðfo��-���-��-�o ��-fo�-��-�o��-���-��-���-���-) ��-)$�D$��-���-)��-���-������f�H��H�$H��dH�%(H��$1�H��H�H9�rH9�w�$Ƅ$����H��$dH3%(uH������ff.���SH��dH�%(H�D$1�H��H��$@H��$��H��H�$�T���H��H�5��H��H)�H)�H9�H�Gm(HB�H�$H�81��E�H�t$dH34%(uH��1�[�������H��H��H�5r�dH�%(H�D$1�H�����1҅�tH�<$��H��o(H�H��H�L$dH3%(H��uH������ff.����H������H�go(H�H���ff.���H����^��H�7o(H�H���ff.���H����D$�D$�D$�L$����D$���Hc|$H��������%��SH��H�5c�H��dH�%(H�D$1�H�T$�D$���tW�D$��u/����H�~n(H�H�L$dH3%(u.H��[�@�[�H���n��H���V���@1����W�����Hc=e�-���USH���T�-��t?�F�-H���-H��p�C��t�;H�s1��t���CH�ðH9�u�H�=�-H��tH�/H���-tH��[]�DH�GH�@0H��[]���AUATI��USH��H�|m(H9�toH��H��tgH�<=H�5��-H��1���H��H��t5H�@���uzH�+u H�CH��P0H�Kj(H�5��1�H�8����H��H��[]A\A]�@H�=1�-���H��H����H9��x���H�j(H�5��1�H�8����DH��� ��I��H=����o���H�+tx1�H�v<H�5��-H�����H��t.H�(u H�PH��R0E�,$H��H��H��[]A\A]�f�������f�H�ii(H�5�1�H�8�������H�CH��P0�y���@AUA��ATI��U��SH��dH�%(H��$�1�H��H�nH�{H�$���A���%�@H�=I�/��$�t��$�L��H�މ��8��H��$�dH3%(uH�Ĩ[]A\A]����f���AUHc�ATUSH�@H��H��H��/���uH��[]A\A]�����1��I��D�(���S��uOH��t�{H���o��C��t�H�s 1҉����E�,$��� ��E�,$�s��1�����E�,$H��[]A\A]ÐH����{H�����C���i���멐H��H�=��/���H�=��/����H�=��/���H�=l�/��r��H�=�/H��tH�/H��/t%H�=.�/H��t����H��/H���@H�G�P0�����H���c���H�j(H�H������ F�-����AWL�=��-AVL��AUATUS1�H��98t��H���u���D�%�-���1҉�D�0I��H��H�CH��I�tI��,��A�G�D��H�5a��p��I�_H���T��H��D��Hc��V��H�5��D���B�������-��u;H��tH��D�����E�uH����[]A\A]A^A_�:��f.���H�5Y�-H��D�����@��H�=��/ATI��UH��SH��t H��Յ�u?H�^�/1�H��u�=DH��H���0t(H�9�/H�|H��t�L��Յ�t�[]A\�f�H�=��-H��t[L��H��]A\���[1�]A\�f�H� �-H��H��p98t"H�H9�u�����?w2H���DH�1e(��H�5�H�81��.�1�H����H�ie(H�5�)H�8���1�H���SH��1҉��H�s �I��H�{H��tH�CH�/t�C�����[�@H�G�P0�C�����[�ff.���H��H��H�5O�dH�%(H�D$1�H�T$�D���t`�|$�����tSH�=ģ/H��tOHcD$H�@H��H��H�1����tH���4���Hc�����H�L$dH3%(u!H����1���@H�f(H�������fD�����-��uH��e(H��fDH���w���H�`g(H�H����H��H��c(H�5��H�8�6��1�H���ff.�@��UH��H� !�-H��SH�4�H���dH�%(H��$�1�H�D$H�D$�D$�D$PH�D$P1�L�L$(L�D$�v��ZY�����|$�����������H��H���zH�|$H�t$����H�D$H����H� .�/H���mHcD$H�@H��H��Hˋ����H�{H��tH�/tyH�D$H�H�C�D$�C�D$�C�D$�CH�E�H���H�'e(H���H�)d(H�8�Q��1�H��$�dH3%(�H���[]�DH�G�P0�{���@�t$H�T$ �����u�foD$ foL$0foT$@fo\$Pfod$`fol$pC fo�$�K0fo�$�fo�$�H��$�S@[Pc`kp������H�������fD���H��H�������p���f.���0��H���/H��t��01�H������H���f����k�����������AWH��H� 0�-H��AVH�ѡAUATUSH��dH�%(H��$�1�I��L�D$H�D$�$�����H�|$H�t$���H�D$H����]��H��H���1H�=��-H��t H�/��D$H�T$�|�-�$H��s�-H�CH�\�-H�e�-�G�-��u~�9�-H���-H�l$L��pL�5���L�-X�/L�eL��L�t$�g��I�}DŽ$�@tDŽ$�H�{�H��H���,���u(�C�H�ðI9�u�H�~b(H���H��_(H�8���1�H��$�dH3%(u=H�ĸ[]A\A]A^A_�f�H�G�P0���@���H��H��t�����)��f���H��(H��H� n�-H��dH�%(H�D$1�L�L$L�D$H�D$H�ٟ�D$�D���tpH�|$H�t$��H�D$H��tW���H��tm�T$�|$��uH������H�ra(H��.@H�pH���|�H��t�H��H�m^(H�8���D1�H�L$dH3%(uH��(�f����H��t���/��ff.�@��AUH��H� ��-H��ATH��USH��dH�%(H��$�1�H�D$�D$H�D$ �D$PH�D$(P1�L�L$L�D$(�"��Y^���.����YD$f/�����H,�H�����Y��H��H���mH�|$ H�t$��H�D$ H�����D$H�|$(����L$(f/ 2����H,��Y�f/����H,�I���������H��L�d$0I��I��H��H��H��H��H��H)�H��o^M<+ H��I)�H��H��H��H��I��H��I��I��L��H��L)�H��H)�I��H���gH��H��L��1�V�d����XZL���b��I��H����H�����I���v�H�=ϛ/H��t H�/�0H�D$ H�=��/�H���/L�%ћ/H�H���/�D$L�-Û/���/�D$���/H�EH���/�D$���/���1�H�=����H����H��^(H�H��$�dH3%(�WH�Ĩ[]A\A]�f�H��](H�5CH�8�*��1��fD�\h��H,�H��?�M���f��\ H��H,�H��?����f�H�O��dL��1��j�����DH�G�P0����@�[���H��H�������1��*����H�9[(H�5�H�8�z��1�����������fDH�=q�/����H�=�/H��tH�/H� �/uH�G�P0L�����H�qZ(H�5��H��/H�8���1�����K��ff.���USH��dH�%(H��$�1�H��H���E��H��1ҿ�v��H����pD��H�����H�[(��H��H�(脽�Hc��/H�5v�/�=H�/���H�5T�/�=6�/H����H�/��ubH��u4�)�/��t*H�5�/H�=?�/1������w���H�=(�/���H�=$�/�w��H��$�dH3%(uH�Ę[]ÿ�P���+��ff.�����H�=�-����ff.���AT� US�Q�/H�N�/ ��H�2�/H��t1�H�=$�/����_H�,�/�W��H�`�/�K��H�=T�/H�U�/H���\H���S��A��H��Y(������+��H��H���H�=��S��H��H����H��H�����H�+A����E��~VH�=����H��H����H��H��*1�H�5_�-���H�+H��taH����H�EE1�H�P�H�UH��tTD��[]A\�@H�=��,��H���C����8�:����{���DH�CH��P0�b����H�CH��P0�@H�EH��P0D��[]A\�fDH�=��/蜽�H���/���@A������i���DH�!W(H�5 �A�����H�8����C������H�=��/St(��H�=��/���H�=��/�T�H���/H�=��/H��t�8�H�u�/H��/H��tE1��H�<[H��HNj��t����H��/H��H��Au�H��跼�H�ԕ/��H�=��/H��t薼�H���/[�f���H�����H�V�O1�;JuX��~H�r9wuLH�rH9wuB�A�H�@H�4���f��L9LuH�H��H;L�uH9�u��@1��D��H�H�/uH��H�G�P01�H���1��ff.�f���H��H�wH�=�/���/1�H�����H�H�/uH��H�G�P01�H���1��ff.�f���SH�=�/���H�=�/H�����H�=I�/�H�����H�=ݔ/��H�=)�/H����H��� ��H�=�j[H��1��'�����Hc=��-�0��H��H�=�/��k��H�=|�/�_��H�=Ȕ/H���/H�z�/���H�=V�/1�H�5������H�=A�/���H�=E�/1�H�5�����w��H�=0�/H������H��(H��H�=��/�dH�%(H�D$1�H���E���tH�$H)��/H�D$dH3%(uH��(�����ff.����H��t7SH��H��H�?�PH�=�/��i��H���q���H�=ʓ/[���@�ff.�@�G��xhHcЉ�AVH�@AUL��XBA�CBATL�d�U�xV4SH�_H�;H���L��HcS�H1�H1�I��M�I��L9�u�[H���|]A\A]A^�f��s�5�f.�AVAUI��ATI��USH��dH�%(H�D$1�H��tH��H��L�������Ic|$�$��H�$H����A�D$1�.��H�YU(H�H�C H�$��J�\�A9l$~^�����H��H����Lc�K�vI��H�BH��t$HczH�H�C��x����H��tbH�C �@H��T(H�B��M��t{H��L��L������xjH�$H�H�L$dH3%(ulH��[]A\A]A^��H�+u H�CH��P0H�<$H�/t1��f.�H�G�P01��DH�$�H�<$H�/uH�G�P0�Ŀ�1���[��ff.���Hc=9�-�����H�vH��t#H��tH���������H������1�H9����������-��tbU�SH��H�= �/��H��/H�= �/H�-ΐ/����H�����H��H�����H��H��H�=!>H��[1�]����@1�1�H�=J�1�����ff.�H�5T(�=C�/���ff.���S1�H�� dH�%(H�D$1�H�$H�D$���H�D$H��tJ�5�-��u{H�L$dH3%(�H�� [Ð�K��H�|$H��tH�D$H�/uH�G�P0H�|$H��t1�H�5X�������H�|$����H�<$H��t���H�D$�@H�I�-E1�E1�1�PH� 9T(�jH��Q(�6��H�D$ZYH���f���H�=��/����H�=&�/詬�H�=r�/H�$�I��H�<$�.������H�<$H�5�H���F��=�/1����7�������H�|$H��� ����3��������H�����-�M���H�56�/1��/��H�5�/����H�57�/�� ������H�5y�/H�=��/��/H�a�/H���@���J�-��uH�+Q(H��fDH���g���H�Q(H�H������� �-��uH��P(H��fDH������B����=̍/1��%��H��P(H�H���D��SH�� dH�%(H�D$1����-��tPH�VH�F�H��H�=ۍ/����@HE��V��H�=g�/H��H���?��H�=��/������u%H�6P(H�H�L$dH3%(uH�� [�@H�|$1��<������%��D��AUATI���UH��SH��L�n�~��H��tyI�|$H�����H��tWH�CI�|$ L�����H��tAH�C H�}H������H�+��tH����[��]A\A]�f�H�SH��R0��@H�+u H�CH��P0H���[]A\A]ËZ�-S����1ۃ��KH�5Ό/1��w������É�/�����H�=i�/�#H���-E1�E1�1�SH�lO(1�H� ���j����E1�E1�1�H��/X1�H� ���ZSH�����j���Y^SjH� �P(E1�E1�H�"N(1��H���/�w��H�=��/_H��/AX��H�=w�/��H����H�=e(�|��H���/H����H�=��/1��~��H��/H�=`�/�^�/�`�/H�Q�/���H�9�/������-��[�fD���H�4�/H������H��J(H�5���H�8�����+������뺻�����H��J(H�5������H�8�R���H��L(H�8豱��ff.�@AUATUS��H��8dH�%(H�D$(1�������+�-E�-����;�-��H�=��/L�%��/Hc�H�[H�4����/H��/H����H�H�5�/H��1�H�D$L�-.���H�GH�D$H�4$L�l$���H��1��J��H�SL��H�D$H�oH�D$L�l$L�$$����H����H�5(�/�H�4$���H�����=G�/1��O�-���H�T$(dH3%(��u+H��8[]A\A]�f�1��ֽ������耷����������@��H��H��H�5;�dH�%(H�D$1�H��H�$����tWH�<$H�G�H=��� w*�E�����x>H��K(H�H�L$dH3%(u'H��ÐH��H(���� H�5��H�81����1����z��f.�AWAVAUATI��UH��SH��(H�M�/dH�%(H�D$1��C�y��H����L�h�CM��u0�W��C��-���C9���M�mM���,H�L��H�@L�<�H��/I�G����H�A�GI�E H��t�L�p`M��t�I�F���t�A�~ y�H�=��/L���D��H����L�pM�w�f���fD�SDL�-��/��ueH��L��H�,$H�=7�/L�l$�E���uH-J�/H;-;�/H�-<�/vH�-+�/H�L$dH3%(��H��([]A\A]A^A_�H����H�=�/H��H�薤�H��taL�hM���o��������Q����I�H�=��/1�1�L��詯������I�.����I�FL���P0�p�����CH�=��/��H�H�@L�4�L����/I��H��t9L��H��H���f��H�=/�/1�1�L���3�������L��H�=��/���/�����������ff.��AUI��ATI��UH��SH��H�?A�T$H��H��t5H�=�/�H��t<藶�H����H��L���D���H�=�/����H��H��[]A\A]�f.��[��H��L������H�=��/��x���H��H��[]A\A]�f��{��H��I�<$1�A�T$�ff.���ATI��UH��SH���= �/账�H��tOH�;L��H��SH��H��t*H��t%H�=?�/��ŵ�H�����H�=&�/���H��[]A\�f��[�L��H��H������=��/1�H������H��[]A\�D��AUATI��UH��SH��H���=c�/���H��tQH�;L��H��SH��H��t*H��t%H�=��/����H���'�H�=��/�[��H��H��[]A\A]�D��讼�L��H��H��A��� ���D��H���b��=܃/1��5��H��H��[]A\A]��ATI��UH��SH�?�UH��H��t,H�=�/�致�H��L���<���H�=�/��x���H��[]A\�@���H��1�H�}�UH��[]A\����UH��SH��H���=:�/���H��tH�CH�;H��H��[]��fD���H��H���H����=�/1�H���X��H��H��[]�ff.���ATUH��SH���=̂/�w��H��tH�CH��H�;[]A\��f��[��V��H��H��A������D��H��� ��=��/1�����H��[]A\����S��H�=�-�:��H��tH�������x H��[�@1�H��[�f���ATUSH��dH�%(H�D$1�H��C(���uH�=f�蛟�H��H��t �8�J����H��H����H�=�����H��H����H��H���&��H�+H����H����H;-iE(��H���+��H���/� H���U��H��H���H�����H�+I��u H�CH��P0I�����H�UI�L$�H�B�H����� ��D��H�EH��u H�EH��P0E���������H�L$dH3%(��H��[]A\��H�CH��P0H���-����X��H���������H�m�u�H�EH��P0�H�$臢� H��H���H���.��H�$�:ugH�P�H����� wZ�}"tT���P�������H�UH�������H�UuH�EH��P0fDH�=���d������������� ���H�=W��B��������������=��-t�f�H�����-���-��t��H�=�/���H�=�/����H�=�/����H�=�/H��t�.��H��/�=}/���H�=�/H��tH�/tH��ÐH�GH�@0H����f�AVAUATUSH�WH���f��H*�� Jo�X��^�f/����H,��H��v��H�H9�w�L�/I9���I��L�4�H�_L��A�T$HI�D$H����H��L��1�蒹�I�,$I��J�<�L�E�M��t>fDI�H��t'M�L$H�PH�L!�I��H�2H�0H�H��H��u�I��L9�u�I�D$PH��[]A\A]A^��fD�\��H,�H��?�&���I�\$[]A\A]A^��H�Ѓ�f�H��H ��H*��X�����f�AWE1�AVI��H��AUATUH��SH��H�$H�L$A�V I��I�L�`�I�FM!�J��H��u!��f.�H�I��H����H��L9ku�H��H��A�V(��t�H�M����I�H�<$I�nH��tH�T$H�s���H��A�VPI�FH��xof��H*�I�H��xf���H*��^�� 1��Z�f/�v$L������H���[]A\A]A^A_�fD1�H��[]A\A]A^A_��H��f�H��H �I��H*��X�H��y�H��f��H��H ��H*��X��l����I�VJ��������H������������1�H9~���f���AWI��AVI��AUATUH��SH��(H�D$hL�D$L�L$H����H�L�`H�t$�X��I��H����H�t$H�����f.�H�H9�w�H��H��H�T$I�EI�EI�m��H�T$H��I�Etx1�H��莶�H�D$M�} M�u(I�E0H�D$I�]HI�E8H�D$`M�ePI�E@H��(L��[]A\A]A^A_ÐL�%A>(H��:(�7���D����i���f�L��E1�A���D��H��H��E1�H��jE1��j��H���f���AUATUSH��H�GH�H��H�GH�@H�l�XtDH��t?I��E1�I�D$J��H��tf.�H�{A�T$@H�H�H��u�I��M9,$w�H��H��[]A\A]�@��AUI��ATI��H��USH��A�T$ I�T$H��I�$H��H!�H��H��u�6fDH�H��t(H9ku�H��L��A�T$(��t�H��H��[]A\A]�DH��1�H��[]A\A]���AWI��AVI��AUATUSH��H��H��H�t$�S I��H�H��L!�I��H�CH�x�SHH����H�t$L�hL��H�xH��H�pL������H�CJ��H�H�UH�(H�CH��H�Cx?f��H*�H�H��xOf���H*�1��^�/}w_H��[]A\A]A^A_��H��f�H��H �H��H*��X�H��y�H��f��H��H �1��H*��X��^�/�|v�H�����H��1�[]A\A]A^A_ø�����ff.�@��UH��SH��H���{��H��1�H��tH��H��H�����H��[]�fD���w������1�1��c�����H�?t[AVE1�AUI��ATI��UH��SI�EJ��H��u �#H�H��tL��H��Յ�t�[]A\A]A^�I��M9uw�[1�]A\A]A^�1�����AVAUATUH��SH�?t\H�WE1�@N�4�J�2H�H��t,@H�E8L�#H��tH�{��H��L��UPM��u�H�UJ�2H�I��L9mw�H�E[H��]A\A]A^�������AUATUH��SH��H�}H�tBE1�J��H��t+�H�E8L�#H��tH�{��H��L��UPM��u�H�}I��L9mw�UPH�EPH��H��[]A\A]��ff.����AVAUATUH��SH��H�O(H�W dH�%(H�D$1�H�EHH�L�M8L�E0H�uP�u@舲�ZYI��H����H�}t~E1�I��H�EJ��H��u6�H�{��H�$H��tIH�MH�sL��L���f���u2H�H��tZH�E0H��u�H�MH�sH�SL���=���t�f�L��E1��E��H�T$dH3%(L��u"H��[]A\A]A^�DI��L9u�U��������f.����UH��H�5eySH��(H� :(dH�%(H�D$1�H��L�L$L�D$������H�T$�H�=�VH����������H�=�VH�������t~H�ֹH�=W������uoH�<$H�t$�A��H�|$H��H�/uH�G�P0H��twH�kH�{@H�E�U��H�����H�\$dH3%(H��u\H��([]���f�H�)5(H�52yH�8�j��H�|$H�/uH�G�P0�1��@��O���艨�f���SH�=|5(迴������H�=;�-���H��H�����H�5�H��趔�H�5�wH��袔�H�5�wH��莔�H�5�wH���z�� H�5�wH���f��@H�5�wH���R���H�5�wH���>���H�5�wH���*��1�H�5�wH�����H�5�wH�����H�5�wH�����H�5xwH���ݓ�H�5twH���ɓ�H�5 H��赓�H�5YwH��術�H�5UwH��荓�H�5�vH���y��H�5=wH���e��H�5.wH���Q��H�5$wH���=���(��H��tH�+u H�CH��P01�H��[�f.�f���H��8(SH����(��x�C(1�[ø����[�D��H�M6(SH����(��x�C(1�[ø����[�D��SH��H��H�5wH��dH�%(H�D$1�H�T$�����t,�D$�C(H��4(H�H�L$dH3%(uH��[�@1����ǥ����SH��H��H�5�vH��dH�%(H�D$1�H�T$�p���t,�D$�C(H�^4(H�H�L$dH3%(uH��[�@1����W�����SH��H�56vH�� dH�%(H�D$1�H�L$H�T$�D$�L�D$�����tU蘟�H���H�t$H�|$�A��H��t4H�(tF�l$y��j��f�H)��H*��^��衰�� �1�H�\$dH3%(uH�� [�H�PH��R0�菤�ff.�@��Hc(�����S1�H��H��H�5Vu�7���tHc{([�ɰ�f�1�[�ff.����S1�H��H��H�5u����tHc{([鉰�f�1�[�ff.����ATI��UH���SH���U��H��t$H��t;H��t&H�EH�hI�$L�` H�H�X([]A\��H�y2(���H�-i2(H��u���f���SH�l3(H�= �-H��-豯����H��5(H�=K�-H�D�-華������H�=�-���H��H��tnH�=�-�b���x^H�=��-�R���xNH���-H�5;tH��H��-����x,H�u�-H�5�sH��H�c�-�����yf.�1�H��[���H��H���:%s%s%s, %.20s, %.9s17:08:22Apr 17 2024no mem to build parser accelerators XXX too high nonterminal number!no mem to add parser accelerators XXX too many states!XXX ambiguity!NT%d%.32s(%.32s)invalid label%s s_push: parser stack overflow no mem for bitsetMSTARTRULERHS ALTITEMATOM8 Calculate FIRST set for '%s' Left-recursion for '%s' Left-recursion below '%s' FIRST set for '%s': { }Adding FIRST sets ...Re-calculating FIRST set for '%s' ??? no mem for new sym in calcfirstsetno mem to resize sym in calcfirstsetno mem for new grammarLabel @ %8p, %d: %s Label %d/'%s' not found grammar.c:findlabel()Translating label %s ... Label %s is non-terminal %d. Label %s is terminal %d. Label %s is a keyword Can't alloc dest '%s' Unknown OP label %s Can't translate label '%s' no mem to resize dfa in adddfano mem to resize state in addstateno mem to resize arc list in addarcno mem to resize labellist in addlabelCan't translate NAME label '%s' Can't translate STRING label %s out of memSubset DFA %s Subset %d (finish) { %d Arc to state %d, label %s no mem for new nfa grammarno mem for new nfaDump of NFA for '%s' ... Making DFA for '%s' ... %c%2d%c -> %2d %sbefore minimizingRename state %d to %d. after minimizingCompiling (meta-) parse tree into NFA grammarNFA '%s' has %d states; start %d, finish %d no mem for xx_state in makedfaError: nonterminal '%s' may produce empty. input line too longcan't re-enter readline/builddir/build/BUILD/Python-3.4.10/Parser/myreadline.c!=<><string>with Barry as BDFL, use '<>' instead of '!='isisOOOutf-8iso-8859-1utf-8-iso-latin-1iso-8859-1-iso-latin-1-encoding problem: %sencoding problem: %s with BOMENDMARKERNAMESTRINGNEWLINEINDENTDEDENTLPARRPARLSQBRSQBCOLONCOMMASEMIPLUSMINUSVBARAMPERLESSGREATERPERCENTLBRACERBRACEEQEQUALNOTEQUALLESSEQUALGREATEREQUALTILDECIRCUMFLEXLEFTSHIFTRIGHTSHIFTDOUBLESTARPLUSEQUALMINEQUALPERCENTEQUALAMPEREQUALVBAREQUALCIRCUMFLEXEQUALLEFTSHIFTEQUALRIGHTSHIFTEQUALDOUBLESTAREQUALDOUBLESLASHDOUBLESLASHEQUALRARROWELLIPSIS<ERRORTOKEN><N_TOKENS>Non-UTF-8 code starting with '\x%.2x' in file %U on line %i, but no encoding declared; see http://python.org/dev/peps/pep-0263/ for detailstok_backup: beginning of buffer%U: inconsistent use of tabs and spaces in indentation �-�/�/�/�-�.�/�/�/�(.�P.�/��.�/��.�/�/�/�/�/�/�/�/�/�/�/�/�h.�.�.�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�.�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/�/��-��-��-��-��-��-�.��-��-��-��-��-��-��-��-��-��-��-��-�.��-��-�!44444444444 4144444444444444444444444444 4 4444444444444444444444444444null argument to internal routineunsupported operand type(s) for %.100s: '%.100s' and '%.100s'unsupported operand type(s) for ** or pow(): '%.100s' and '%.100s'unsupported operand type(s) for pow(): '%.100s', '%.100s', '%.100s'/builddir/build/BUILD/Python-3.4.10/Objects/abstract.cissubclass() arg 1 must be a classissubclass() arg 2 must be a class or tuple of classesisinstance() arg 2 must be a type or tuple of types'%.100s' does not support the buffer interfaceexpected an object with a writable buffer interfaceboth destination and source must have the buffer interfacedestination is too small to receive data from sourcebad operand type for unary -: '%.200s'bad operand type for unary +: '%.200s'bad operand type for unary ~: '%.200s'bad operand type for abs(): '%.200s''%.200s' object cannot be interpreted as an integer__index__ returned non-int (type %.200s)__index__ returned non-int (type %.200s). The ability to return an instance of a strict subclass of int is deprecated, and may be removed in a future version of Python.cannot fit '%.200s' into an index-sized integercan't multiply sequence by non-int of type '%.200s'__trunc__ returned non-Integral (type %.200s)int() argument must be a string, a bytes-like object or a number, not '%.200s'__float__ returned non-float (type %.200s)PyNumber_ToBase: index not intobject of type '%.200s' has no len()'%.200s' object can't be concatenated'%.200s' object can't be repeated'%.200s' object does not support indexingsequence index must be integer, not '%.200s''%.200s' object is not subscriptable'%.200s' object is unsliceable'%.200s' object does not support item assignment'%.200s' object doesn't support item deletion'%.200s' object does not support item deletion'%.200s' object doesn't support slice assignment'%.200s' object doesn't support slice deletion while calling a Python objectNULL result without error in PyObject_Call'%.200s' object is not callableattribute of type '%.200s' is not callable__length_hint__ must be an integer, not %.100s__length_hint__() should return >= 0Type %.100s doesn't define __format____format__ method did not return string'%.200s' object is not iterableiter() returned non-iterator of type '%.100s'argument of type '%.200s' is not iterablesequence.index(x): x not in sequenceObject is not writable.|^<<>>//%|=^=&=<<=>>=-=//=+=%=*= in __instancecheck__ in __subclasscheck__o.keys() are not iterableo.items() are not iterableo.values() are not iterablecount exceeds C integer sizeindex exceeds C integer size__bases____class____trunc____length_hint__TrueFalse|O:booly*y*:maketransmaketrans arguments must have same lengthB.maketrans(frm, to) -> translation table
Return a translation table (a bytes object of length 256) suitable for use in the bytes or bytearray translate method where each byte in frm is mapped to the byte at the same position in to. The bytes objects frm and to must be of the same length.B.swapcase() -> copy of B
Return a copy of B with uppercase ASCII characters converted to lowercase ASCII and vice versa.B.capitalize() -> copy of B
Return a copy of B with only its first character capitalized (ASCII) and the rest lower-cased.B.title() -> copy of B
Return a titlecased version of B, i.e. ASCII words start with uppercase characters, all remaining cased characters have lowercase.B.upper() -> copy of B
Return a copy of B with all ASCII characters converted to uppercase.B.lower() -> copy of B
Return a copy of B with all ASCII characters converted to lowercase.B.istitle() -> bool
Return True if B is a titlecased string and there is at least one character in B, i.e. uppercase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.B.isupper() -> bool
Return True if all cased characters in B are uppercase and there is at least one cased character in B, False otherwise.B.islower() -> bool
Return True if all cased characters in B are lowercase and there is at least one cased character in B, False otherwise.B.isdigit() -> bool
Return True if all characters in B are digits and there is at least one character in B, False otherwise.B.isalnum() -> bool
Return True if all characters in B are alphanumeric and there is at least one character in B, False otherwise.B.isalpha() -> bool
Return True if all characters in B are alphabetic and there is at least one character in B, False otherwise.B.isspace() -> bool
Return True if all characters in B are whitespace and there is at least one character in B, False otherwise.(O(Ns)N)(O(y#)N)(O()N)|i:__reduce_ex__GC object already trackedbytearray(bstr() on a bytearray instancean integer is requiredbyte must be in range(0, 256)bytearray index out of rangeN(O)nN(N)subsection not foundcan't concat %.100s to %.100sn:zfill
|O:strip|i:splitlines|O:rstripempty separatory*y*|n:replacereplace string is too longreplace bytes is too long|O:lstripcan only join an iterablejoin() result is too long|i:expandtabsresult too long|On:rsplit|On:splitn|c:rjustn|c:ljustn|c:center|Oss:bytearraynegative counttranslatevalue not found in bytearray|n:poppop from empty bytearraypop index out of rangenO:insertU:fromhextabsizemaxsplitkeependsbytearray_iterator__setstate____alloc____sizeof__appendcapitalizecopyendswithextendisalnumisalphaisdigitislowerisspaceistitleisupperjoinremovereverserfindrindexrpartitionstartswithswapcase/builddir/build/BUILD/Python-3.4.10/Objects/bytearrayobject.cbytearray object is too large to make reprdeallocated bytearray object has exported buffersExisting exports of data: object cannot be re-sizedComparison between bytearray and stringstartswith first arg must be bytes or a tuple of bytes, not %sendswith first arg must be bytes or a tuple of bytes, not %sNegative size passed to PyByteArray_FromStringAndSizesequence item %zd: expected a bytes-like object, %.80s foundsequence changed size during iterationbytearray indices must be integersencoding or errors without sequence argumentstring argument without an encodingencoding or errors without a string argumenttranslation table must be 256 characters longcannot add more objects to bytearraynon-hexadecimal number found in fromhex() arg at position %zdcan't set bytearray slice from %.100sbytearray indices must be integercan assign only bytes, buffers, or iterables of ints in range(0, 256)attempt to assign bytes of size %zd to extended slice of size %zd�������|��\����X������X��X����startswithfind/rfind/index�?repeated bytes are too long(y#)substring not foundbyte string is too largebyte string is too longexpected bytes, %.200s foundexpected bytes with no nullstr() on a bytes instance%ld%lu%zu%u%iTrailing \ in stringstrictignore|Oss:bytes__bytes__bytes_iterator__getnewargs__Comparison between bytes and string/builddir/build/BUILD/Python-3.4.10/Objects/bytesobject.cNegative size passed to PyBytes_FromStringAndSizereplacement bytes are too longbyte indices must be integers, not %.200sbytes object is too large to make reprPyBytes_FromFormatV(): %c format expects an integer in range [0; 255]invalid \x escape at position %ddecoding error; unknown error handling code: %.400scannot convert unicode object to bytesbytes must be in range(0, 256)__bytes__ returned non-bytes (type %.200s),������������������������������������������������d����������|������������������<��<��<��<��<��<��<��<��������������������������������������������������������������������������l����������|��������������������������������������̋���܋�����Cell is empty<cell at %p: empty>cell_contents������Ȝ�����<cell at %p: %.80s object at %p>/builddir/build/BUILD/Python-3.4.10/Objects/cellobject.c__doc__O(ON)<bound method %V.%V of %R>self must not be Nonefree PyMethodObjectinstancemethod<instancemethod %V at %p>getattr__func____self____name__/builddir/build/BUILD/Python-3.4.10/Objects/classobject.cfirst argument must be callablethe function (or other callable) implementing a methodthe instance to which a method is boundnon-string found in code slotiiiiiSO!O!O!UUiS|O!O!:codeco_argcountco_kwonlyargcountco_nlocalsco_stacksizeco_flagsco_codeco_constsco_namesco_varnamesco_freevarsco_cellvarsco_nameco_firstlinenoco_lnotabname tuples must contain only strings, not '%.500s'<code object %U at %p, file "%U", line %d><code object %U at %p, file ???, line %d>0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ_abcdefghijklmnopqrstuvwxyz/builddir/build/BUILD/Python-3.4.10/Objects/codeobject.ccode: argcount must not be negativecode: kwonlyargcount must not be negativecode: nlocals must not be negative__complex__ should return a complex objectcan't take floor of complex number.can't convert complex to floatcan't take floor or mod of complex number.complex() can't take second arg if first is a stringcomplex() arg is a malformed stringcomplex() second arg can't be a stringcomplex() argument must be a string or a number, not '%.200s'float(r) didn't return a float0.0 to a negative or complex powerthe real part of a complex numberthe imaginary part of a complex numbercan't convert complex to intcan't mod complex numbers.|OO:complexU:__format__(dd)(%s%s%sj%sabsolute value too largecomplex division by zerocomplex modulocomplex exponentiationrealimag__complex__conjugate�?�?�����������������?��������mappingproxy(%R)O(OO)|OOOO:propertyOOOO%S.%S<method '%V' of '%s' objects><member '%V' of '%s' objects>O:mappingproxycan't delete attributecan't set attributeunreadable attributefgetfdeldoc__qualname____isabstractmethod__setterdeletermethod-wrapper__objclass____text_signature__D.keys() -> list of D's keyswrapper_descriptorgetset_descriptormember_descriptorclassmethod_descriptordescriptor '%V' for type '%s' needs either an object or a typedescriptor '%V' for type '%s' needs a type, not a '%s' as arg 2descriptor '%V' for type '%s' doesn't apply to type '%s'<method-wrapper '%s' of %s object at %p>descriptor '%V' of '%.100s' object needs an argumentdescriptor '%V' requires a '%.100s' object but received a '%.100s'descriptor '%V' requires a type but received a '%.100s'descriptor '%V' requires a subtype of '%.100s' but received '%.100swrapper %s doesn't take keyword argumentsdescriptor '%V' for '%s' objects doesn't apply to '%s' objectdescriptor '%V' for '%.100s' objects doesn't apply to '%.100s' objectattribute '%V' of '%.100s' objects is not writableattribute '%V' of '%.100s' objects is not readable<descriptor>.__name__ is not a unicode object<descriptor>.__objclass__.__qualname__ is not a unicode object<attribute '%V' of '%s' objects><slot wrapper '%V' of '%s' objects>mappingproxy() argument must be a mapping, not %s/builddir/build/BUILD/Python-3.4.10/Objects/descrobject.cD.get(k[,d]) -> D[k] if k in D, else d. d defaults to None.D.values() -> list of D's valuesD.items() -> list of D's (key, value) pairs, as 2-tuplesD.copy() -> a shallow copy of D���P��X��p��h����O|O:enumeratereversedreversed()O(On)O(O)nO(())__reversed__argument to reversed() must be a sequence%s%R%S (%U, line %ld)%S (%U)%S (line %ld)O!O!nnO!O!OnnO!args may not be deletedstate is not a dictionary[Errno %S] %S: %R -> %R[Errno %S] %S: %R[Errno %S] %SOSErrorcharacters_writtenprint exec tuple index out of range%.200s attribute not set__cause__ may not be deletedsu#nnssy#nnsBaseExceptionTypeErrorStopIterationGeneratorExitSystemExitKeyboardInterruptEnvironmentErrorEOFErrorRuntimeErrorNotImplementedErrorNameErrorUnboundLocalErrorAttributeErrorSyntaxErrorIndentationErrorTabErrorIndexErrorKeyErrorValueErrorUnicodeErrorUnicodeEncodeErrorUnicodeDecodeErrorUnicodeTranslateErrorAssertionErrorArithmeticErrorFloatingPointErrorOverflowErrorZeroDivisionErrorSystemErrorReferenceErrorBufferErrorMemoryErrorUserWarningPendingDeprecationWarningSyntaxWarningRuntimeWarningFutureWarningImportWarningUnicodeWarningBytesWarningResourceWarningConnectionErrorBlockingIOErrorerrmap insertion problem.BrokenPipeErrorChildProcessErrorConnectionAbortedErrorConnectionRefusedErrorConnectionResetErrorFileExistsErrorFileNotFoundErrorIsADirectoryErrorNotADirectoryErrorInterruptedErrorPermissionErrorProcessLookupErrorTimeoutError%U (%s: %S)Buffer error.Out of memory.Assertion failed.Unicode translation error.Unicode decoding error.Unicode encoding error.exception encodingexception objectexception startexception endexception reasonUnicode related error.Mapping key not found.Sequence index out of range.Base class for lookup errors.Improper indentation.Invalid syntax.exception msgexception linenoexception offsetexception textexception print_file_and_lineAttribute not found.Name not found globally.Unspecified run-time error.Read beyond end of file.Timeout expired.Process not found.Not enough permissions.Interrupted by signal.File not found.File already exists.Connection reset.Connection refused.Connection aborted.Broken pipe.Child process error.Connection error.I/O operation would block.POSIX exception codeexception strerrorfilename2second exception filenameexception messagemodule pathProgram interrupted by user.generator return valueInappropriate argument type.__suppress_context____traceback____context__exception context__cause__exception causewith_traceback'%U' codec can't decode byte 0x%02x in position %zd: %U'%U' codec can't decode bytes in position %zd-%zd: %U'%U' codec can't encode character '\x%02x' in position %zd: %U'%U' codec can't encode character '\u%04x' in position %zd: %U'%U' codec can't encode character '\U%08x' in position %zd: %U'%U' codec can't encode characters in position %zd-%zd: %Ucan't translate character '\x%02x' in position %zd: %Ucan't translate character '\u%04x' in position %zd: %Ucan't translate character '\U%08x' in position %zd: %Ucan't translate characters in position %zd-%zd: %U__traceback__ may not be deleted__traceback__ must be a traceback or NoneMissing parentheses in call to 'print'Missing parentheses in call to 'exec'%.200s attribute must be bytes%.200s attribute must be unicodeexception cause must be None or derive from BaseException__context__ may not be deletedexception context must be None or derive from BaseExceptionexceptions bootstrapping error.Module dictionary insertion problem.Cannot allocate map from errnos to OSError subclassesCould not preallocate MemoryError objectCannot pre-allocate RuntimeError instance for recursion errorsmaximum recursion depth exceededcannot allocate argument for RuntimeError pre-allocationcannot allocate tuple for RuntimeError pre-allocationinit of pre-allocated RuntimeError failedBase class for warnings about resource usage.Base class for warnings about bytes and buffer related problems, mostly related to conversion from str or comparing to str.Base class for warnings about Unicode related problems, mostly related to conversion problems.Base class for warnings about probable mistakes in module importsBase class for warnings about constructs that will change semantically in the future.Base class for warnings about dubious runtime behavior.Base class for warnings about dubious syntax.Base class for warnings about features which will be deprecated in the future.Base class for warnings about deprecated features.Base class for warnings generated by user code.Base class for warning categories.Weak ref proxy used after referent went away.Internal error in the Python interpreter.
Please report this to the Python maintainer, along with the traceback, the Python version, and the hardware/OS platform and version.Second argument to a division or modulo operation was zero.Result too large to be represented.Floating point operation failed.Base class for arithmetic errors.Inappropriate argument value (of correct type).Improper mixture of spaces and tabs.Local name referenced but not bound to a value.Method or function hasn't been implemented yet.Operation only works on directories.Operation doesn't work on directories.Base class for I/O related errors.Import can't find module, or can't find name in module.Request to exit from the interpreter.Request that a generator exit.Signal the end from iterator.__next__().Common base class for all non-exit exceptions.Common base class for all exceptions<generator object %S at %p>generator already executingthrowgeneratorsendgi_framegi_runninggi_code/builddir/build/BUILD/Python-3.4.10/Objects/genobject.ccan't send non-None value to a just-started generatorgenerator ignored GeneratorExitthrow() third argument must be a traceback objectinstance exception may not have a separate valueexceptions must be classes or instances deriving from BaseException, not %scannot create 'stderrprinter' instances<stdprinter(fd=%d) object at 0x%x>/builddir/build/BUILD/Python-3.4.10/Objects/fileobject.cobject.readline() returned non-stringnull file for PyFile_WriteStringfileno() returned a non-integerargument must be an int, or have a fileno() method.file descriptor cannot be a negative integer (%i)backslashreplaceisisssi(i)EOF when reading a linewriteobject with NULL filefilenostderrprinterTrue if the file is closedEncoding of the fileString giving the file modeflushss:__setformat__doubleunknownIEEE, little-endianIEEE, big-endian(d)float divmod()-0x0.0p+0-0x%sp%c%dfloat division by zerofloat modulo|O:floata float is required%s0%se%dfree PyFloatObjectfrexp() result out of range__round__as_integer_ratiois_integer__getformat__sys.float_infomax_expmax_10_expmin_expmin_10_expDBL_DIG -- digitsmant_digepsilonradixFLT_ROUNDS -- addition rounds__setformat__() argument 1 must be 'double' or 'float'__setformat__() argument 2 must be 'unknown', 'IEEE, little-endian' or 'IEEE, big-endian'can only set %s format to 'unknown' or the detected platform value__getformat__() argument must be string, not %.500s__getformat__() argument 1 must be 'double' or 'float'insane float_format or double_formathexadecimal string too long to converthexadecimal value too large to represent as a floatinvalid hexadecimal floating-point stringCannot pass infinity to float.as_integer_ratio.Cannot pass NaN to float.as_integer_ratio.pow() 3rd argument not allowed unless all arguments are integers0.0 cannot be raised to a negative powerfloat() argument must be a string or a number, not '%.200s'could not convert string to float: %Rnb_float should return float objectrounded value too large to representfloat too large to pack with f formatfloat too large to pack with d formatcan't unpack IEEE 754 special value on non-IEEE platformReturn self, the complex conjugate of any float.Return the Integral closest to x between 0 and x.Return the Integral closest to x, rounding half toward even. When an argument is passed, work like built-in round(x, ndigits).Return True if the float is an integer.DBL_MAX -- maximum representable finite floatDBL_MAX_EXP -- maximum int e such that radix**(e-1) is representableDBL_MAX_10_EXP -- maximum int e such that 10**e is representableDBL_MIN -- Minimum positive normalizer floatDBL_MIN_EXP -- minimum int e such that radix**(e-1) is a normalized floatDBL_MIN_10_EXP -- minimum int e such that 10**e is a normalizedDBL_MANT_DIG -- mantissa digitsDBL_EPSILON -- Difference between 1 and the next representable floatFLT_RADIX -- radix of exponent@\�[�x\�P\�h\�0\� �������
��������������������������
0@@0C�?�<�����C�?C`A�ApA�>p>0>�����lineno must be an integerlineno out of rangeXXX block stack overflowXXX block stack underflowfree PyFrameObject__builtins__f_localsf_linenof_tracef_backf_codef_builtinsf_globalsf_lastif_lineno can only be set by a line trace functionline %d comes before the current code blockline %d comes after the current code blockcan't jump to 'except' line as there's no exceptioncan't jump into or out of a 'finally' blockcan't jump into the middle of a blockcannot clear an executing frame/builddir/build/BUILD/Python-3.4.10/Objects/frameobject.cco_varnames must be a tuple, not %s__code__ must be set to a code object%U() requires a code object with %zd free vars, not %zd__qualname__ must be set to a string object__name__ must be set to a string object__annotations__ must be set to a dict object__kwdefaults__ must be set to a dict object__defaults__ must be set to a tuple objectuninitialized staticmethod objectuninitialized classmethod objectarg 3 (name) must be None or stringarg 4 (defaults) must be None or tuplearg 5 (closure) must be None or tuple%U requires closure of length %zd, not %zdarg 5 (closure) expected cell, found %s/builddir/build/BUILD/Python-3.4.10/Objects/funcobject.cnon-dict keyword only default argsexpected tuple for closure, got '%.100s'<function %U at %p>classmethodstaticmethodO!O!|OOO:functionarg 5 (closure) must be tuplenon-tuple default argsnon-dict annotationsargdefsclosure__code____defaults____kwdefaults____annotations____closure____globals____module__iter index too largeN(())N(OO)callable_iterator/builddir/build/BUILD/Python-3.4.10/Objects/iterobject.c/builddir/build/BUILD/Python-3.4.10/Objects/listobject.ccannot add more objects to list while getting the repr of a listmust use keyword argument for key functionlist assignment index out of rangemust assign iterable to extended sliceattempt to assign sequence of size %zd to extended slice of size %zdlist indices must be integers, not %.200scan only concatenate list (not "%.200s") to listO|O&O&:index%R is not in listlist index out of rangeargument must be iterable|O:list[...], |Oi:sortlist modified during sortfree PyListObjectcan only assign an iterablelist.remove(x): x not in listpop from empty listlist_reverseiteratorlist_iterator__getitem__z��o��d��Y�� ����/builddir/build/BUILD/Python-3.4.10/Objects/longobject.can integer is required (got type %.200s)__int__ returned non-int (type %.200s)__int__ returned non-int (type %.200s). The ability to return an instance of a strict subclass of int is deprecated, and may be removed in a future version of Python.intermediate overflow during divisioninteger division result too large for a floatinteger division or modulo by zerocannot convert float infinity to integercannot convert float NaN to integerPython int too large to convert to C longPython int too large to convert to C intPython int too large to convert to C ssize_tcan't convert negative value to unsigned intPython int too large to convert to C unsigned longcan't convert negative value to size_tPython int too large to convert to C size_tint has too many bits to express in a platform size_tbyte array too long to convert to int'signed' is a keyword-only argumentbyteorder must be either 'little' or 'big'can't convert negative int to unsignedlength argument must be non-negativepow() 2nd argument cannot be negative when 3rd argument specifiedpow() 3rd argument cannot be 0int() arg 2 must be >= 2 and <= 36int string too large to convertinvalid literal for int() with base %d: %.200Rint() base must be >= 2 and <= 36int() can't convert non-string with explicit basehuge integer: number of bits overflows a Py_ssize_tint too large to convert to floatnon-integer arguments in divisionsize in bytes of the C type used to represent a digitthe numerator of a rational number in lowest termsthe denominator of a rational number in lowest termsReturns self, the complex conjugate of any int.Truncating an Integral returns itself.Flooring an Integral returns itself.Ceiling of an Integral returns itself.Rounding an Integral returns itself. Rounding with an ndigits argument also returns an integer.Returns size in memory, in bytesint too large to formattoo many digits in integernegative shift countOU|O:from_byteslittleint too big to convertnU|O:to_bytes|OO:intint() missing string argumentbyteordersignedbasesys.int_infobits_per_digitsize of a digit in bitssizeof_digitnumeratordenominatorbit_length__floor____ceil__��������p����`������`��`������������������A�%���X�?P� �^�4@�<deallocating <dummy key>%s(%R)free PyDictObject{...}fromkeysdict mutated during updatesetdefaultThis object has no __dict__intersection_updatesymmetric_difference_update__missing__<dummy key> typedict_valuesdict_itemsisdisjointdict_keysdict_itemiteratordict_valueiteratordict_keyiterator__contains__popitem/builddir/build/BUILD/Python-3.4.10/Objects/dictobject.c%s() requires a dict argument, not '%s'dictionary changed size during iterationpopitem(): dictionary is emptycannot convert dictionary update sequence element #%zd to a sequencedictionary update sequence element #%zd has length %zd; 2 is requiredNot enough memory to allocate new values arrayX��������H��ؓ�index out of bounds<released memory at %p><memory at %p>cannot delete memorymemoryview: invalid slice key@?@d@f@N@n@Q@q@L@l@I@i@H@h@B@b@c@PO|Omemoryview: internal errorstructStructunpack_fromO:memoryviewshapetobytestolistcast__enter____exit__objnbytesreadonlyitemsizendimstridessuboffsetsc_contiguousf_contiguousmanagedbuffermemoryview has %zd exported buffer%s_memory_release(): negative export countoperation forbidden on released memoryview objectmemoryview: underlying buffer is not writablememoryview: underlying buffer is not C-contiguousmemoryview: underlying buffer is not Fortran contiguousmemoryview: underlying buffer is not contiguousmemoryview: underlying buffer requires suboffsetsmemoryview: cannot cast to unsigned bytes if the format flag is presentmemoryview: invalid type for format '%s'memoryview: invalid value for format '%s'memoryview: format %s not supportedmemoryview assignment: lvalue and rvalue have different structuresmemoryview: unsupported format %scannot modify read-only memoryinvalid indexing of 0-dim memorymemoryview assignments are currently restricted to ndim = 1memoryview slice assignments are currently restricted to ndim = 1memoryview: internal error in richcomparememoryview: number of dimensions must not exceed 64cannot hash writable memoryview objectmemoryview: hashing is restricted to formats 'B', 'b' or 'c'memoryview: format argument must be a stringmemoryview: casts are restricted to C-contiguous viewsshape must be a list or a tuplememoryview: cast must be 1D -> ND or ND -> 1Dmemoryview: source format must be a native single character format prefixed with an optional '@'memoryview: cannot cast between two non-byte formatsmemoryview: length is not a multiple of itemsizememoryview.cast(): elements of shape must be integersmemoryview.cast(): elements of shape must be integers > 0memoryview.cast(): product(shape) > SSIZE_MAXmemoryview: product(shape) * itemsize != buffer sizememoryview: destination format must be a native single character format prefixed with an optional '@'memoryview: cannot cast view with zeros in shape or stridesmulti-dimensional sub-views are not implementedmulti-dimensional slicing is not implementedPyMemoryView_FromBuffer(): info->buf must not be NULLmemoryview: %.200s object does not have the buffer interfaceunderlying buffer is not writablewritable contiguous buffer requested for a non-contiguous object.PyBuffer_ToContiguous: len != view->lenP�� �� ��p�� �� �� �� �� ��p��p�� �� ��p�� ����� ��8���� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �� �������X�� ��X�� �������� �� ����� ���� �� ����������$������������4��L������������������������������������������������\������$��$�����������4��L���������������������@��������0�����������������(�� ������������������������������������������������������������������������������������������������������p��������0��l������������l��l������l����l����l��l����������������������������������l��l��l��������l��l������l����l������l��4��������4�����������������4��4��������4�����4�����4��4��������������������������������������������������4��4��4�����4�����4��4��������4�����4��������4��h������h��������������������@����@����@��@����������������������������������h��h��@�����������������@����@������@����,��,��U��,��,��,��,��,��:����,��,��~��,��c��,��H��-��,��,��,��,��,��,��,��,��,��,��,��,��,��,��,��,���������,����,������,��,��p��,����,��,��W��(������P������������x����������������������������������������������������(��P��������������������������������-��-����-��-��-��-��-������-��-����-����-������-��-��-��-��-��-��-��-��-��-��-��-��-��-��-��-��������-����-������-��-��q��-��a��-��-��Q��U��w��w��8��w��w��w��w��w��2��-��w��w����w����w������w��w��w��w��w��w��w��w��w��w��w��w��w��w��w��w��������w��Y��w��S��N��w��w��.��w����w��w�����d�d��d�d�d�d�d���d�d��d��d���d�d�d�d�d�d�d�d�d�d�d�d�d�d�d�d����d��d���d�d��d��d�d�����������������������������������������������������������V������������l�����+���+���+�+��������������������������������V�V��������l�����+���+�����+������1�����������J�>�������������������������������������������X�����1�1��������J�>�����������������%.200s() takes no arguments (%zd given)%.200s() takes exactly one argument (%zd given)Bad call flags in PyCFunction_Call. METH_OLDARGS is no longer supported!%.200s() takes no keyword arguments<method>.__class__.__qualname__ is not a unicode object<built-in method %s of %s object at %p>/builddir/build/BUILD/Python-3.4.10/Objects/methodobject.c%S.%s<built-in function %s>O(Os)free PyCFunctionObjectbuiltin_function_or_method# destroy %S __package____loader____spec__U|O:module.__init___module_reprnameless modulemodule filename missing__file__# clear[1] %s # clear[2] %s __dir__moduledef/builddir/build/BUILD/Python-3.4.10/Objects/moduleobject.cPython import machinery not initializedPython C API version mismatch for module %.100s: This Python has API version %d, module %.100s has version %d.module functions cannot set METH_CLASS or METH_STATIC%.200s.__dict__ is not a dictionary__dir__() -> list specialized dir() implementationnamespace%s(...)%S=%R%s(%S)types.SimpleNamespaceno positional arguments expecteddeallocating Nonedeallocating NotImplementedNoneType takes no arguments<NULL><%s object at %p><nil><refcnt %ld at %p>NULL object : in comparisonunhashable type: '%.200s'assign tocannot delete __dict__Can't initialize type typeCan't initialize weakref typeCan't initialize bool typeCan't initialize 'str'Can't initialize list typeCan't initialize None typeCan't initialize super typeCan't initialize object typeCan't initialize range typeCan't initialize dict typeCan't initialize set typeCan't initialize str typeCan't initialize slice typeCan't initialize complex typeCan't initialize float typeCan't initialize int typeCan't initialize tuple typeCan't initialize StdPrinterCan't initialize code typeCan't initialize frame typeCan't initialize method typeCan't initialize wrapper typeCan't initialize capsule typeCan't initialize cell typeNotImplementedTypeNoneType==Py_ReprNotImplementedType takes no argumentsPyObject_CallFinalizerFromDealloc called on object with a non-zero refcount__repr__ returned non-string (type %.200s)/builddir/build/BUILD/Python-3.4.10/Objects/object.c while getting the str of an object__str__ returned non-string (type %.200s)str() or repr() returned '%.100s' type : %s refcount: %ld address : %p unorderable types: %.100s() %s %.100s()attribute name must be string, not '%.200s''%.50s' object has no attribute '%U''%.100s' object has no attributes (%s .%U)'%.100s' object has only read-only attributes (%s .%U)'%.100s' object has no attribute '%U''%.50s' object attribute '%U' is read-only__dict__ must be set to a dictionary, not a '%.200s'dir(): expected keys() of locals to be a list, not '%.200s'object does not provide __dir__Can't initialize callable weakref proxy typeCan't initialize weakref proxy typeCan't initialize bytearray typeCan't initialize NotImplemented typeCan't initialize traceback typeCan't initialize static method typeCan't initialize frozenset typeCan't initialize property typeCan't initialize managed buffer typeCan't initialize memoryview typeCan't initialize enumerate typeCan't initialize reversed typeCan't initialize builtin function typeCan't initialize function typeCan't initialize dict proxy typeCan't initialize generator typeCan't initialize get-set descriptor typeCan't initialize method wrapper typeCan't initialize ellipsis typeCan't initialize member descriptor typeCan't initialize namespace typeCan't initialize long range iterator typeCan't initialize instance method typeCan't initialize class method descr typeCan't initialize method descr typeCan't initialize call iter typeCan't initialize sequence iterator type%d %ss * %zd bytes each%48s %5u %6u %11zu %15zu %13zu # arenas allocated total# arenas reclaimed# arenas highwater mark# arenas allocated current%zu arenas * %d bytes/arena# bytes in allocated blocks# bytes in available blocks%u unused pools * %d bytes# bytes lost to pool headers# bytes lost to quantizationTotalSmall block threshold = %d, in %u size classes. class size num pools blocks in use avail blocks ----- ---- --------- ------------- ------------ # bytes lost to arena alignment"<capsule object %s%s%s at %p>PyCapsulePyCapsule_New called with null pointerPyCapsule_GetPointer called with invalid PyCapsule objectPyCapsule_GetPointer called with incorrect namePyCapsule_GetName called with invalid PyCapsule objectPyCapsule_GetDestructor called with invalid PyCapsule objectPyCapsule_GetContext called with invalid PyCapsule objectPyCapsule_SetPointer called with null pointerPyCapsule_SetPointer called with invalid PyCapsule objectPyCapsule_SetName called with invalid PyCapsule objectPyCapsule_SetDestructor called with invalid PyCapsule objectPyCapsule_SetContext called with invalid PyCapsule objectPyCapsule_Import could not import module "%s"PyCapsule_Import "%s" is not validrange()(O(OOO))N(N)iN(N)Orangeiter()%R is not in rangerange(%R, %R, %R)range(%R, %R)longrange_iteratorstopsteprange() arg 3 must not be zerorange too large to represent as a range_iteratorlll;rangeiter() requires 3 int argumentsrange object index out of rangerange indices must be integers or slices, not %.200sSet changed size during iteration/builddir/build/BUILD/Python-3.4.10/Objects/setobject.cpop from an empty setfrozenset()%s()%s({%U}){%U}frozensetintersectionissubsetissupersetsymmetric_differenceuniondiscardset_iterator8������ȣ�ӣ�EllipsisO(OOO)slice(%R, %R, %R)slice step cannot be zerolength should not be negative(NNN)indicesellipsisEllipsisType takes no argumentsslice indices must be integers or None or have an __index__ method(O(OO))O|O:structseqn_unnamed_fieldsn_fieldsn_sequence_fieldsunnamed fieldIn structseq_repr(), member %d name is NULL for type %.500sconstructor requires a sequence%.500s() takes a dict as second arg, if any%.500s() takes an at least %zd-sequence (%zd-sequence given)%.500s() takes an at most %zd-sequence (%zd-sequence given)%.500s() takes a %zd-sequence (%zd-sequence given),)free %d-sized PyTupleObject|O:tupletuple_iteratortuple.index(x): x not in tuple/builddir/build/BUILD/Python-3.4.10/Objects/tupleobject.c while getting the repr of a tupletuple indices must be integers, not %.200scan only concatenate tuple (not "%.200s") to tupletuple assignment index out of rangeS��I��?��5����]��) --
can't set %s.%scan't delete %s.%s<class '%U.%U'><class '%s'><%U.%U object at %p>__setattr__<super: <class '%s'>, NULL>object() takes no parameters__delattr__|O!O:supersuper(): no current framesuper(): no code objectsuper(): no argumentssuper(): arg[0] deletedsuper(): bad __class__ cellsuper(): empty __class__ cellcan't pickle %s objects_reduce_ex|i:__reduce__(nO)__len__() should return >= 0bases must be typesinvalid slot offsettype() takes 1 or 3 argumentsUO!O!:type__slots__ must be identifiers__weakref__duplicate base class %Uduplicate base class__eq__copyreg__newobj___slotnames__slotnames____getstate____getnewargs_ex____newobj_ex__mro__repr____str____getattr____iter____next____get____set____delete____del____add____radd____sub____rsub____mul____rmul____mod____rmod____divmod____rdivmod____pow____rpow____neg____pos____abs____bool____invert____lshift____rlshift____rshift____rrshift____and____rand____xor____rxor____or____ror____int____float____iadd____isub____imul____imod____ipow____ilshift____irshift____iand____ixor____ior____floordiv____rfloordiv____truediv____rtruediv____ifloordiv____itruediv____index____slots__bases__thisclass__the class invoking super()__self_class____getattribute____hash____lt____le____ne____gt____ge____new____neg__($self, /) --
-self__pos__($self, /) --
+self__len____setitem____delitem__helper for pickle__subclasshook__default object formatterthe object's class__subclasses____prepare____abstractmethods____basicsize____itemsize____flags____weakrefoffset____base____dictoffset____mro__Cannot create a consistent method resolution order (MRO) for basestype_traverse() called for non-heap type '%.100s'non-empty format string passed to object.__format__This object has no __weakref__PyArg_UnpackTuple() argument list is not a tupleexpected %d arguments, got %zdcan't apply this %s to %s objectcan only assign string to %s.__qualname__, not '%s'can only assign string to %s.__name__, not '%s'__name__ must not contain null bytes__get__(None, None) is invalid%s assignment: '%s' deallocator differs from '%s'%s assignment: '%s' object layout differs from '%s'can't delete __class__ attribute__class__ must be set to a class, not '%s' object__class__ assignment: only for heap types<super: <class '%s'>, <%s object>>Out of memory interning slotdef namesCan't instantiate abstract class %s with abstract methods %Uobject.__init__() takes no parameterstype.__init__() takes no keyword argumentstype.__init__() takes 1 or 3 arguments/builddir/build/BUILD/Python-3.4.10/Objects/typeobject.c%.200s.__slotnames__ should be a list or None, not %.200scopyreg._slotnames didn't return a list or None__slotsname__ changed size during iteration__new__() called with non-type 'self'%s.__new__(): not enough arguments%s.__new__(X): X is not a type object (%s)%s.__new__(%s): %s is not a subtype of %s%s.__new__(%s) is not safe, use %s.__new__()cannot create '%.100s' instancessuper(type, obj): obj must be an instance or subtype of typesuper(): __class__ is not a type (%s)super(): __class__ cell not foundmetaclass conflict: the metaclass of a derived class must be a (non-strict) subclass of the metaclasses of all its basescan't set attributes of built-in/extension type '%s'__getnewargs_ex__ should return a tuple, not '%.200s'__getnewargs_ex__ should return a tuple of length 2, not %zdfirst item of the tuple returned by __getnewargs_ex__ must be a tuple, not '%.200s'second item of the tuple returned by __getnewargs_ex__ must be a dict, not '%.200s'__getnewargs__ should return a tuple, not '%.200s'must use protocol 4 or greater to copy this object; since __getnewargs_ex__ returned keyword arguments.__bool__ should return bool, returned %s__init__() should return None, not '%.200s'__hash__ method should return an integerthis __dict__ descriptor does not support '%.200s' objectsmethod cannot be both class and statictype '%.100s' is not dynamically allocated but its base type '%.100s' is dynamically allocatedtype '%.100s' participates in gc and is a base type but has inappropriate tp_free slotType %.100s defines tp_reserved (formerly tp_compare) but not tp_richcompare. Comparisons may not behave as intended.type '%.100s' is not an acceptable base typemultiple bases have instance lay-out conflictnonempty __slots__ not supported for subtype of '%s'__slots__ items must be strings, not '%.200s'__dict__ slot disallowed: we already got one__weakref__ slot disallowed: either we already got one, or __itemsize__ != 0%R in __slots__ conflicts with class variabletype __qualname__ must be a str, not %sCannot extend an incomplete type '%.100s'mro() returned a non-class ('%.500s')mro() returned base with unsuitable layout ('%.500s')can only assign tuple to %s.__bases__, not %scan only assign non-empty tuple to %s.__bases__, not ()%s.__bases__ must be tuple of classes, not '%s'a __bases__ item causes an inheritance cycletype object '%.50s' has no attribute '%U'the instance invoking super(); may be Nonethe type of the instance invoking super(); may be None__repr__($self, /) --
Create and return a new object. See help(type) for accurate signature.object() --
The most base type__sizeof__() -> int size of object in memory, in bytes__dir__() -> list default dir() implementationmro() -> list return a type's method resolution order__subclasses__() -> list of immediate subclasses__prepare__() -> dict used to create the namespace for the class statement__instancecheck__() -> bool check if an object is an instance__subclasscheck__() -> bool check if a class is a subclass__dir__() -> list specialized __dir__ implementation for types__sizeof__() -> int return memory consumption of the type objectlist of weak references to the object (if defined)dictionary for instance variables (if defined)���������� x�(`�P8pH@X0�h�����������������0P��0x�@�x(H���8X�H�����@wstrlegacy asciilegacy latin1legacy UCS2legacy UCS4<legacy invalid kind><invalid compact kind>unexpected '{' in field nameunmatched '{' in format specMissing ']' in format stringO|UU:maketranssurrogateescapesOnnscharacter maps to <undefined>string index out of rangesurrogates not allowedordinal not in range(256)ordinal not in range(128)xmlcharrefreplace&#%d;expected str, got %ssize must be positiveinvalid kindpadded string is too longn|O&:rjustn|O&:ljustnew string is too longn|O&:centerrepeated string is too longinvalid widening attemptOO|n:replacecharacter out of rangeutf-32-leutf-32-beutf-32utf-16-leutf-16-beutf-16utf8iso8859-1charmapidentifier not ready%s arg must be None or strunexpected special characterutf7unterminated shift sequenceunexpected end of datainvalid start byteinvalid continuation byteembedded null charactersOnnOembedded NUL charactersy#nnOwidth too bigprecision too bigtruncated dataillegal encodingillegal UTF-16 surrogatetruncated \xXX escapetruncated \UXXXXXXXX escapetruncated \uXXXX escapeillegal Unicode charactermalformed \N character escape\ at end of stringunicodedata.ucnhash_CAPItruncated \uXXXXrawunicodeescape\Uxxxxxxxx out of rangetruncated inputunicode_internaldecoding str is not supported|Oss:strMax string recursion exceededformat requires a mappingincomplete format key* wants intprecision too large%c arg not in range(0x110000)%c requires int or charincomplete formatCan't initialize 'unicode'Can't create empty stringcould not ready string _stringstring helper moduleformatter_field_name_splitformatter_parserstr_iteratorcasefoldisdecimalisnumericisidentifierisprintableformat_mapfieldnameiteratorformatteriteratorEncodingMapSingle '}' encountered in format stringSingle '{' encountered in format stringend of string while looking for conversion specifierexpected ':' after conversion specifierexpected '}' before end of stringcharacter mapping must be in range(256)character mapping must return integer, bytes or None, not %.400sToo many decimal digits in format stringcannot switch from manual field specification to automatic field numberingcannot switch from automatic field numbering to manual field specificationOnly '.' or '[' may follow ']' in format field specifierEmpty attribute in format stringfirst maketrans argument must be a string if there is a second argumentthe first two maketrans arguments must have equal lengthif you give only one argument to maketrans it must be a dictstring keys in translate table must be of length 1keys in translate table must be strings or integersdeletion of interned string failedImmortal interned string died.Inconsistent interned string state.only 'strict' and 'surrogateescape' error handlers are supported, not '%s'not enough arguments for format stringCannot modify a string currently usedcharacter mapping must be in range(0x%x)character mapping must return integer, None or strinvalid maximum character passed to PyUnicode_NewNegative size passed to PyUnicode_Newcharacter U+%x is not in range [U+0000; U+10ffff]/builddir/build/BUILD/Python-3.4.10/Objects/unicodeobject.cCannot write %zi characters at %zi in a string of %zi charactersCannot copy %s characters into a string of %s charactersstring is longer than the bufferOn;encoding error handler must return (str/bytes, int) tupleposition %zd from error handler out of boundsencoded result is too long for a Python stringstring is too long to generate reprchr() arg not in range(0x110000)Can't convert '%.100s' object to str implicitly'in <string>' requires string as left operand, not %sstrings are too large to concatendswith first arg must be str or a tuple of str, not %sstartswith first arg must be str or a tuple of str, not %sThe fill character cannot be converted to UnicodeThe fill character must be exactly one character longImpossible unicode object state, wstr and str should share memory already.'%.400s' decoder returned '%.400s' instead of 'str'; use codecs.decode() to decode to arbitrary types'%.400s' encoder returned '%.400s' instead of 'str'; use codecs.encode() to encode to arbitrary typesABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/encoder %s returned bytearray instead of bytes; use codecs.encode() to encode to arbitrary types'%.400s' encoder returned '%.400s' instead of 'bytes'; use codecs.encode() to encode to arbitrary typesO!n;translating error handler must return (str, int) tupleinvalid decimal Unicode stringseparator: expected str instance, %.80s foundsequence item %zd: expected str instance, %.80s foundjoin() result is too long for a Python stringfill character is bigger than the string maximum characterCan't compare %.100s and %.100sstring indices must be integersO!n;decoding error handler must return (str, int) tupleexception attribute object must be bytespartial character in shift sequencenon-zero padding bits in shift sequenceNegative size passed to PyUnicode_FromStringAndSizewcstombs() encountered an unencodable wide characterencoder failed to return bytesmbstowcs() encountered an invalid multibyte sequencecharacter argument not in range(0x110000)PyUnicode_FromFormatV() expects an ASCII-encoded format string, got a non-ASCII byte: 0x%02xcode point in surrogate code point range(0xd800, 0xe000)code point not in range(0x110000)unknown Unicode character name\N escapes not supported (can't load unicodedata module)illegal code point (> 0x10FFFF)unicode_internal codec has been deprecatedcoercing to str: need a bytes-like object, %.80s founddecoder failed to return unicodecharacter mapping must be in range(0x%lx)Format string contains positional fieldsUnknown conversion specifier %cUnknown conversion specifier \x%xautomatic int conversions have been deprecatedstring too large in _PyBytes_FormatLong%%%c format: a number is required, not %.200sunsupported format character '%c' (0x%x) at index %zdnot all arguments converted during string formattingCan't initialize encoding map typeCan't initialize field name iterator typeCan't initialize formatter iter typereleasing %zd interned strings total size of all interned strings: %zd/%zd mortal/immortal split the argument as a field nameparse the argument as a format stringReturn the size (in bytes) of this object��ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ���ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ��P��ʲ����ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ�I��ݮ�ʲ�ʲ�ʲ�ʲ�ݮ�ʲ�ʲ�ʲ�ʲ�ʲ�ʲ���ʲ�ʲ���ʲ�ݮ�ʲ�ʲ�ݮ�,��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��@��(��(��(��(��@��(��(��(��(��(��(��(��(������������������(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(��(����(��(��(��(��(��(����(��(��(��(��(��(��@��(��(��(��(��@��@��(��(��(��@��(��(��(��(��(��(��(��@��(��(��(��@��(��@����@��(����T�����������������������������������������������������������������������T���������������������������������������������������������������������������������������������������������������������������T������������������������������������������������������d�������������$�����������������������4��������������������������t��X�l�l�H�l�l�l�l�l�l�l�8�l�0�l�l� ����>�>�>�>�>�>�>�>�>�>�>�>�>�>�>�>��>�>�>�>�>�>�>�>�9�>�������>��>�>�>�>�>��>�>�9�9�>��>�>�� ���
!""#$%&'"""()*+,-./0123456789:;<=>?@@@ABC@@@@DE@@@@@@FGHIJKLM@NOPQRST@@UV""""""W"""""X""""""""""""""""""""""""""""""""""""YZ[\"""]"""^_"""""`"""a""""""""""bcd""""""ef""""""""g""""""""""""""h""""""""i""""e""""""""""""""""""""h""""""j""""""""""""""""kl"""""""""""""""""mn"""""""""""""""""op""""""""q""rstuvwxyz{|}"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""~�������"����������G�����GGGGGG�G���G�G�GGG�GGG����GGGGGGGGG�GGGGGGGGGGGGGGGGGG""""""�G�GGGGGGGGGGGGGGGGGGGGGGG""""""""�GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG""""�GGGGGGGGG��GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG�GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG@����G�G��������GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG��GG�����G��������AGGGGGGGGGGGGGGGGG���"""""""""""""""W�"��""""""""""""""""""""""""""""""""""""""""""""""""�"""""""""""�""""""""""""""""""""""""""""""""""�"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""�""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""�""""""""""""""""""""""""""""""""�"�GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG"�""�GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG�G��GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG�յ���ssSSSsi0I�n�NsS�jJE���������������������������������e�5R5��h1H1�tT�w W �y Y �a�A��a`�ss�P��R��T��V�B�B������ ���� ������������ ���������������� ���� ������������ ����������� �(���!�)���"�*���#�+���$�,���%�-���&�.���'�/��� �(���!�)���"�*���#�+���$�,���%�-���&�.���'�/���`�h���a�i���b�j���c�k���d�l���e�m���f�n���g�o���`�h���a�i���b�j���c�k���d�l���e�m���f�n���g�o���p����E������������E��B�B��B��B��BE����������t����E������������E��B�B��B��B��BE��������������B�B��B�B�����������B�B��B�B�|����E������������E��B�B��B��B��BE�������ffFFFf�fiFIFi�flFLFl�ffiFFIFfi�fflFFLFfl�stSTSt�stSTSt�tvDFDv�teD5De�tkD;Dk�~vNFNv�tmD=Dm 0 �'���� ' ' g gyy '�'�������� ' �g������ ' g�����' g�� '��'��'��'O�'��'��'��'aa '��'��'�� '��'�� '��'��'��'��'88 '�'����A'�������� '�������� ' g�����'����'~����'+*�']����'(*�'?*?* '=����'E�'G�'** '** '** '.���.��� '2���2��� '3���3��� '6���6��� '5���5��� '1���1��� '(�(� 'D�D� '/���/��� '-���-��� '�)�) '�)�) '+���+��� '*���*��� '�)�) '&���&��� '�������� ''���'��� '�������� '%���%��� ' 7v 4&�'%�'@�'?�'!0! g������ '������ '($0( g-+- g�������� '�������� '�'0.0 g313 g�'646 g979 g�������� '<:< g?=? g '����'B@B g�����'P�'�������� '�'�� '0�'������ 'FC H g`�' �� '�� 'MJ M gRO R gWT W g\Y \ ga^ a gece gif i�g '�����'mj m gso0s gzv0z g�}0� gJJ 'VV 'dd '�� 'pp '~~ '�� � g�� � g�� � g�� � g�� � g�� � g�� � g�� � g�� �Ag�� �Ag�� �Ag�� �Ag�� �Ag�� �Ag�� �Ag�� �Ag�� � g�� � g�� � g�� � g�� g g g g Ag Ag# %Ag)& +Ag/, 1Ag52 7Ag;8 =AgA> CAgGD I gMJ O gSP U gYV [ g_\ a geb g gkh m gqn s gwt yAg}z Ag�� �Ag�� �Ag�� �Ag�� �Ag�� �Ag�� �Ag�� � g�� � g�� � g�� � g��0� g�����'�� �Ag��� g�� � g�� � g�� � g�� � g��0� g�����'�� �Ag��0� g0 g
g0 g�����'0 g0 g$! $ g)& ) g/+0/ g�����'52 7 g<9 > gB? D gIF I gOK0R g�����'�����'XU ZAg ���'A���'����'�'���� '�/��/�$����$ ���'��'���'������ '������ '����'���'����'����'����'���� '�u���'�Z���'�Z���'^[ ` geb g gli n gtp0w g~z0� g�� � g�� � g�� � g�� � g�� � g�� � g�� � g(�'������ '࿚������?�?UUUUUU�?�?�������?UUUUUU�?�$I�$I�?�?�q�q�?$@Y@@�@��@j�@�חA��mB&@@(@*@@,@.@@1@!@2@3@UUUUUU�?�������?4@i@@�@��@5@^ A6@7@8@9@:@;@<@=@@�?�?�?333333�?�?>@�r@p�@L�@?@@@�@@A@�A@B@�B@C@�C@@�������?D@y@@�@��@�D@E@�E@^AF@�F@G@�G@H@�H@@@�������?�?I@@@��@j�@@N@��@p�@L�@@@�?�Q@�@X�@�@ @T@�@@�@��@"@@�V@ �@��@��@<weakproxy at %p to %s at %p><weakref at %p; dead>:__call__weak object has gone awayweakcallableproxyweakproxy__callback__<weakref at %p; to '%s' at %p (%U)><weakref at %p; to '%s' at %p>cannot create weak reference to '%s' objectweakly-referenced object no longer exists/builddir/build/BUILD/Python-3.4.10/Objects/weakrefobject.calwaysunknown action'registry' must be a dict<unknown>filtersshowwarningonce:%d: lost sys.stderr OOUi|OOO:warn_explicit__warningregistry____main__O|On:warn_onceregistry_defaultactioncategorystacklevelmodule_globals_warnings_filters_mutated_warnings.filters must be a list_warnings.filters item %zd isn't a 5-tuple_warnings.defaultaction not foundUnrecognized action (%R) in warnings.filters: %Rwarnings.showwarning() must be set to a callable/builddir/build/BUILD/Python-3.4.10/Python/_warnings.ccategory is not a subclass of Warningunknown operator foundunknown expr_context foundeither 0 or s(O){sOss}_astO()O()O_attributesModuleInteractiveExpressionSuiteFunctionDefClassDefReturnDeleteAugAssignForWhileWithRaiseTryAssertImportImportFromGlobalNonlocalExprPassBreakContinueBoolOpBinOpUnaryOpLambdaIfExpDictSetListCompSetCompDictCompGeneratorExpYieldYieldFromCompareCallNameConstantAttributeSubscriptStarredListTupleexpr_contextDelAugLoadAugStoreParamExtSliceIndexboolopMultModPowLShiftRShiftBitOrBitXorBitAndFloorDivunaryopInvertUAddUSubcmpopNotEqLtLtEGtGtEIsIsNotNotInexcepthandlerExceptHandleraliaswithitemunknown boolop foundunknown unaryop foundunknown cmpop foundinvalid integer value: %Rfield test is required for Iffield n is required for Numfield s is required for Strfield s is required for Bytesfield id is required for Namefield arg is required for argPyCF_ONLY_ASTexpected %s node, got %.400scontext_exproptional_varsasnameannotationcol_offsetvarargkwonlyargskw_defaultskwargtargetifsdimseltsctxfunckeywordsstarargskwargsopseltgeneratorsorelseoperandhandlersfinalbodyexctargetsdecorator_listreturns_ast.AST���������������,��<��L��\��l��|������������������������,�t����\������� � ����<����� �\ ��� � � �\ ��y�I�i�Y�9�)�� ����]�t-�,�*��)�)�(�<(�D'�'�4&�%��$�#�$#��"�!��!�$!� �!� ���%.400s constructor takes %s%zd positional argument%sexpected some sort of operator, but got %Rexpected some sort of expr_context, but got %RAST identifier must be of type strfield body is required for Expressionfield name is required for FunctionDeffield args is required for FunctionDeffield name is required for ClassDeffield value is required for Assignfield target is required for AugAssignfield op is required for AugAssignfield value is required for AugAssignfield target is required for Forfield iter is required for Forfield test is required for Whilefield test is required for Assertfield value is required for Exprfield op is required for BoolOpfield left is required for BinOpfield op is required for BinOpfield right is required for BinOpfield op is required for UnaryOpfield operand is required for UnaryOpfield args is required for Lambdafield body is required for Lambdafield test is required for IfExpfield body is required for IfExpfield orelse is required for IfExpfield elt is required for ListCompfield elt is required for SetCompfield key is required for DictCompfield value is required for DictCompfield elt is required for GeneratorExpfield value is required for YieldFromfield left is required for Comparefield func is required for Callfield value is required for NameConstantfield value is required for Attributefield attr is required for Attributefield ctx is required for Attributefield value is required for Subscriptfield slice is required for Subscriptfield ctx is required for Subscriptfield value is required for Starredfield ctx is required for Starredfield ctx is required for Namefield ctx is required for Listfield ctx is required for Tuplefield value is required for Indexfield target is required for comprehensionfield iter is required for comprehensionfield arg is required for keywordfield value is required for keywordrequired field "value" missing from keywordrequired field "arg" missing from keywordrequired field "col_offset" missing from exprexpected some sort of boolop, but got %Rrequired field "op" missing from BoolOpBoolOp field "values" must be a list, not a %.200srequired field "values" missing from BoolOprequired field "left" missing from BinOprequired field "op" missing from BinOprequired field "right" missing from BinOpexpected some sort of unaryop, but got %Rrequired field "op" missing from UnaryOprequired field "operand" missing from UnaryOprequired field "args" missing from Lambdarequired field "body" missing from Lambdarequired field "test" missing from IfExprequired field "body" missing from IfExprequired field "orelse" missing from IfExpDict field "keys" must be a list, not a %.200srequired field "keys" missing from DictDict field "values" must be a list, not a %.200srequired field "values" missing from DictSet field "elts" must be a list, not a %.200srequired field "elts" missing from Setrequired field "elt" missing from ListCompListComp field "generators" must be a list, not a %.200srequired field "generators" missing from ListComprequired field "elt" missing from SetCompSetComp field "generators" must be a list, not a %.200srequired field "generators" missing from SetComprequired field "key" missing from DictComprequired field "value" missing from DictCompDictComp field "generators" must be a list, not a %.200srequired field "generators" missing from DictComprequired field "elt" missing from GeneratorExpGeneratorExp field "generators" must be a list, not a %.200srequired field "generators" missing from GeneratorExprequired field "value" missing from YieldFromrequired field "left" missing from CompareCompare field "ops" must be a list, not a %.200sexpected some sort of cmpop, but got %Rrequired field "ops" missing from CompareCompare field "comparators" must be a list, not a %.200srequired field "comparators" missing from Comparerequired field "func" missing from CallCall field "args" must be a list, not a %.200srequired field "args" missing from CallCall field "keywords" must be a list, not a %.200srequired field "keywords" missing from Callrequired field "n" missing from NumAST string must be of type strrequired field "s" missing from StrAST bytes must be of type bytesrequired field "s" missing from BytesAST singleton must be True, False, or Nonerequired field "value" missing from NameConstantrequired field "value" missing from Attributerequired field "attr" missing from Attributerequired field "ctx" missing from Attributerequired field "value" missing from Subscriptrequired field "slice" missing from Subscriptrequired field "ctx" missing from Subscriptrequired field "value" missing from Starredrequired field "ctx" missing from Starredrequired field "id" missing from Namerequired field "ctx" missing from NameList field "elts" must be a list, not a %.200srequired field "elts" missing from Listrequired field "ctx" missing from ListTuple field "elts" must be a list, not a %.200srequired field "elts" missing from Tuplerequired field "ctx" missing from Tupleexpected some sort of expr, but got %Rrequired field "lineno" missing from exprrequired field "arg" missing from argarguments field "args" must be a list, not a %.200sarguments field "kwonlyargs" must be a list, not a %.200srequired field "kwonlyargs" missing from argumentsarguments field "kw_defaults" must be a list, not a %.200srequired field "kw_defaults" missing from argumentsarguments field "defaults" must be a list, not a %.200srequired field "defaults" missing from argumentsrequired field "args" missing from argumentsrequired field "iter" missing from comprehensioncomprehension field "ifs" must be a list, not a %.200srequired field "ifs" missing from comprehensionrequired field "target" missing from comprehensionExtSlice field "dims" must be a list, not a %.200srequired field "dims" missing from ExtSlicerequired field "value" missing from Indexexpected some sort of slice, but got %Rfield name is required for aliasrequired field "name" missing from aliasfield context_expr is required for withitemrequired field "col_offset" missing from stmtrequired field "name" missing from FunctionDefrequired field "args" missing from FunctionDefFunctionDef field "body" must be a list, not a %.200srequired field "body" missing from FunctionDefFunctionDef field "decorator_list" must be a list, not a %.200srequired field "decorator_list" missing from FunctionDefrequired field "name" missing from ClassDefClassDef field "bases" must be a list, not a %.200srequired field "bases" missing from ClassDefClassDef field "keywords" must be a list, not a %.200srequired field "keywords" missing from ClassDefClassDef field "body" must be a list, not a %.200srequired field "body" missing from ClassDefClassDef field "decorator_list" must be a list, not a %.200srequired field "decorator_list" missing from ClassDefDelete field "targets" must be a list, not a %.200srequired field "targets" missing from DeleteAssign field "targets" must be a list, not a %.200srequired field "targets" missing from Assignrequired field "value" missing from Assignrequired field "target" missing from AugAssignrequired field "op" missing from AugAssignrequired field "value" missing from AugAssignrequired field "target" missing from Forrequired field "iter" missing from ForFor field "body" must be a list, not a %.200srequired field "body" missing from ForFor field "orelse" must be a list, not a %.200srequired field "orelse" missing from Forrequired field "test" missing from WhileWhile field "body" must be a list, not a %.200srequired field "body" missing from WhileWhile field "orelse" must be a list, not a %.200srequired field "orelse" missing from Whilerequired field "test" missing from IfIf field "body" must be a list, not a %.200srequired field "body" missing from IfIf field "orelse" must be a list, not a %.200srequired field "orelse" missing from IfWith field "items" must be a list, not a %.200srequired field "context_expr" missing from withitemrequired field "items" missing from WithWith field "body" must be a list, not a %.200srequired field "body" missing from WithTry field "body" must be a list, not a %.200srequired field "body" missing from TryTry field "handlers" must be a list, not a %.200srequired field "lineno" missing from excepthandlerrequired field "col_offset" missing from excepthandlerExceptHandler field "body" must be a list, not a %.200srequired field "body" missing from ExceptHandlerexpected some sort of excepthandler, but got %Rrequired field "handlers" missing from TryTry field "orelse" must be a list, not a %.200srequired field "orelse" missing from TryTry field "finalbody" must be a list, not a %.200srequired field "finalbody" missing from Tryrequired field "test" missing from AssertImport field "names" must be a list, not a %.200srequired field "names" missing from ImportImportFrom field "names" must be a list, not a %.200srequired field "names" missing from ImportFromGlobal field "names" must be a list, not a %.200srequired field "names" missing from GlobalNonlocal field "names" must be a list, not a %.200srequired field "names" missing from Nonlocalrequired field "value" missing from Exprexpected some sort of stmt, but got %Rrequired field "lineno" missing from stmtModule field "body" must be a list, not a %.200srequired field "body" missing from ModuleInteractive field "body" must be a list, not a %.200srequired field "body" missing from Interactiverequired field "body" missing from ExpressionSuite field "body" must be a list, not a %.200srequired field "body" missing from Suiteexpected some sort of mod, but got %RNon-statement found: %d %d(unknown)Compare with no comparatorsnon-numeric type in Numnon-string type in Strnon-bytes type in Bytesunexpected expressionempty %s on %sImportFrom level less than -1unexpected statementunknown slice node(OiiN)unicodedatanormalizeNFKC(sN)__debug__assignment to keywordconditional expressionliterallambdafunction callgenerator expressionyield expressionlist comprehensionset comprehensiondict comprehensiondeletecan't %s %sunexpected import name: %dstring to parse is too long\U%08xunicode errorvalue errorinvalid comp_op: %sinvalid comp_op: %s %sunhandled factor: %d(%s) %s(%s) unknown errorunhandled atom %dunhandled expr: %dunexpected nodemore than 255 argumentskeyword argument repeatedinvalid augassign: %sunexpected flow_stmt: %dfinallymalformed 'try' statementimpossible module node�� ��X��X��X��X��X��X��X��X��X��X��p���X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X��X���X��X��X��X��X��X��X������0������6��}�����������D��$����4�����L����4��4��̦�4�����d�����l��̧����4��{��r��i��`��W����v�������X��Ȱ���P������8����Ȯ��ȭ��X����������0�� �� �� ��h������и�����������X����� ��0��@��p����������������������������T��4��4��4��4��4��4���������������������������������������L�����������������(����p������������������������������������������������������������������������������������������������������������������������������������������������������������d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��4��t������l��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d��d����0��������`��`����������������������������0����������6�������������������������������������������������������������������������������������������������������������������������������������������������������������������������a�� comprehension with no generatorsexpression which can't be assigned to in %s contextexpression must have %s context but has %s insteadBoolOp with less than 2 valuesDict doesn't have the same number of keys as valuesCompare has a different number of comparators and operandsNone disallowed in expression listmore positional defaults than args on argumentslength of kwonlyargs is not the same as kw_defaults on argumentsRaise with cause but no exceptionTry has neither except handlers nor finalbodyTry has orelse but no except handlersNone disallowed in statement listunexpected expression in assignment %d (line %d)/builddir/build/BUILD/Python-3.4.10/Python/ast.cbytes can only contain ASCII literal characters.invalid comp_op: has %d childrencannot mix bytes and nonbytes literalsnamed arguments must follow bare *non-default argument follows default argumentunexpected node in varargslist: %d @ %dlogic error in count_comp_forsGenerator expression must be parenthesized if not sole argumentnon-keyword arg after keyword argonly named arguments may follow *expressionlambda cannot contain assignmentkeyword can't be an expressionillegal expression for augmented assignmentassignment to yield expression not possibletrailing comma not allowed without surrounding parenthesesUnexpected node-type in from-importunknown import statement: starts with command '%s'improper number of parts to 'assert' statement: %dunhandled small_stmt: TYPE=%d NCH=%d unexpected token in 'if' statement: %swrong number of tokens for 'while' statement: %dwrong number of children for 'except' clause: %dSuite is not valid in the CPython compilerinvalid node %d for PyAST_FromNodefilterfilter()zip()sumO|Oi:sortedO|O:round|OOOO:print|$OO%s() arg is an empty sequenceissubclassisinstanceinput(): lost sys.stdininput(): lost sys.stdoutinput(): lost sys.stderrhasattrO|U:formatdivmodi:chrU|OOOi:__import__setattrdelattrexecstring, bytes or codeglobals must be a dictevallocals must be a mappingOO&s|iii:compilecompile(): unrecognised flagssinglestring, bytes or ASTzipdont_inheritoptimizendigits__build_class__anybinhashoctmetaclassmap() must have at least two arguments.zip argument #%zd must support iterationsum() can't sum strings [use ''.join(seq) instead]sum() can't sum bytes [use b''.join(seq) instead]sum() can't sum bytearray [use b''.join(seq) instead]type %.100s doesn't define __round__ methodsep must be None or a string, not %.200send must be None or a string, not %.200sord() expected string of length 1, but %.200s foundord() expected a character, but string of length %zd found'%.200s' object is not an iteratorCannot specify a default for %s() with multiple positional argumentshasattr(): attribute name must be stringgetattr(): attribute name must be string__build_class__: args is not a tuple__build_class__: not enough arguments__build_class__: func must be a function__build_class__: name is not a stringvars() argument must have __dict__ attributeiter(v, w): v must be callable%s() arg 1 must be a %s objectsource code string cannot contain null bytesglobals and locals cannot be NULLexec() arg 2 must be a dict, not %.100sarg 3 must be a mapping or None, not %.100scode object passed to exec() may not contain free variablesglobals must be a real dict; try eval(expr, {}, mapping)eval must be given globals and locals when called without a framecode object passed to eval() may not contain free variablescompile(): invalid optimize valuecompile() arg 3 must be 'exec', 'eval' or 'single'positionalkeyword-only%U and %U, %U, and %UPyCOND_INIT(gil_cond) faileddrop_gil: GIL is not lockedPyCOND_FINI(gil_cond) failedtake_gil: NULL tstatePyCOND_WAIT(gil_cond) failedthreadingframe does not existargument list must be a tupleceval: tstate mix-upceval: orphan tstatelost sys.displayhookbad RAISE_VARARGS oparg'finally' pops bad exception__build_class__ not foundno locals when deleting %Rname '%.200s' is not definedno locals when loading %R__import__ not foundcannot import name %RXXX lineno: %d, opcode: %d unknown opcodewaswere%U() keywords must be stringsfrom %d to %d__all___after_forkneed more than %d value%s to unpacktoo many values to unpack (expected %d)need more than %zd values to unpacklocal variable '%.200s' referenced before assignmentfree variable '%.200s' referenced before assignment in enclosing scope%U() missing %i required %s argument%s: %U/builddir/build/BUILD/Python-3.4.10/Include/pyatomic.h/builddir/build/BUILD/Python-3.4.10/Python/ceval_gil.hPyMUTEX_INIT(gil_mutex) failedPyMUTEX_INIT(switch_mutex) failedPyCOND_INIT(switch_cond) failedPyMUTEX_LOCK(gil_mutex) failedPyCOND_SIGNAL(gil_cond) failedPyMUTEX_UNLOCK(gil_mutex) failedPyMUTEX_LOCK(switch_mutex) failedPyCOND_WAIT(switch_cond) failedPyMUTEX_UNLOCK(switch_mutex) failedPyMUTEX_FINI(gil_mutex) failedPyCOND_FINI(switch_cond) failedPyMUTEX_FINI(switch_mutex) failed/builddir/build/BUILD/Python-3.4.10/Python/ceval.cPyEval_ReleaseThread: NULL thread statePyEval_ReleaseThread: wrong thread statePyCOND_SIGNAL(switch_cond) failedPyEval_AcquireLock: current thread state is NULLPyEval_AcquireThread: NULL new thread statePyEval_AcquireThread: non-NULL old thread statePyEval_SaveThread: NULL tstatePyEval_RestoreThread: NULL tstateCannot recover from stack overflow.maximum recursion depth exceeded%skeyword list must be a dictionary%.200s%s got multiple values for keyword argument '%U'No active exception to reraisecalling %R should have returned an instance of BaseException, not %Rexceptions must derive from BaseExceptionexception causes must derive from BaseExceptionpopped block is not an except handlerno locals found when storing %Rcatching classes that do not inherit from BaseException is not allowedno locals found during 'import *'from-import-* object has no __dict__ and no __all__%.200s() takes no arguments (%d given)%.200s() takes exactly one argument (%d given)%.200s%.200s argument after ** must be a mapping, not %.200s%.200s%.200s argument after * must be a sequence, not %.200serror return without exception setPyEval_EvalCodeEx: NULL globals%U() got an unexpected keyword argument '%S'%U() got multiple values for argument '%S' positional argument%s (and %d keyword-only argument%s)%U() takes %U positional argument%s but %d%U %s given����g���h������ڐ��<g������������h������pk��Ň��������'������������̨���w�����[x���Q����m���n��(��������}���������������������������������������������������������������������������~�� ����g��X�����"����ْ��t�������@����������X���N����������b���������ʘ������:i��������ܧ���q�����Is������+���ul��#�����Z����z�������������{��Þ��v|��9}�����l��(�����ˋ��\y��Oz���������o��Uq���������������;������L���������̔���d���d���d�����)�������Y��������������o����e������e���j���v��;���zs�����`a��`a��`a���u������Gm��t���t��j��������-������<���too many statically nested blocksunknown scope for %.100s in %.100s(%s) symbols: %s locals: %s globals: %slookup %s in %s %d %d freevars of %s: %s private identifier too large to be mangledparam invalid for deref variableparam invalid for local variableparam invalid for global variableparam invalid for name variableunary op %d should not be possibleparam invalid in attribute expressionparam invalid in subscript expressionstarred assignment target must be in a list or tuplecan use starred expression only as assignment targettoo many expressions in star-unpacking assignmenttwo starred expressions in assignmentextended slice invalid in nested sliceinplace binary op %d should not be possibleinvalid node type (%d) for augmented assignmentassertion is always true, perhaps remove parentheses?from __future__ imports must occur at the beginning of the filedefault 'except:' must be lastmodule kind %d should not be possiblecompiler_make_closure()(OiiO)(zO)compile.c compiler unitcompiler_exit_scope()opcode = %d PyCompile_OpcodeStackEffect()<lambda><genexpr><listcomp><setcomp><dictcomp>'yield' outside functioninvalid subscript kind %dtoo many annotations'return' outside function__future__'break' outside loopno symtable<module>suite should not be possible.<locals>@�@���`�P���������j���������\����������T�������������,���,�����������������������d���T���D�������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������\���\�����������������������������|���l���<���������������$���$������|������������������H��0��������X�����8����������������h������ ��� ��������������X�����8�����h����� ��S��4�������������3������������n��,'���%��L&���&���&��L'���'��(���)��<*���*���*��,+��\+��l,��.��,'��,'���0��,'���%��,0��ghi|}~ >?BA@789;CKLONM 'continue' not supported inside 'finally' clause'continue' not properly in loop(Nn)%s with '%s' codec faileddecodingincrementaldecoderincrementalencoderhandler must be callableencodingsargument must be callableunknown encoding: %sOscodecs.encode()codecs.decode()(Cn)_is_text_encodingstrict_errorsignore_errorsxmlcharrefreplace_errorsbackslashreplace_errorssurrogatepass0123456789abcdefdon't know how to handle %.200s in error callbackencoder must return a tuple (object, integer)decoder must return a tuple (object,integer)/builddir/build/BUILD/Python-3.4.10/Python/codecs.ccan't initialize codec error registrycan't initialize codec registryno codec search functions registered: can't find encodingcodec search functions must return 4-tuples'%.400s' is not a text encoding; use %s to handle arbitrary codecsunknown error handler name '%.400s'codec must pass exception instanceImplements the 'strict' error handling, which raises a UnicodeError on coding errors.Implements the 'ignore' error handling, which ignores malformed data and continues.Implements the 'replace' error handling, which replaces malformed data with a replacement marker.Implements the 'xmlcharrefreplace' error handling, which replaces an unencodable character with the appropriate XML character reference.Implements the 'backslashreplace' error handling, which replaces an unencodable character with a backslashed escape sequence.R���Q���Q��PR��8R���S���S��vS��ZS���S��RUNNING_ON_VALGRIND/builddir/build/BUILD/Python-3.4.10/Python/errors.cexception %R not a BaseException subclassOut of memory and PyExc_MemoryError is not initialized yetbad argument type for built-in operation%s:%d: bad argument to internal functionbad argument to internal functionPyErr_NewException: name must be module.class(iOOiO)(iOO)(iO)sOOException ignored in: rbout of memory PYTHONINSPECTPYTHONUNBUFFEREDPython %s %s __main__ not frozen<stdin>Unable to decode the command line argument #%i nested_scopesdivisionabsolute_importwith_statementprint_functionunicode_literalsbarry_as_FLUFLbracesnot a chancefuture feature %.100s is not definedUnmatched left paren in format stringUnmatched right paren in format stringinteger argument expected, got floatstr without null characters or Nonemust be %d-item sequence, not %.50smust be sequence of length %d, not %zdunsigned byte integer is less than minimumunsigned byte integer is greater than maximumsigned short integer is less than minimumsigned short integer is greater than maximumsigned integer is greater than maximumsigned integer is less than minimum(unknown parser marker combination)string or unicode or text buffer(encoder failed to return bytes)encoded string without NULL bytesinvalid use of 'w' format character%s%s takes at most %d argument%s (%zd given)Invalid format string (| specified twice)Invalid format string ($ before |)Invalid format string ($ specified twice)Function takes %s %d positional arguments (%d given)More keyword list entries (%d) than format specifiers (%d)Argument given by name ('%s') and position (%d)Required argument '%s' (pos %d) not foundmore argument specifiers than keyword list entries (remaining format:'%s')'%U' is an invalid keyword argument for this functiontoo many tuple nesting levels in argument format string%.200s%s takes at least one argumentold style getargs format uses new featuresnew style getargs format but argument is not a tuple%.150s%s takes %s %d argument%s (%ld given)/builddir/build/BUILD/Python-3.4.10/Python/getargs.ckeyword arguments must be strings%s expected %s%zd arguments, got %zdunpacked tuple should have %s%zd elements, but has %zd%s does not take keyword arguments%s does not take positional argumentsimpossible<bad format char>bytes or buffercontiguous bufferread-only pinned buffer%.200s() argument %zd, item %d %.256sstr or Nonestr without null charactersis not retrievableinteger<k>must be %.50s, not %.50sinteger<K>a byte string of length 1a unicode charactersize does not fit in an intbytes without null bytes(unicode conversion error)(buffer is NULL)(AsCharBuffer failed)(encoding failed)(buffer_len is NULL)(buffer overflow)(unspecified)read-write bufferat mostexactly%s: '%s'at leastexcess ')' in getargs formatmissing ')' in getargs format%.200s%s takes no argumentsbad format string: %.200sat least at most ����D�������������������������������������������������������������������������������������������������������������������������������������������������������l��������������������������������������������������������������������������������������܊��������������������������������������������������������������������������������������p������������������X���������������������� ���������������З����������������������0���������������������������������Ț��P����������H���������x�������(���Д������@������������������X��������������������@���X��� [GCC 8.5.0 20210514 (Red Hat 8.5.0-20)]Copyright (c) 2001-2019 Python Software Foundation. All Rights Reserved.
Copyright (c) 2000 BeOpen.com. All Rights Reserved.
Copyright (c) 1995-2001 Corporation for National Research Initiatives. All Rights Reserved.
Copyright (c) 1991-1995 Stichting Mathematisch Centrum, Amsterdam. All Rights Reserved.3.4.10%.80s (%.80s) %.80sbreakcontinueraiseglobalnonlocalassertelifexceptsingle_inputfile_inputeval_inputdecoratordecoratorsdecoratedfuncdeftypedargslisttfpdefvarargslistvfpdefsimple_stmtsmall_stmtexpr_stmttestlist_star_expraugassigndel_stmtpass_stmtflow_stmtbreak_stmtcontinue_stmtreturn_stmtyield_stmtraise_stmtimport_stmtimport_nameimport_fromimport_as_namedotted_as_nameimport_as_namesdotted_as_namesdotted_nameglobal_stmtnonlocal_stmtassert_stmtcompound_stmtif_stmtwhile_stmtfor_stmttry_stmtwith_stmtwith_itemexcept_clausesuitetest_nocondlambdeflambdef_nocondor_testand_testnot_testcomp_opxor_exprand_exprshift_exprarith_exprtermfactorpoweratomtestlist_comptrailersubscriptlistsubscriptsliceopexprlisttestlistdictorsetmakerclassdefarglistcomp_itercomp_forcomp_ifencoding_declyield_expryield_arg(0���p�%��P>��(0���p�%��P>� ���P> � (0���p�%��P>� ���p��P>� ����P>� ��� @�� @�%� ���p��P>�� ��P> ��P>�� �P> @ ���P> ���P> ����P> ���P>U:is_frozen_packageU:get_frozen_objectU:is_builtinUO&|O:load_dynamicU:is_frozenO!U:_fix_co_filenameCan't backup builtins dictmeta_pathpath_importer_cachenot holding the import lock# clear builtins._ # clear sys.%s # restore sys.%s # cleanup[2] removing %U # cleanup[3] wiping %U # cleanup[3] wiping sys # cleanup[3] wiping builtins _RAW_MAGIC_NUMBERU:init_builtin__path__U:init_frozenEmpty module namemodule name must be a stringlevel must be >= 0package must be a string'__name__' not in globals__name__ must be a string<frozen importlib._bootstrap>_call_with_frames_removed{OO}OOOOiunable to get sys.path_hooks# installing zipimport hook zipimport# can't import zipimport # installed zipimport hook initializing zipimport failedreload_handle_fromlist_find_and_load_lock_unlock_module_initializing_fix_up_module_get_sourcefile_impextension_suffixeslock_heldacquire_lockrelease_lock__stdin____stdout____stderr__ps1ps2last_typelast_valuelast_traceback__interactivehook__No such frozen object named %RExcluded frozen object named %RCan't initialize import variablesinitializing sys.meta_path, sys.path_hooks, or path_importer_cache failedPyImport_ReInitLock failed to create a new lock/builddir/build/BUILD/Python-3.4.10/Python/import.cPyImport_GetModuleDict: no module dictionary!import: deleting existing key insys.modules failedLoaded module %R not found in sys.modulesimport %U # previously loaded (%R) Cannot re-init internal module %RPyImport_ExecCodeModuleWithPathnames: no interpreter!frozen object %R is not a code objectParent module %R not loaded, cannot perform relative importattempted relative import beyond top-level packageimport of %R halted; None in sys.modules%R not in sys.modules as expected# can't import zipimport.zipimporter dynamic module does not define init function (PyInit_%s)initialization of %s raised unreported exceptioninitialization of %s did not return an extension moduletoo many objectsmarshal data too shortEOF read where not expectedrecursion limit exceededy*:loadsunmarshallable objectO|i:dumpsOO|i:dumpmarshalread() returned too much data: %zd bytes requested, %zd returnedbad marshal data (index list too large)EOF read where object expectedbad marshal data (long size out of range)bad marshal data (unnormalized long data)bad marshal data (digit out of range in long)bad marshal data (string size out of range)bad marshal data (unicode size out of range)bad marshal data (tuple size out of range)NULL object in marshal data for tuplebad marshal data (list size out of range)NULL object in marshal data for listbad marshal data (set size out of range)NULL object in marshal data for setbad marshal data (invalid reference)bad marshal data (unknown type code)XXX readobject called with exception set NULL object in marshal data for objectf.read() returned not bytes but %.100sobject too deeply nested to marshal|������ ��� ��� ��� ������ ������ ��� ��� ��� ��� ��� ��� ��� ��� ��� ��� ������ ������ ��� ������ ��� ��� ��� ������ ��� ��� ��� ��� ��� ��� ������ ��� ��� ��� ��$����� ��� ��� ��� ��� �����<��� ��� ��� ��� ��� ��l��� ������ ��� �����<��� ������ ��� ����� ��� ��� ��� ��� �����|�����<��� ��� ��d����������unmatched paren in formatUnmatched paren in formatmodule '%s' has no __dict__���\��\��\��\��\��\��\��\��T��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��T��\��\��T��\��\��T��\��,��D��\��\��T��\��\��\��\��\��\��\��\��\��\��\��\��\��T��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��,��\��D��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��\��,��\��D�����!��!��!��!��!��!��!��!��!��!��!��!��!��!��!��!��!��!��!��!��!��!�����!��!��!��!��!��!��!�����!��!��!�����!��!��!��!��!��!��!��!��!��!��!��!��!�����!��!��!��!��!��!��!��D��l�����!��!��!��������!����D��!��t��t��!��!��!��t��!�����!��!��!��!��!����!��!��!��!��!��!��D������ ��!��� ��!��D��D��!��� �����!�����!��!��!��!�����!����!��!��!��T��������NULL object passed to Py_BuildValuebad format char passed to Py_BuildValuePyModule_AddObject() needs module as first argPyModule_AddObject() needs non-NULL value@(
�������UUUUUUUU�������?33333333�������*�$I�$I�$�������q�q�q��������E]t�EUUUUUUU�;�;�I�$I�$I�������8��8��85��P^Cy �������0�0�0袋.�����,d!������� p= ףp= ؉�؉�� %���^B{ $I�$I�$ �=�����������B!�B��������|��������PuPuP�q�qunexpected binary operation %d on a constantunexpected unary operation %d on a constant7��7��|3���3���3��7���3���3���3���5���5���3���5���5���5���5���5���5���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���5���5���5���5���5���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3��D5���3���3���3���3���3���3���3���3���3��T4���3���3���3���3���3���3���3���3��6��6��6���3���3��3���3���3��T4��|2��|2��T4��T4��T4���3���3���3��T4��T4��T4��T4���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3���3��T4���1��)8��8���8���7���7���7���7��c7���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8���8��r8��Q8��B7���5��
!"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~�����������������������������������������������������������������������������������������������������������������������������*@�� @��@��@���A���A��xA��pA��siphash24PyThreadState_Delete: NULL tstatePyThreadState_Delete: NULL interpCouldn't create autoTLSkey mapping/builddir/build/BUILD/Python-3.4.10/Python/pystate.cCan't initialize threads for interpreterPyState_AddModule: Module Definition is NULLPyState_AddModule: Module already added!PyState_RemoveModule: Module index invalid.PyState_RemoveModule: Interpreters module-list not acessible.PyState_RemoveModule: Module index out of bounds.PyThreadState_Clear: warning: thread still has a frame PyThreadState_Delete: tstate is still currentPyInterpreterState_Delete: invalid interpPyInterpreterState_Delete: remaining threadsPyThreadState_DeleteCurrent: no current tstatePyThreadState_Get: no current threadCouldn't create thread-state for new threadauto-releasing thread-state, but no thread-state for this threadThis thread state must be current when releasingCould not allocate TLS entry File "%U", line %d ^ unexpected indentinvalid tokenunexpected EOF while parsingexpression too longunknown decode errorunknown parsing errorexpected an indented blockinvalid syntaxunexpected unindenterror=%d (sO)sNwbOsssOisiOOOiencodings.utf_8encodings.latin_1OpenWrapperPYTHONIOENCODING<stdout><stderr>PYTHONHOMEFatal Python error: %s CODESET is not set or emptycan't create __main__ moduleBuiltinImporterError in sys.excepthook:
Original exception was: sys.excepthook is missing _frozen_importlibimport imp # builtin import sys # builtin _install>>> ... __cached__.pyc.pyoSourcelessFileLoaderBad magic number in .pyc fileBad code object in .pyc fileSourceFileLoadersysmodules???PYTHONDEBUGPYTHONVERBOSEPYTHONOPTIMIZEPYTHONDONTWRITEBYTECODEPYTHONHASHSEED_shutdownrawexcepthook The above exception was the direct cause of the following exception:
During handling of the above exception, another exception occurred:
TypeError: print_exception(): Exception expected for value, EOF while scanning triple-quoted string literalEOL while scanning string literalinconsistent use of tabs and spaces in indentationunindent does not match any outer indentation leveltoo many levels of indentationunexpected character after line continuation characterinvalid character in identifiermultiple statements found while compiling a single statement/builddir/build/BUILD/Python-3.4.10/Python/pythonrun.cPy_Initialize: Unable to get the locale encodingFailed to retrieve builtins moduleFailed to initialize __main__.__builtins__Failed to retrieve BuiltinImporterFailed to initialize __main__.__loader__Py_EndInterpreter: thread is not currentPy_EndInterpreter: thread still has a framePy_EndInterpreter: not the last threadPy_Initialize: can't import _frozen_importlibimport _frozen_importlib # frozen Py_Initialize: couldn't get _frozen_importlib from sys.modulesPy_Initialize: can't import impPy_Initialize: can't save _imp to sys.modulesPy_Initialize: importlib install failedFailed to import the site module python: Can't reopen .pyc file python: failed to set __main__.__loader__ Py_NewInterpreter: call Py_Initialize firstPy_Initialize: can't set preliminary stderrPy_Initialize: can't initialize sys standard streamsPy_Initialize: can't make first interpreterPy_Initialize: can't make first threadPy_Initialize: can't init framesPy_Initialize: can't init longsPy_Initialize: can't init bytearrayPy_Initialize: can't init floatPy_Initialize: can't make modules dictionaryPy_Initialize: can't initialize unicodePy_Initialize: can't initialize structseqPy_Initialize: can't initialize builtins modulesPy_Initialize: can't initialize builtins dictPy_Initialize: can't initialize sysPy_Initialize: can't initialize sys dictPy_Initialize: can't initialize faulthandlerPy_Initialize: unable to load the file system codecPy_Initialize: can't import signalPy_Initialize: can't initialize tracemalloc'import warnings' failed; traceback: �W���W���T��8V���V��X��V���V���V���V���V��W���W���W���W���W���W��python3gettimeofday()ftime()timestamp out of range for platform time_t���ư>����MbP?e��A��.Anegative argument not allowedgetentropy() failedPYTHONHASHSEED must be "random" or an integer in range [0; 4294967295]bad memberdescr typereadonly attributeTruncation of value to charTruncation of value to shortTruncation of value to intbad memberdescr type for %sx���h���X���@�����������������؟�� ������ȟ�������������������؞��0���Ȟ������������$���\��������������������T���������<�����������4�������ģ�������can't delete numeric/char attributeattribute value type must be boolTruncation of value to unsigned charTruncation of value to unsigned shortWriting negative value into unsigned fieldTruncation of value to unsigned int<symtable entry %U(%ld), line %d>duplicate argument '%U' in function definitionname '%U' is parameter and globalname '%U' is nonlocal and globalname '%U' is parameter and nonlocalnonlocal declaration not allowed at module levelno binding for nonlocal '%U' foundimport * only allowed at module levelmaximum recursion depth exceeded during compilationname '%.400s' is assigned to before global declarationname '%.400s' is used prior to global declarationname '%.400s' is assigned to before nonlocal declarationname '%.400s' is used prior to nonlocal declaration/builddir/build/BUILD/Python-3.4.10/Python/symtable.cthis compiler does not handle Suites(Oii)genexprlistcompsetcompdictcomp.%d_[%d]unknown symbol table entrysymtable entrysymbolsoptimizednested,�����ܿ��̿��ľ������D�����������\������̼����������<���ܻ��,���,���,���,���,���|���$���|�������L�������������������X�����X����������������@������� �� �� ����OO!:call_tracingU:interncan't intern %.400si:setrecursionlimitd:setswitchintervali:setcheckintervali:setdlopenflags|i:_getframecall stack is not deep enoughlost builtins moduleno mem for sys.path insertionsys.path.insert(0) failed... truncatedO|O:getsizeofcan't create sys.pathcan't assign sys.pathno mem for sys.argvcan't assign sys.argv__displayhook____excepthook__hexversionCPython(szz)_mercurialdont_write_bytecodeapi_versioncopyrightplatformexecutablebase_prefixbase_exec_prefixmaxsizemaxunicodebuiltin_module_namesabiflags_xoptionsfinalcache_tagimplementationfloat_repr_stylewarnoptionsc_callc_exceptionc_returncpython-34cpythonsys.version_infoMajor release numberMinor release numbermicroPatch release numberreleaselevelserialSerial release numbersys.flags-dinspect-iinteractive-O or -OO-Bno_user_site-sno_site-Signore_environment-Everbose-vbytes_warning-bquiet-qhash_randomization-Risolated-Icallstats_clear_type_cache_current_framesexc_infogetdefaultencodinggetdlopenflagsgetallocatedblocksgetfilesystemencodinggetrefcountgetrecursionlimitgetcheckintervalgetswitchintervalsetprofilegetprofilesettracegettrace_debugmallocstatssys.hash_infowidthmodulusinfnanhash_bitsseed_bitsseed size of hash algorithmcutoffsys.getcheckinterval() and sys.setcheckinterval() are deprecated. Use sys.getswitchinterval() instead.filesystem encoding is not initializedrecursion limit must be positiveswitch interval must be strictly positivesys.getcheckinterval() and sys.setcheckinterval() are deprecated. Use sys.setswitchinterval() instead./builddir/build/BUILD/Python-3.4.10/Python/sysmodule.cType %.100s doesn't define __sizeof____sizeof__() should return >= 0Python error: <stdin> is a directory, cannot continue 'alpha', 'beta', 'candidate', or 'release'width of the type used for hashing, in bitsprime number giving the modulus on which the hash function is basedvalue to be used for hash of a positive infinityvalue to be used for hash of a nanmultiplier used for the imaginary part of a complex numbername of the algorithm for hashing of str, bytes and memoryviewsinternal output size of hash algorithmsmall string optimization cutoff-c-mtb_linenotb_lastitb_nexttb_frame[ssss]\x\u\U ... File , line in tracebacklimit File "%U", line %d, in %U Current thread 0xThread 0x (most recent call first): Stack (most recent call first): /builddir/build/BUILD/Python-3.4.10/Python/traceback.cTraceback (most recent call last): unable to get the thread head state----help--version-J is reserved for Jython Unknown option: -%c Argument expected for the -%c option %+.02dINFNANcould not convert string to float: %.200svalue too large to convert to float: %.200s/builddir/build/BUILD/Python-3.4.10/Python/pystrtod.c��������@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@��@���� �����@��@��@��@��@��@��@��@��@��@�����InfinityNaN}��ؗ�Ҝ<3���#�I9=��D��2�����[%Co�d(h��7y�ACn����F��?�O8M20�Hw�Z<�s�Ou�?$@Y@@�@��@j�@��.A�cA�חAe��A _�B�vH7B��mB@�0�B�ļ�B4&�kC��7y�AC�W4vC�Ngm��C=�`�X�C@��x�DP����KD��M��D��7y�AC�����A�5�����?5�5�?�5�����?aCoc���?��`�(��?�y�PD�?<�s�OuFormat specifier missing precisionCannot specify ',' with '\x%x'.Unknown format code '%c' for object of type '%.200s'Unknown format code '\x%x' for object of type '%.200s'Sign not allowed in string format specifierAlternate form (#) not allowed in string format specifier'=' alignment not allowed in string format specifierPrecision not allowed in integer format specifierSign not allowed with integer format specifier 'c'Zero padding is not allowed in complex format specifier'=' alignment flag is not allowed in complex format specifierInvalid format specifierCannot specify ',' with '%c'.non-ascii grouped digitx}���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|��x}��x}��x}���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|��x}��x}��x}���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|���|��
646ansi-x3.4-1968ansi-x3-4-1968ansi-x3.4-1986cp367csasciiibm367iso646-usiso-646.irv-1991iso-ir-6us-asciiunknown dlopen() error./%-.255sPyInit_%.200s.cpython-34m.so.abi3.so/builddir/build/BUILD/Python-3.4.10/Python/dynload_shlib.csem_initsem_destroysem_timedwaitsem_trywaitsem_waitsem_postpthreadsemaphoresys.thread_infoname of the thread implementationname of the lock implementationname and version of the thread libraryposixpwd_sre_codecs_weakref_functools_operator_collectionsitertoolsatexit_stat_locale_iofaulthandler_tracemalloc_symtablexxsubtypegcbuffer overflow in getpath.c's joinpath()Unable to decode path variables in getpath.c: memory error/builddir/build/BUILD/Python-3.4.10Could not find platform independent libraries <prefix> Could not find platform dependent libraries <exec_prefix> Consider setting $PYTHONHOME to <prefix>[:<exec_prefix>] Not enough memory for dynamic PYTHONPATHor home =os.pyLibrbPYTHONPATH:plat-linux/opt/alt/python34lib64/python3.4pyvenv.cfglib64/python00.zipModules/Setuppybuilddir.txtlib64/lib-dynloadrunpy_run_module_as_main<prefix>/pythonX.XPython %s PYTHONNOUSERSITEPYTHONWARNINGS,Python %s on %s PYTHONSTARTUPCould not open PYTHONSTARTUP unable to get sys.path<encoding error><unprintable file name>Could not import runpy module Could not access runpy._run_module_as_main Could not convert module name to unicode Could not create arguments for runpy._run_module_as_main Failed calling sys.__interactivehook__ not enough memory to copy -c argumentusage: %ls [option] ... [-c cmd | -m mod | file | -] [arg] ... Try `python -h' for more information. Options and arguments (and corresponding environment variables): -b : issue warnings about str(bytes_instance), str(bytearray_instance) and comparing bytes/bytearray with str. (-bb: issue errors) -B : don't write .py[co] files on import; also PYTHONDONTWRITEBYTECODE=x -c cmd : program passed in as string (terminates option list) -d : debug output from parser; also PYTHONDEBUG=x -E : ignore PYTHON* environment variables (such as PYTHONPATH) -h : print this help message and exit (also --help) -i : inspect interactively after running script; forces a prompt even if stdin does not appear to be a terminal; also PYTHONINSPECT=x -I : isolate Python from the user's environment (implies -E and -s) -m mod : run library module as a script (terminates option list) -O : optimize generated bytecode slightly; also PYTHONOPTIMIZE=x -OO : remove doc-strings in addition to the -O optimizations -q : don't print version and copyright messages on interactive startup -s : don't add user site directory to sys.path; also PYTHONNOUSERSITE -S : don't imply 'import site' on initialization -u : unbuffered binary stdout and stderr, stdin always buffered; also PYTHONUNBUFFERED=x see man page for details on internal buffering relating to '-u' -v : verbose (trace import statements); also PYTHONVERBOSE=x can be supplied multiple times to increase verbosity -V : print the Python version number and exit (also --version) -W arg : warning control; arg is action:message:category:module:lineno also PYTHONWARNINGS=arg -x : skip first line of source, allowing use of non-Unix forms of #!cmd -X opt : set implementation-specific option file : program read from script file - : program read from stdin (default; interactive mode if a tty) arg ...: arguments passed to program in sys.argv[1:]
Other environment variables: PYTHONSTARTUP: file executed on interactive startup (no default) PYTHONPATH : '%c'-separated list of directories prefixed to the default module search path. The result is sys.path. PYTHONHOME : alternate <prefix> directory (or <prefix>%c<exec_prefix>). The default module search path uses %s. PYTHONCASEOK : ignore case in 'import' statements (Windows). PYTHONIOENCODING: Encoding[:errors] used for stdin/stdout/stderr. PYTHONFAULTHANDLER: dump the Python traceback on fatal errors. PYTHONHASHSEED: if this variable is set to 'random', a random value is used to seed the hashes of str, bytes and datetime objects. It can also be set to an integer in the range [0,4294967295] to get hash values with a predictable seed. not enough memory to copy PYTHONWARNINGSType "help", "copyright", "credits" or "license" for more information.Unable to decode the command from the command line: %ls: '%ls' is a directory, cannot continue %ls: can't open file '%s': [Errno %d] %s bBc:dEhiIJm:OqRsStuvVW:xX:?__main__�����������������������������������������������������������������������������h���P������������������������������@������0��������������������������������������������������ȩ�����������uncollectablecollected{snsnsn}(iii)gc: %s <%s %p> gc: done, %.4fs elapsedgarbage collection{sisnsn}i:set_debuginvalid generationi|ii:set_thresholdgarbageDEBUG_STATSDEBUG_COLLECTABLEDEBUG_UNCOLLECTABLEDEBUG_SAVEALLDEBUG_LEAK %s disableisenabledget_debugget_countget_thresholdcollectget_objectsget_statsis_trackedget_referrersget_referentsgc: collecting generation %d... gc: objects in each generation:gc: done, %zd unreachable, %zd uncollectablegc couldn't create gc.garbage listunexpected exception during garbage collectiongc: %zd uncollectable objects at shutdowngc: %zd uncollectable objects at shutdown; use gc.set_debug(gc.DEBUG_UNCOLLECTABLE) to list them/builddir/build/BUILD/Python-3.4.10/Modules/gcmodule.cUnhandled exception in thread started by can't specify a timeout for a non-blocking calltimeout value must be strictly positiveInternal lock count overflowedCouldn't get thread-state dictionaryInitialization arguments are not supportedsize must be 0 or a positive valuesetting stack size not supportedcannot release un-acquired lockoptional 3rd arg must be a dictionary/builddir/build/BUILD/Python-3.4.10/Modules/_threadmodule.cblockingtimeout|id:acquiretimeout value is too large<%s owner=%ld count=%lu>thread.local.%pcan't allocate lockrelease unlocked lock|n:stack_sizesize not valid: %zd bytesno current thread identkl(kl):_acquire_restorecouldn't acquire lockstart_new_threadfirst arg must be callable2nd arg must be a tuplecan't start new threadTIMEOUT_MAXLockType_localdummy_destroyedstart_newallocate_lockexit_threadinterrupt_mainget_ident_set_sentinel_thread._localThread-local data_thread._localdummyThread-local dummy_thread.RLock_is_owned_release_save_thread.locklocked_lock쵠�ƠBException ignored when trying to write to the signal wakeup fd: signal number %ld out of rangesignal only works in main threadsignal handler must be signal.SIG_IGN, signal.SIG_DFL, or a callable objectset_wakeup_fd only works in main threaderrno associated with this signalreal user ID of sending processOO:sigtimedwaittimeout must be non-negativeO:sigwaitiO:signalsignal number out of rangei:alarmi:set_wakeup_fdinvalid fdi:getsignalO:sigwaitinfoii:siginterrupti:getitimerid|d:setitimerSIG_DFLSIG_IGNNSIGSIG_BLOCKSIG_UNBLOCKSIG_SETMASKdefault_int_handlerSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGIOTSIGABRTSIGFPESIGKILLSIGBUSSIGSEGVSIGSYSSIGPIPESIGALRMSIGTERMSIGUSR1SIGUSR2SIGCLDSIGCHLDSIGPWRSIGIOSIGURGSIGWINCHSIGSTOPSIGTSTPSIGCONTSIGTTINSIGTTOUSIGVTALRMSIGPROFSIGXCPUSIGXFSZSIGRTMINSIGRTMAXITIMER_REALITIMER_VIRTUALITIMER_PROFsignal.ItimerErroriO:pthread_sigmaskli:pthread_killpausesigpendingsignal.struct_siginfosi_signosignal numbersi_codesignal codesi_errnosi_pidsending process IDsi_uidsi_statusexit value or signalsi_bandband event for SIGPOLLuid should be integer, not %.200sgid should be integer, not %.200sargument should be %s, not %.200s%s%scan't specify None for %s argument%s%sillegal type for %s parameter%s%sembedded NUL character in %ssetgroups argument must be a sequenceunable to determine login namecould not allocate a large enough CPU setexpected an iterator of ints, but iterator yielded %Rexecve: argv must be a tuple or listexecve: environment must be a mapping objectenv.keys() or env.values() is not a listexecv() arg 2 must be a tuple or listexecv() arg 2 must not be emptysymlink: src and dst must be the same typelink: src and dst must be the same type%s: cannot use fd and follow_symlinks togetherutime: you may specify either 'times' or 'ns' but not bothutime: 'times' must be either a tuple of two ints or Noneutime: 'ns' must be a tuple of two ints%s: can't specify dir_fd without matching path%s: can't specify both dir_fd and fdLoad averages are unobtainablemust have a sched_param objectconfiguration names must be strings or integersunrecognized configuration namestrerror() argument out of rangereadv() arg 2 must be a sequencestat_float_times() is deprecated%s: src and dst must be the same type%s: cannot use dir_fd and follow_symlinks together%s%s%s unavailable on this platformwritev() arg 2 must be a sequencewidth of the terminal window in charactersheight of the terminal window in charactersSC_THREAD_DESTRUCTOR_ITERATIONSCS_XBS5_ILP32_OFFBIG_LINTFLAGSCS_XBS5_LPBIG_OFFBIG_LINTFLAGSelapsed time since an arbitrary point in the pastname of machine on network (implementation-defined)integer time of last modificationtime of last access in nanosecondstime of last modification in nanosecondstime of last change in nanosecondsuid is less than minimumuid is greater than maximumgid is less than minimumgid is greater than maximumfd is greater than maximumfd is less than minimumO:sched_paramO&:minorO&:majori:get_inheritablei:WIFEXITEDi:WIFSIGNALEDi:WIFSTOPPEDi:WCONTINUEDi:WCOREDUMPstring, bytes or integeri:WSTOPSIGi:WTERMSIGi:WEXITSTATUSO&:confstrO&:unsetenvO&O&:putenv%s=%sii:makedev(ii)ii:closerangei:isattyiiOn:sendfileiiO&:preadii:readiOi:lseekii|i:dup2i:dupi:device_encodingresourceNiNii:wait4i:wait3too many groupsgroups must be integersi:sched_getaffinityO&|iO&$O&:mknodO&O&:pathconfO&O&:truncateO&|i$O&:mkfifoO&i|i$O&:openiO:sched_setaffinitynegative CPU numberCPU number too largei:sched_getparamO&OO:execveO&O:execvi:_exitO&|$O&:unlinkO&:systemsrcdstO&O&|i$O&:symlinkO&|$O&:rmdirO&|$O&:readlinkO&|i$O&:mkdirO&O&|O&O&p:linkO&O&O&:lchownO&:chdir|O&$p:listxattrO&O&|$p:removexattrO&O&|$p:getxattrO&O&y*|i$p:setxattrfollow_symlinksO&|O$OO&p:utimei:fstatvfsO&:statvfsii:set_inheritableO&:sysconfO&O&O&:setresgidO&O&O&:setresuidn:urandomdddiO&:fpathconfsched_priority out of rangei:strerroriO&O&i:posix_fadviseiO&O&:posix_fallocateiO&:ftruncatei:closeiy*O&:pwriteiO:readviy*:writeiiO&:lockfii:tcsetpgrpi:tcgetpgrpii:setpgidi:getsidiiiNii:getpgidO&O&:initgroupsO&:setgidO&O&:setregidO&:setegidO&:seteuidO&:setuidii:killpgii:kill(Ni)iiO&:sched_setscheduleriO&:sched_setparami:sched_rr_get_intervali:sched_getscheduleri:sched_get_priority_mini:sched_get_priority_maxi:umask|i:stat_float_timesrenamei:nice|O&:listdiriO&O&:fchownii:fchmodi:ttynameO&i|$O&pp:accessO&:chrootO&i|$O&p:chmodO&O&:setreuidii:waitpidiO:writevO&O&O&|$O&p:chowniii:waitidi:fstatO&|$O&:lstatO&|$O&p:statsO&:getgrouplistF_OKR_OKW_OKTMP_MAXWNOHANGWUNTRACEDO_RDONLYO_WRONLYO_RDWRO_NDELAYO_NONBLOCKO_APPENDO_DSYNCO_RSYNCO_SYNCO_NOCTTYO_CREATO_EXCLO_LARGEFILEO_PATHO_TMPFILEPRIO_PROCESSPRIO_PGRPPRIO_USERO_CLOEXECO_ACCMODESEEK_HOLESEEK_DATAO_ASYNCO_DIRECTO_DIRECTORYO_NOFOLLOWO_NOATIMEEX_OKEX_USAGEEX_DATAERREX_NOINPUTEX_NOUSEREX_NOHOSTEX_UNAVAILABLEEX_SOFTWAREEX_OSERREX_OSFILEEX_CANTCREATEX_IOERREX_TEMPFAILEX_PROTOCOLEX_NOPERMEX_CONFIGST_RDONLYST_NOSUIDST_NODEVST_NOEXECST_SYNCHRONOUSST_MANDLOCKST_WRITEST_APPENDST_NOATIMEST_NODIRATIMEST_RELATIMEPOSIX_FADV_NORMALPOSIX_FADV_SEQUENTIALPOSIX_FADV_RANDOMPOSIX_FADV_NOREUSEPOSIX_FADV_WILLNEEDPOSIX_FADV_DONTNEEDP_PIDP_PGIDP_ALLWEXITEDWNOWAITWSTOPPEDCLD_EXITEDCLD_DUMPEDCLD_TRAPPEDCLD_CONTINUEDF_LOCKF_TLOCKF_ULOCKF_TESTSCHED_OTHERSCHED_FIFOSCHED_RRSCHED_BATCHSCHED_IDLESCHED_RESET_ON_FORKXATTR_CREATEXATTR_REPLACEXATTR_SIZE_MAXRTLD_LAZYRTLD_NOWRTLD_GLOBALRTLD_LOCALRTLD_NODELETERTLD_NOLOADRTLD_DEEPBINDconfstr_namessysconf_namesposix.times_resultposix.waitid_resultos.stat_resultos.statvfs_resultposix.sched_paramposix.uname_result_have_functionspathconf_namesenvironeffective_idssrc_dir_fddst_dir_fdtarget_is_directorystruct_rusagefd2devicesched_priorityHAVE_FACCESSATHAVE_FCHDIRHAVE_FCHMODHAVE_FCHMODATHAVE_FCHOWNHAVE_FCHOWNATHAVE_FEXECVEHAVE_FDOPENDIRHAVE_FPATHCONFHAVE_FSTATATHAVE_FSTATVFSHAVE_FTRUNCATEHAVE_FUTIMENSHAVE_FUTIMESHAVE_FUTIMESATHAVE_LINKATHAVE_LCHOWNHAVE_LSTATHAVE_LUTIMESHAVE_MKDIRATHAVE_MKFIFOATHAVE_MKNODATHAVE_OPENATHAVE_READLINKATHAVE_RENAMEATHAVE_SYMLINKATHAVE_UNLINKATHAVE_UTIMENSATctermidgetcwdgetcwdbgetprioritysetpriorityunamesched_yieldopenptyforkptygetegidgeteuidgetgidgetgroupsgetpidgetppidgetuidgetloginsetgroupssetsidpipepipe2fchdirfsyncfdatasyncWIFCONTINUEDabortgetloadavggetresuidgetresgidget_terminal_sizecpu_countos.terminal_sizecolumnsSC_2_CHAR_TERMSC_2_C_BINDSC_2_C_DEVSC_2_C_VERSIONSC_2_FORT_DEVSC_2_FORT_RUNSC_2_LOCALEDEFSC_2_SW_DEVSC_2_UPESC_2_VERSIONSC_AIO_LISTIO_MAXSC_AIO_MAXSC_AIO_PRIO_DELTA_MAXSC_ARG_MAXSC_ASYNCHRONOUS_IOSC_ATEXIT_MAXSC_AVPHYS_PAGESSC_BC_BASE_MAXSC_BC_DIM_MAXSC_BC_SCALE_MAXSC_BC_STRING_MAXSC_CHARCLASS_NAME_MAXSC_CHAR_BITSC_CHAR_MAXSC_CHAR_MINSC_CHILD_MAXSC_CLK_TCKSC_COLL_WEIGHTS_MAXSC_DELAYTIMER_MAXSC_EQUIV_CLASS_MAXSC_EXPR_NEST_MAXSC_FSYNCSC_GETGR_R_SIZE_MAXSC_GETPW_R_SIZE_MAXSC_INT_MAXSC_INT_MINSC_IOV_MAXSC_JOB_CONTROLSC_LINE_MAXSC_LOGIN_NAME_MAXSC_LONG_BITSC_MAPPED_FILESSC_MB_LEN_MAXSC_MEMLOCKSC_MEMLOCK_RANGESC_MEMORY_PROTECTIONSC_MESSAGE_PASSINGSC_MQ_OPEN_MAXSC_MQ_PRIO_MAXSC_NGROUPS_MAXSC_NL_ARGMAXSC_NL_LANGMAXSC_NL_MSGMAXSC_NL_NMAXSC_NL_SETMAXSC_NL_TEXTMAXSC_NPROCESSORS_CONFSC_NPROCESSORS_ONLNSC_NZEROSC_OPEN_MAXSC_PAGESIZESC_PAGE_SIZESC_PASS_MAXSC_PHYS_PAGESSC_PIISC_PII_INTERNETSC_PII_INTERNET_DGRAMSC_PII_INTERNET_STREAMSC_PII_OSISC_PII_OSI_CLTSSC_PII_OSI_COTSSC_PII_OSI_MSC_PII_SOCKETSC_PII_XTISC_POLLSC_PRIORITIZED_IOSC_PRIORITY_SCHEDULINGSC_REALTIME_SIGNALSSC_RE_DUP_MAXSC_RTSIG_MAXSC_SAVED_IDSSC_SCHAR_MAXSC_SCHAR_MINSC_SELECTSC_SEMAPHORESSC_SEM_NSEMS_MAXSC_SEM_VALUE_MAXSC_SHARED_MEMORY_OBJECTSSC_SHRT_MAXSC_SHRT_MINSC_SIGQUEUE_MAXSC_SSIZE_MAXSC_STREAM_MAXSC_SYNCHRONIZED_IOSC_THREADSSC_THREAD_ATTR_STACKADDRSC_THREAD_ATTR_STACKSIZESC_THREAD_KEYS_MAXSC_THREAD_PRIORITY_SCHEDULINGSC_THREAD_PRIO_INHERITSC_THREAD_PRIO_PROTECTSC_THREAD_PROCESS_SHAREDSC_THREAD_SAFE_FUNCTIONSSC_THREAD_STACK_MINSC_THREAD_THREADS_MAXSC_TIMERSSC_TIMER_MAXSC_TTY_NAME_MAXSC_TZNAME_MAXSC_T_IOV_MAXSC_UCHAR_MAXSC_UINT_MAXSC_UIO_MAXIOVSC_ULONG_MAXSC_USHRT_MAXSC_VERSIONSC_WORD_BITSC_XBS5_ILP32_OFF32SC_XBS5_ILP32_OFFBIGSC_XBS5_LP64_OFF64SC_XBS5_LPBIG_OFFBIGSC_XOPEN_CRYPTSC_XOPEN_ENH_I18NSC_XOPEN_LEGACYSC_XOPEN_REALTIMESC_XOPEN_REALTIME_THREADSSC_XOPEN_SHMSC_XOPEN_UNIXSC_XOPEN_VERSIONSC_XOPEN_XCU_VERSIONSC_XOPEN_XPG2SC_XOPEN_XPG3SC_XOPEN_XPG4CS_GNU_LIBC_VERSIONCS_GNU_LIBPTHREAD_VERSIONCS_LFS64_CFLAGSCS_LFS64_LDFLAGSCS_LFS64_LIBSCS_LFS64_LINTFLAGSCS_LFS_CFLAGSCS_LFS_LDFLAGSCS_LFS_LIBSCS_LFS_LINTFLAGSCS_PATHCS_XBS5_ILP32_OFF32_CFLAGSCS_XBS5_ILP32_OFF32_LDFLAGSCS_XBS5_ILP32_OFF32_LIBSCS_XBS5_ILP32_OFF32_LINTFLAGSCS_XBS5_ILP32_OFFBIG_CFLAGSCS_XBS5_ILP32_OFFBIG_LDFLAGSCS_XBS5_ILP32_OFFBIG_LIBSCS_XBS5_LP64_OFF64_CFLAGSCS_XBS5_LP64_OFF64_LDFLAGSCS_XBS5_LP64_OFF64_LIBSCS_XBS5_LP64_OFF64_LINTFLAGSCS_XBS5_LPBIG_OFFBIG_CFLAGSCS_XBS5_LPBIG_OFFBIG_LDFLAGSCS_XBS5_LPBIG_OFFBIG_LIBSPC_ASYNC_IOPC_CHOWN_RESTRICTEDPC_FILESIZEBITSPC_LINK_MAXPC_MAX_CANONPC_MAX_INPUTPC_NAME_MAXPC_NO_TRUNCPC_PATH_MAXPC_PIPE_BUFPC_PRIO_IOPC_SOCK_MAXBUFPC_SYNC_IOPC_VDISABLEPC_ALLOC_SIZE_MINPC_REC_INCR_XFER_SIZEPC_REC_MAX_XFER_SIZEPC_REC_MIN_XFER_SIZEPC_REC_XFER_ALIGNPC_SYMLINK_MAXuser timesystem timechildren_useruser time of childrenchildren_systemsystem time of childrenthe scheduling prioritysysnameoperating system namenodenameoperating system releaseoperating system versionmachinehardware identifierf_bsizef_frsizef_blocksf_bfreef_bavailf_filesf_ffreef_favailf_flagf_namemaxst_modeprotection bitsst_inoinodest_devst_nlinknumber of hard linksst_uiduser ID of ownerst_gidgroup ID of ownerst_sizetotal size, in bytesinteger time of last accessinteger time of last changest_atimest_mtimetime of last modificationst_ctimest_atime_nsst_mtime_nsst_ctime_nsst_blksizeblocksize for filesystem I/Ost_blocksnumber of blocks allocatedst_rdevdevice type (if inode device)���&�.>errorcodeENODEVENOCSIEHOSTUNREACHENOMSGEUCLEANEL2NSYNCEL2HLTENODATAENOTBLKENOSYSEPIPEEINVALEOVERFLOWEADVEINTREUSERSENOTEMPTYENOBUFSEPROTOEREMOTEENAVAILECHILDELOOPEXDEVE2BIGESRCHEMSGSIZEEAFNOSUPPORTEBADREHOSTDOWNEPFNOSUPPORTENOPROTOOPTEBUSYEWOULDBLOCKEBADFDEDOTDOTEISCONNENOANOESHUTDOWNECHRNGELIBBADENONETEBADEEBADFEMULTIHOPEUNATCHEPROTOTYPEENOSPCENOEXECEALREADYENETDOWNENOTNAMEACCESELNRNGEILSEQENOTDIRENOTUNIQEPERMEDOMEXFULLECONNREFUSEDEISDIREPROTONOSUPPORTEROFSEADDRNOTAVAILEIDRMECOMMESRMNTEREMOTEIOEL3RSTEBADMSGENFILEELIBMAXESPIPEENOLINKENETRESETETIMEDOUTENOENTEEXISTEDQUOTENOSTREBADSLTEBADRQCELIBACCEFAULTEFBIGEDEADLKENOTCONNEDESTADDRREQELIBSCNENOLCKEISNAMECONNABORTEDENETUNREACHESTALEENOSRENOMEMENOTSOCKESTRPIPEEMLINKERANGEELIBEXECEL3HLTECONNRESETEADDRINUSEEOPNOTSUPPEREMCHGEAGAINENAMETOOLONGENOTTYERESTARTESOCKTNOSUPPORTETIMEEBFONTEDEADLOCKETOOMANYREFSEMFILEETXTBSYEINPROGRESSENXIOENOPKGENOMEDIUMEMEDIUMTYPEECANCELEDENOKEYEKEYEXPIREDEKEYREVOKEDEKEYREJECTEDEOWNERDEADENOTRECOVERABLEERFKILLENOTSUPU:getpwnamO&:getpwuidgetpwuid(): uid not foundgetpwuid(): uid not found: %Sgetpwallpwd.struct_passwdpw_nameuser namepw_passwdpasswordpw_uiduser idpw_gidgroup idpw_gecosreal namepw_dirhome directorypw_shellshell programgetpwnam(): name not found: %s�����������A���A���A���A���A���A���A���p���A���A���A���A���A���A���`���H���������������������������t�����������������T���̝��T���l���l���̜�������������������������������������������������,���L������4�����������Ԩ���d����������T���t������������������������������������������������ܿ��Ŀ��,�����������������������������������������������������������������������������������������(���A���������"��H��a�����������<���������t�����������������������������������������������������T��������������D���������������������������L����������������<��������������4�����������l��D�������������<�����������l��D��������\�����D��������l�����T��������������������\��d����������4��4��D�������T��������4�������������������(��T��������T����d��<��t��T�����$��|��d����d�����^�g��2�T���������������t�[���������������������������������L�������L���\�����������������D�����������������������������������d�<��������t�L�4���$�����������d��������T�����������������������������������������������L���|���|�������,���\�������<����������������L���,������,�������D��l��������|��������������������������^�����<�����������������������������������������������T�����������t������ �� �� �� �� �� �� �� �� ��� ��� ��\ �� �� �� �� �� �� �� ��L �� �� �� �� �� �� ��< ����������������d��<����������,����������������������,�������,#���#���������������#������#���#���"���!���!��� ��4!��d!��d!��t!����D�����$ ��� ��d#���#���#��<�����#����x��������,�����T�����������������d���������)���)���)��*���(�����^(���)���(���'��#���)��t=���=���=���=���=���=���=���=���=��L=��,=���<���=���=���=���=���=���=���=���<���=���=���=���=���=���=��=���<���?���?���?���A���A���A��|A��\A���@���@��l@��L>��,>���=��T=���>���>��@��4G��ZG��ZG��ZG��ZG��ZG��ZG��ZG��ZG��G���F���F��ZG��ZG��ZG��ZG��ZG��ZG��ZG���F��ZG��ZG��ZG��ZG��ZG��ZG���F���F��K���J���J���J���J��jJ��GJ��$J���I��VI��-I���H���H���H��$H��DG���F��9K���L���L���L���L���L���L���L���L���L���L���L��lL���L���L���L���L���L���L���L��\L���L���L���L���L���L���L��TL��<L���O���O���O���O��iO��FO��#O��O��dP���P���N���N���N��dN���M���L���L��P��
!"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~cannot deepcopy this match objectcannot deepcopy this pattern objectcannot copy this pattern objectmaximum recursion limit exceededinternal error in regular expression engineArgument given by name ('%s') and position (1)The '%s' keyword parameter name is deprecated. Use 'string' instead.Required argument 'string' (pos 1) not foundregular expression code size limit exceeded<%s object; span=(%d, %d), match=%.50R>can't use a string pattern on a bytes-like objectcan't use a bytes pattern on a string-like objectcannot copy this match object0x%xre.compile(%.200R, %S)re.compile(%.200R)expected string or bufferBuffer is NULLspanno such groupOiO!|nOOinvalid SRE code_expand|O:groupdict|O:groups|Onn$O:scanner|Onn$O:fullmatchpattern|Onn$O:match|Onn$O:search|Onn$O:findall|On$O:split_subxNnOO|n:subnOO|n:subMAGICCODESIZEMAXREPEATre.TEMPLATEre.IGNORECASEre.LOCALEre.MULTILINEre.DOTALLre.UNICODEre.VERBOSEre.DEBUGre.ASCIIendposreplgetcodesizegetlower_sre.SRE_Scanner_sre.SRE_Matchlastindexlastgroupregs__copy____deepcopy___sre.SRE_Patterngroupindexfinditers:lookup_errorOns*|z:readbuffer_encodeU:charmap_buildy*|zO:charmap_decodeO|zO:charmap_encodey*|z:ascii_decodeO|z:ascii_encodey*|z:latin_1_decodeO|z:latin_1_encodeO|z:raw_unicode_escape_encodeO|z:unicode_internal_decodeO|z:unicode_internal_encodes*|z:unicode_escape_decodeO|z:unicode_escape_encodey*|zii:utf_32_ex_decodeOniy*|zi:utf_32_be_decodey*|zi:utf_32_le_decodey*|zi:utf_32_decodeO|z:utf_32_be_encodeO|z:utf_32_le_encodeO|zi:utf_32_encodey*|zii:utf_16_ex_decodey*|zi:utf_16_be_decodey*|zi:utf_16_le_decodey*|zi:utf_16_decodeO|z:utf_16_be_encodeO|z:utf_16_le_encodeO|zi:utf_16_encodey*|zi:utf_7_decodeO|z:utf_7_encodey*|zi:utf_8_decodeO|z:utf_8_encodes#|z:escape_decodeO!|z:escape_encodestring is too large to encodeO|ss:decodeO|ss:encodes:lookups:_forget_codecsO:register_errorraw_unicode_escape_decodes*|z:raw_unicode_escape_decodeReferenceTypeCallableProxyTypegetweakrefcountgetweakrefsWeak-reference support module.O:cmp_to_keyO:KreduceO(O)(OOOO)%U, %R%U, %U=%R%s(%R%U)mycmpfunctools.KeyWrapperfunctools.partialother argument must be K instancereduce() arg 2 must support iterationreduce() of empty sequence with no initial valuetype 'partial' takes at least one argumentthe first argument must be callableValue wrapped by a key function.function object to use in future partial callstuple of arguments to future partial callsdictionary of keyword arguments to future partial callsmethodcaller needs at least one argument, the method nameattribute name must be a stringcomparing strings with non-ASCII characters is not supportedunsupported operand types(s) or combination of types: '%.100s' and '%.100s'Buffer must be single dimensiontruth(a) -- Return True if a is true, False otherwise.contains(a, b) -- Same as b in a (note reversed operands).indexOf(a, b) -- Return the first index of b in a.countOf(a, b) -- Return the number of times b occurs in a.is_not(a, b) -- Same as a is not b.index(a) -- Same as a.__index__()floordiv(a, b) -- Same as a // b.truediv(a, b) -- Same as a / b.lshift(a, b) -- Same as a << b.rshift(a, b) -- Same as a >> b.a = iadd(a, b) -- Same as a += b.a = isub(a, b) -- Same as a -= b.a = imul(a, b) -- Same as a *= b.a = ifloordiv(a, b) -- Same as a //= b.a = itruediv(a, b) -- Same as a /= ba = imod(a, b) -- Same as a %= b.a = ilshift(a, b) -- Same as a <<= b.a = irshift(a, b) -- Same as a >>= b.a = iand(a, b) -- Same as a &= b.a = ixor(a, b) -- Same as a ^= b.a = ior(a, b) -- Same as a |= b.concat(a, b) -- Same as a + b, for a and b sequences.a = iconcat(a, b) -- Same as a += b, for a and b sequences.getitem(a, b) -- Same as a[b].setitem(a, b, c) -- Same as a[b] = c.delitem(a, b) -- Same as del a[b].a = ipow(a, b) -- Same as a **= b.is_notis_itemgetter()attrgetter()op_getitemO|n:length_hintOO:compare_digestop_geop_gtop_neop_eqop_leop_ltipowop_iconcatop_concatop_iorop_ixorop_iandop_irshiftop_ilshiftop_imodop_itruedivop_ifloordivop_imulop_isubop_iaddop_or_op_xorop_and_op_rshiftop_lshiftop_modop_truedivop_floordivop_mulop_subop_addcountOfindexOfop_containsop_delitemop_setitemoperator.methodcalleroperator.attrgetteroperator.itemgettertruthis_(a, b) -- Same as a is b.add(a, b) -- Same as a + b.sub(a, b) -- Same as a - b.mul(a, b) -- Same as a * b.mod(a, b) -- Same as a % b.negneg(a) -- Same as -a.pos(a) -- Same as +a.abs(a) -- Same as abs(a).invinv(a) -- Same as ~a.invertinvert(a) -- Same as ~a.not_not_(a) -- Same as not a.and_(a, b) -- Same as a & b.xor(a, b) -- Same as a ^ b.or_(a, b) -- Same as a | b.pow(a, b) -- Same as a ** b.lt(a, b) -- Same as a<b.le(a, b) -- Same as a<=b.eq(a, b) -- Same as a==b.ne(a, b) -- Same as a!=b.gt(a, b) -- Same as a>b.ge(a, b) -- Same as a>=b._compare_digestdeque index out of rangedefaultdict(%U, %U)O(O)O(OO)OO(On)O_count_elementsO!|ndeque(%R, maxlen=%zd)deque(%R)pop from an empty deque|n:rotatemaxlen|OO:dequemaxlen must be non-negative_deque_reverse_iteratordefault_factorycollections.defaultdict_collections._deque_iteratorappendleftextendleftpopleftcollections.dequefirst argument must be callable or Nonedeque mutated during iterationcannot add more blocks to the dequedeque mutated during remove().deque.remove(x): x not in dequeFactory for default value called by __missing__()._collections._deque_reverse_iteratormaximum size of a deque or None if unboundedt��i��Z��K��<�����O!iIndex out of rangeOO!OInvalid argumentsO|nn must be >= 0O(ONO)O(())(Oi)ONOO(OO)lO(O)(Oi)O|O:groupbyOO:compressO|O:accumulateO|n:repeat|n:productrepeat argument too larger must be non-negativeOn:combinationsinvalid argumentsO|O:permutationsExpected int as rO!O!fillvalue|OO:counta number is requiredfilterfalse()starmap()islice()takewhile()dropwhile()cycle()chain()O(OO)(OOO)O(n)O()(OO)O()(O)len() of unsized objectrepeat(%R)repeat(%R, %zd)OONO(()n)O(On)(NN)O(Nn)nO(OnNn)nO(On)Ncount(%zd)count(%R)count(%R, %R)selectorsitertools.zip_longestitertools.repeatitertools.countitertools.filterfalseitertools.compressitertools.accumulateitertools.permutationsitertools.combinationsitertools.productfrom_iterableitertools.chainitertools.starmapitertools.isliceitertools.takewhileitertools.dropwhileitertools.cycleitertools._teeitertools._tee_dataobjectitertools._grouperitertools.groupbyrepeat argument cannot be negativeOn:combinations_with_replacementzip_longest() got an unexpected keyword argumentzip_longest argument #%zd must support iterationStop argument for islice() must be None or an integer: 0 <= x <= sys.maxsize.Indices for islice() must be None or an integer: 0 <= x <= sys.maxsize.Step for islice() must be a positive integer or None.itertools.combinations_with_replacementregister() takes at least 1 argument (0 given)Error in atexit._run_exitfuncs: _clear_run_exitfuncs_ncallbacksmode out of rangeS_IFDIRS_IFCHRS_IFBLKS_IFREGS_IFIFOS_IFLNKS_IFSOCKS_IFDOORS_IFPORTS_IFWHTS_ISUIDS_ISGIDS_ISVTXS_ENFMTS_IREADS_IWRITES_IEXECS_IRWXUS_IRUSRS_IWUSRS_IXUSRS_IRWXGS_IRGRPS_IWGRPS_IXGRPS_IRWXOS_IROTHS_IWOTHS_IXOTHUF_NODUMPUF_IMMUTABLEUF_APPENDUF_OPAQUEUF_NOUNLINKUF_COMPRESSEDUF_HIDDENSF_ARCHIVEDSF_IMMUTABLESF_APPENDSF_NOUNLINKSF_SNAPSHOTST_MODEST_INOST_DEVST_NLINKST_UIDST_GIDST_SIZEST_ATIMEST_MTIMEST_CTIMES_ISDIRS_ISCHRS_ISBLKS_ISREGS_ISFIFOS_ISLNKS_ISSOCKS_ISDOORS_ISPORTS_ISWHTS_IMODES_IFMTfilemodezsizsU:strxfrmUU:strcolli|z:setlocaleunsupported locale settinglocale query failedszi:nl_langinfounsupported langinfo constantint_curr_symbolcurrency_symbolmon_decimal_pointmon_thousands_sepmon_groupingpositive_signnegative_signint_frac_digitsp_cs_precedesp_sep_by_spacen_cs_precedesn_sep_by_spacep_sign_posnn_sign_posnLC_CTYPELC_TIMELC_COLLATELC_MONETARYLC_MESSAGESLC_NUMERICLC_ALLlocale.Errorlocaleconvdgettextdcgettextbindtextdomainbind_textdomain_codesetABDAY_1ABDAY_2ABDAY_3ABDAY_4ABDAY_5ABDAY_6ABDAY_7ABMON_1ABMON_2ABMON_3ABMON_4ABMON_5ABMON_6ABMON_7ABMON_8ABMON_9ABMON_10ABMON_11ABMON_12RADIXCHARTHOUSEPCRNCYSTRAM_STRPM_STRCODESETT_FMT_AMPMERAERA_D_FMTERA_D_T_FMTERA_T_FMTALT_DIGITSYESEXPRNOEXPR_DATE_FMTdomain must be a non-empty stringnewlineclosefdO|sizzziO:openinvalid file: %Rinvalid mode: '%s''U' mode is deprecatedOsiOinvalid buffering sizeunknown mode: '%s'Osssi_bootlocaleDEFAULT_BUFFER_SIZEUnsupportedOperations(OO){}newlinesreadallresetseekabletellcan't use U and writing mode at oncecan't have text and binary mode at oncemust have exactly one of create/read/write/append modebinary mode doesn't take an encoding argumentbinary mode doesn't take an errors argumentbinary mode doesn't take a newline argumentcan't have unbuffered text I/Ocannot fit '%.200s' into an offset-sized integerinteger argument expected, got '%.200s'could not find io module state (interpreter shutdown?) K���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J��HH���J���J���J���J���J���J���J���J���J���J���J��K��K���J���J���J���J���J���J���J���J���J���J���J���J���J���J���J��PH���J���J���J���J���J��pJ��|O&:readlines|O&:readlineread() should return bytes|n:readI/O operation on closed file.O:writelines_finalizing_io._RawIOBase_io._IOBase_checkClosed_checkSeekable_checkReadable_checkWritable__IOBase_closedpeek() should have returned a bytes object, not '%.200s'read() should have returned a bytes object, not '%.200s'File or stream is not seekable.File or stream is not readable.File or stream is not writable.xb+xbab+rb+cannot serialize '%s' objectunclosed file %RFile not open for %sI/O operation on closed file|O&writingO|siO:fileionegative file descriptorinvalid mode: %.200s(is)expected integer from openerO|iy*w*<_io.FileIO [closed]><_io.FileIO fd=%d mode='%s'>_dealloc_warn_io.FileIOunbounded read returned more bytes than a Python bytes object can holdMust have exactly one of create/read/write/append mode and at most one plusCannot use closefd=False with file name<_io.FileIO name=%R mode='%s'>True if the file descriptor will be closed by close().n|i:seeknegative seek value %zdnew position too large|O:read|O:readline|O:readlinesnew buffer size too large|O:truncatenegative size value %zdinitial_bytes|O:BytesIO(OnN)_io._BytesIOBuffer_io.BytesIOgetbuffergetvalueTrue if the file is closed.invalid whence (%i, should be 0, 1 or 2)integer argument expected, got '%s'deallocated BytesIO object has exported buffers%.200s.__setstate__ argument should be 3-tuple, got %.200ssecond item of state must be an integer, not %.200sposition value cannot be negativethird item of state should be a dict, got a %.200sdetachw*:readintocan't allocate read lockbuffer_sizeO|n:BufferedReaderO|n:BufferedWriterOO|n:BufferedRWPairO|n:BufferedRandomraw stream has been detached<%s><%s name=%R>reentrant call inside %Risnflush of closed fileO|i:seekwhence value %d unsupportedseek of closed filewrite to closed filereadline of closed filepeek of closed file|n:peekn:read1read length must be positiveread of closed file|O&:readreadall() should return bytes_io.BufferedRandom_io.BufferedRWPair_io.BufferedWriter_io.BufferedReader_io._BufferedIOBaseRaw stream returned invalid position %zdbuffer size must be strictly positiveI/O operation on uninitialized objectthe BufferedRWPair object is being garbage-collectedcould not acquire lock for %A at interpreter shutdown, possibly due to daemon threadswrite could not complete without blockingraw write() returned invalid length %zd (should have been between 0 and %zd)raw readinto() returned invalid length %zd (should have been between 0 and %zd)readline() should have returned a bytes object, not '%.200s'read length must be positive or -1
sss(OK)line_bufferingwrite_throughO|zzzii:fileioillegal newline value: %scodecs.open()<_io.TextIOWrapper name=%R mode=%R%U encoding=%R>((OK))((yi))y#(y#i)yinegative seek position %RiyU:writenot writableO|i:IncrementalNewlineDecodernot readable|n:readline_CHUNK_SIZE_io.IncrementalNewlineDecoder_io._TextIOBasegetpreferredencodingOi|O:IncrementalNewlineDecodercould not determine default encodingunderlying buffer has been detacheddecoder should return a string result, not '%.200s'a strictly positive integer is requiredunderlying stream is not seekabletelling position disabled by next() callcan't reconstruct logical file positioncan't do nonzero cur-relative seekscan't do nonzero end-relative seeksinvalid whence (%d, should be 0, 1 or 2)underlying read() should have returned a bytes object, not '%.200s'can't restore logical file positionIncrementalNewlineDecoder.__init__ not calledunderlying %s() should have returned a bytes object, not '%.200s'decoder getstate() should have returned a bytes object, not '%.200s'readline() should have returned an str object, not '%.200s'D����������������$�����Invalid whence (%i, should be 0, 1 or 2)Can't do nonzero cur-relative seeksnewline must be str or None, not %.200sinitial_value must be str or None, not %.200sstring argument expected, got '%s'%.200s.__setstate__ argument should be 4-tuple, got %.200sthird item of state must be an integer, got %.200sfourth item of state should be a dict, got a %.200sNegative seek position %zdinitial_value|OO:__init__illegal newline value: %RNegative size value %zd(OOnN)_io.StringIOOlllllllnegative data sizecan't read Zip file: %Rbad local file header in %Uzipimport: can't read datazlib# zipimport: zlib %s availableU:zipimporter.get_data%U%sU:zipimporter.is_packagecan't find module %RU:zipimporter.get_source%U%c__init__.py%U.py# trying %U%c%U bad pyc data# %R has bad magic # %R has bad mtime U:zipimporter.get_filenameU:zipimporter.get_codeU:zipimporter.load_module%U%c%U%U[N]%U%U%cU|O:zipimporter.find_moduleO[]O[O]<zipimporter object "???"><zipimporter object "%U%c%U"><zipimporter object "%U">cp437can't open Zip file: %Rnot a Zip file: %R%U%c%UNhllnhhlzipimporter()O&:zipimporterarchive path is emptynot a Zip filezipimport.ZipImportError_zip_directory_cachedecompresszipimport.zipimporterarchivefind_loaderzipimport: can not open file %Ucan't decompress data; zlib not availablecompiled module %R is not a code objectzipimport: no memory to allocate source bufferimport %U # loaded from Zip %U /builddir/build/BUILD/Python-3.4.10/Modules/zipimport.cbootstrap issue: python%i%i.zip contains non-ASCII filenames without the unicode flag# zipimport: found %ld names in %R
unable to raise a stack overflow (allocated %zu bytes on the stack, %zu recursive calls)file.fileno() is not a valid file descriptorsignal %i cannot be registered, use enable() insteadunable to get the current thread statetimeout must be greater than 0Timeout (%lu:%02lu:%02lu.%06lu)! unable to start watchdog thread/builddir/build/BUILD/Python-3.4.10/Modules/faulthandler.ccould not allocate locks for faulthandlerenable(file=sys.stderr, all_threads=True): enable the fault handlerdisable(): disable the fault handleris_enabled()->bool: check if the handler is enableddump_traceback(file=sys.stderr, all_threads=True): dump the traceback of the current thread, or of all threads if all_threads is True, into filedump_traceback_later(timeout, repeat=False, file=sys.stderrn, exit=False): dump the traceback of all threads in timeout seconds, or each timeout seconds if repeat is True. If exit is True, call _exit(1) which is not safe.cancel_dump_traceback_later(): cancel the previous call to dump_traceback_later().register(signum, file=sys.stderr, all_threads=True, chain=False): register an handler for the signal 'signum': dump the traceback of the current thread, or of all threads if all_threads is True, into fileunregister(signum): unregister the handler of the signal 'signum' registered by register()_read_null(): read from NULL, raise a SIGSEGV or SIGBUS signal depending on the platform_sigsegv(release_gil=False): raise a SIGSEGV signal_sigabrt(): raise a SIGABRT signal_sigfpe(): raise a SIGFPE signal_sigbus(): raise a SIGBUS signal_sigill(): raise a SIGILL signal_fatal_error(message): call Py_FatalError(message)_stack_overflow(): recursive call to raise a stack overflowy:fatal_error|i:_read_nullunable to get sys.stderrsys.stderr is NoneFatal Python error: i:unregisteri|Oii:register|Oi:enable|Oi:dump_tracebackd|iOi:dump_traceback_laterTimeout (%lu:%02lu:%02lu)! PYTHONFAULTHANDLERall_threadssignumis_enabledcancel_dump_traceback_later_sigsegv_sigabrt_sigfpe_sigbus_sigill_fatal_error_stack_overflowBus errorIllegal instructionFloating point exceptionAbortedSegmentation faultcannot allocate lock|n:startPYTHONTRACEMALLOCis_tracingclear_traces_get_traces_get_object_tracebackget_traceback_limitget_tracemalloc_memoryget_traced_memorythe tracemalloc module has been unloadedthe number of frames must be in range [1; %i]PYTHONTRACEMALLOC: invalid number of frames-X tracemalloc=NFRAME: invalid number of frames?sO&s:symtableDEF_GLOBALDEF_LOCALDEF_PARAMDEF_FREEDEF_FREE_CLASSDEF_IMPORTDEF_BOUNDTYPE_FUNCTIONTYPE_CLASSTYPE_MODULEOPT_IMPORT_STAROPT_TOPLEVELGLOBAL_EXPLICITGLOBAL_IMPLICITCELLSCOPE_OFFSCOPE_MASKsymtable() arg 3 must be 'exec' or 'eval' or 'single'Return symbol and scope dictionaries used internally by compiler.i:setstateOS|i:getstatebenchxxsubtype.spamdictgetstate() -> statesetstate(state)xxsubtype.spamlistclassmethclassmeth(*args, **kw)staticmethstaticmeth(*args, **kw)an int variable for demonstration purposes__hello____phello____phello__.spamc@s�dZd�Zdd�Zdd�Zdd �Zd d�Zdd �Zdd�Zdd�Zdd�Z dd�Z ddd�Zdd�Zdd�Z eej�ZGdd�d�ZiZiZGdd �d e�ZGd!d"�d"�ZGd#d$�d$�ZGd%d&�d&�Zd'd(�Zd)d*�Zd+d,�Zd-jd.d/�d0Zejed/�Z d1Z!d2gZ"d3gZ#d4gZ$d5d6d7�Z%d8d9�Z&d:d;�Z'd<d=�Z(d>d?d@dA�Z)dBdC�Z*dDdE�Z+dFdG�Z,dHdI�Z-dJdK�Z.d5d5d5dLdM�Z/d5d5d5dNdO�Z0dPdPdQdR�Z1dSdT�Z2dUdV�Z3GdWdX�dX�Z4GdYdZ�dZ�Z5d[d5d\d5d]d^�Z6e7�Z8d5d_d5d`e8dadb�Z9d5d5dcdd�Z:Gdedf�df�Z;d5dgdh�Z<Gdidj�dj�Z=Gdkdl�dl�Z>Gdmdn�dn�Z?Gdodp�dp�Z@Gdqdr�dre@�ZAGdsdt�dt�ZBGdudv�dveBeA�ZCGdwdx�dxeBe@�ZDgZEGdydz�dz�ZFGd{d|�d|�ZGGd}d~�d~�ZHGdd��d��ZIGd�d��d��ZJGd�d��d��ZKd�d��ZLd�d��ZMd5d�d��ZNd�d��ZOd�ZPePd�ZQd�d��ZRd�d��ZSd5dPd�d��ZTd�d��ZUd�d��ZVd�d��ZWd5d5fdPd�d��ZXd�d��ZYd�d��ZZd�d��Z[d5S)�aSCore implementation of import.
This module is NOT meant to be directly imported! It has been designed such that it can be bootstrapped into Python as the implementation of import. As such it requires the injection of specific modules and attributes in order to work. One should use importlib as the public-facing version of this module.
�win�cygwin�darwincCs1tjjt�r!dd�}ndd�}|S)NcSs dtjkS)z5True if filenames must be checked case-insensitively.sPYTHONCASEOK)�_osZenviron�rr�<frozen importlib._bootstrap>�_relax_casesz%_make_relax_case.<locals>._relax_casecSsdS)z5True if filenames must be checked case-insensitively.Frrrrrr"s)�sys�platform� startswith�_CASE_INSENSITIVE_PLATFORMS)rrrr�_make_relax_casesrcCst|�d@jdd�S)z*Convert a 32-bit integer to little-endian.l����little)�int�to_bytes)�xrrr�_w_long(srcCstj|d�S)z/Convert 4 bytes in little-endian to an integer.r )r� from_bytes)Z int_bytesrrr�_r_long-srcGstjdd�|D��S)zReplacement for os.path.join().cSs%g|]}|r|jt��qSr)�rstrip�path_separators)�.0�partrrr� <listcomp>4s z_path_join.<locals>.<listcomp>)�path_sep�join)� path_partsrrr� _path_join2srcCs�tt�dkr4|jt�\}}}||fSxEt|�D]7}|tkrA|j|dd�\}}||fSqAWd|fS)z Replacement for os.path.split().�Zmaxsplit�)�lenr� rpartitionr�reversed�rsplit)�pathZfront�_�tailrrrr�_path_split8s r&cCs tj|�S)z~Stat the path.
Made a separate function to make it easier to override in experiments (e.g. cache stat results).
)rZstat)r#rrr� _path_statDsr'cCs:yt|�}Wntk r(dSYnX|jd@|kS)z1Test whether the path is the specified mode type.Fi�)r'�OSError�st_mode)r#�modeZ stat_inforrr�_path_is_mode_typeNs
r+cCs t|d�S)zReplacement for os.path.isfile.i�)r+)r#rrr�_path_isfileWsr,cCs"|stj�}nt|d�S)zReplacement for os.path.isdir.i@)r�getcwdr+)r#rrr�_path_isdir\sr.i�cCs�dj|t|��}tj|tjtjBtjB|d@�}y<tj|d��}|j |�WdQXtj ||�Wn;tk r�ytj|�Wntk r�YnX�YnXdS)z�Best-effort function to write data to a path atomically. Be prepared to handle a FileExistsError if concurrent writing of the temporary file is attempted.z{}.{}i�ZwbN) �format�idrZopenZO_EXCLZO_CREATZO_WRONLY�_io�FileIO�write�replacer(Zunlink)r#�datar*Zpath_tmpZfd�filerrr� _write_atomiccs !
r7cCs_xEddddgD]1}t||�rt||t||��qqW|jj|j�dS)z/Simple substitute for functools.update_wrapper.� __module__�__name__�__qualname__�__doc__N)�hasattr�setattr�getattr�__dict__�update)ZnewZoldr4rrr�_wrapys rAcCstt�|�S)N)�typer)�namerrr�_new_module�srDc@s:eZdZdZdd�Zdd�Zdd�ZdS) � _ManageReloadz?Manages the possible clean-up of sys.modules for load_module().cCs ||_dS)N)�_name)�selfrCrrr�__init__�sz_ManageReload.__init__cCs|jtjk|_dS)N)rFr�modules� _is_reload)rGrrr� __enter__�sz_ManageReload.__enter__cGsPtdd�|D��rL|jrLytj|j=WqLtk rHYqLXndS)Ncss|]}|dk VqdS)Nr)r�argrrr� <genexpr>�sz)_ManageReload.__exit__.<locals>.<genexpr>)�anyrJrrIrF�KeyError)rG�argsrrr�__exit__�s # z_ManageReload.__exit__N)r9r8r:r;rHrKrQrrrrrE�srEc@seZdZdS)�_DeadlockErrorN)r9r8r:rrrrrR�srRc@sReZdZdZdd�Zdd�Zdd�Zdd �Zd d�ZdS) �_ModuleLockz�A recursive lock implementation which is able to detect deadlocks (e.g. thread 1 trying to take locks A then B, and thread 2 trying to take locks B then A). cCsFtj�|_tj�|_||_d|_d|_d|_dS)N�)�_threadZ allocate_lock�lock�wakeuprC�owner�count�waiters)rGrCrrrrH�s z_ModuleLock.__init__cCsXtj�}|j}x<tj|�}|dkr7dS|j}||krdSqWdS)NFT)rU� get_identrX�_blocking_on�get)rG�me�tidrVrrr�has_deadlock�s z_ModuleLock.has_deadlockcCs�tj�}|t|<z�x�|j��|jdksD|j|kr`||_|jd7_dS|j�rtd|��n|jj d�r�|j d7_ nWdQX|jj �|jj�qWWdt|=XdS)z� Acquire the module lock. If a potential deadlock is detected, a _DeadlockError is raised. Otherwise, the lock is always acquired and True is returned. rTrTzdeadlock detected by %rFN)rUr[r\rVrYrXr`rRrW�acquirerZ�release)rGr_rrrra�s
z_ModuleLock.acquirec Cs�tj�}|j��|j|kr4td��n|jdksIt�|jd8_|jdkr�d|_|jr�|jd8_|jj �q�nWdQXdS)Nzcannot release un-acquired lockrTr) rUr[rVrX�RuntimeErrorrY�AssertionErrorrZrWrb)rGr_rrrrb�s z_ModuleLock.releasecCsdj|jt|��S)Nz_ModuleLock({!r}) at {})r/rCr0)rGrrr�__repr__�sz_ModuleLock.__repr__N) r9r8r:r;rHr`rarbrerrrrrS�s rSc@sFeZdZdZdd�Zdd�Zdd�Zdd �Zd S)�_DummyModuleLockzVA simple _ModuleLock equivalent for Python builds without multi-threading support.cCs||_d|_dS)NrT)rCrY)rGrCrrrrH�s z_DummyModuleLock.__init__cCs|jd7_dS)NrT)rY)rGrrrra�sz_DummyModuleLock.acquirecCs1|jdkrtd��n|jd8_dS)NrTzcannot release un-acquired lockr)rYrc)rGrrrrb�sz_DummyModuleLock.releasecCsdj|jt|��S)Nz_DummyModuleLock({!r}) at {})r/rCr0)rGrrrre�sz_DummyModuleLock.__repr__N)r9r8r:r;rHrarbrerrrrrf�s rfc@s4eZdZdd�Zdd�Zdd�ZdS)�_ModuleLockManagercCs||_d|_dS)N)rF�_lock)rGrCrrrrHs z_ModuleLockManager.__init__c Cs5zt|j�|_Wdtj�X|jj�dS)N)�_get_module_lockrFrh�_imp�release_lockra)rGrrrrKsz_ModuleLockManager.__enter__cOs|jj�dS)N)rhrb)rGrP�kwargsrrrrQsz_ModuleLockManager.__exit__N)r9r8r:rHrKrQrrrrrg�srgcs�d}yt��}Wntk r+YnX|dkr�tdkrSt��}nt��}�fdd�}tj||�t�<n|S)zmGet or create the module lock for a given module name.
Should only be called with the import lock taken.Ncst�=dS)N)� _module_locks)r$)rCrr�cb sz_get_module_lock.<locals>.cb)rmrOrUrfrS�_weakrefZref)rCrVrnr)rCrris ricCsGt|�}tj�y|j�Wntk r8YnX|j�dS)aRelease the global import lock, and acquires then release the module lock for a given module name. This is used to ensure a module is completely initialized, in the event it is being imported by another thread.
Should only be called with the import lock taken.N)rirjrkrarRrb)rCrVrrr�_lock_unlock_module%s
rpcOs |||�S)a.remove_importlib_frames in import.c will always remove sequences of importlib frames that end with a call to this function
Use it instead of a normal call in places where including the importlib frames introduces unwanted noise into the traceback (e.g. when executing module code) r)�frPZkwdsrrr�_call_with_frames_removed9srri��r s Z__pycache__z.pyz.pycz.pyoNcCs�|dkrtjjn|}|r.t}nt}t|�\}}|jd�\}}}tjj} | dkr�t d��ndj |r�|n||| |dg�} t|t| �S)a�Given the path to a .py file, return the path to its .pyc/.pyo file.
The .py file does not need to exist; this simply returns the path to the .pyc/.pyo file calculated as if the .py file were imported. The extension will be .pyc unless sys.flags.optimize is non-zero, then it will be .pyo.
If debug_override is not None, then it must be a boolean and is used in place of sys.flags.optimize.
If sys.implementation.cache_tag is None then NotImplementedError is raised.
N�.z$sys.implementation.cache_tag is NonerrT) r�flags�optimize�DEBUG_BYTECODE_SUFFIXES�OPTIMIZED_BYTECODE_SUFFIXESr&r �implementation� cache_tag�NotImplementedErrorrr�_PYCACHE)r#Zdebug_override�debug�suffixes�headr%�base�sep�restZtag�filenamerrr�cache_from_source�s +r�cCs�tjjdkr!td��nt|�\}}t|�\}}|tkrltdjt|���n|jd�dkr�tdj|���n|j d�d}t ||td�S)ayGiven the path to a .pyc./.pyo file, return the path to its .py file.
The .pyc/.pyo file does not need to exist; this simply returns the path to the .py file calculated to correspond to the .pyc/.pyo file. If path does not conform to PEP 3147 format, ValueError will be raised. If sys.implementation.cache_tag is None then NotImplementedError is raised.
Nz$sys.implementation.cache_tag is Nonez%{} not bottom-level directory in {!r}rtrszexpected only 2 dots in {!r}rT)rryrzr{r&r|� ValueErrorr/rY� partitionr�SOURCE_SUFFIXES)r#rZpycache_filenameZpycacheZ base_filenamerrr�source_from_cache�s r�cCs�t|�dkrdS|jd�\}}}|sQ|j�dd�dkrU|Syt|�}Wn(ttfk r�|dd �}YnXt|�r�|S|S) z�Convert a bytecode file path to a source path (if possible).
This function exists purely for backwards-compatibility for PyImport_ExecCodeModuleWithFilenames() in the C API.
rTNrt�rZpy������r�)rr �lowerr�r{r�r,)� bytecode_pathr�r$Z extension�source_pathrrr�_get_sourcefile�s#r�cCs<yt|�j}Wntk r-d}YnX|dO}|S)z3Calculate the mode permissions for a bytecode file.i��)r'r)r()r#r*rrr� _calc_mode�s
r�� verbosityrcGsQtjj|krM|jd�s.d|}nt|j|�dtj�ndS)z=Print the message to stderr if -v/PYTHONVERBOSE is turned on.�#�import z# r6N)r�r�)rru�verboser �printr/�stderr)�messager�rPrrr�_verbose_messages r�cs&d�fdd�}t|��|S)z�Decorator to verify that the module being requested matches the one the loader can handle.
The first argument (self) must define _name which the second argument is compared against. If the comparison fails then ImportError is raised.
NcsS|dkr|j}n(|j|kr@td|d|��n�||||�S)Nzloader cannot handle %srC)rC�ImportError)rGrCrPrl)�methodrr�_check_name_wrappers z(_check_name.<locals>._check_name_wrapper)rA)r�r�r)r�r�_check_names r�cs#�fdd�}t|��|S)z1Decorator to verify the named module is built-in.cs:|tjkr-tdj|�d|��n�||�S)Nz{!r} is not a built-in modulerC)r�builtin_module_namesr�r/)rG�fullname)�fxnrr�_requires_builtin_wrapper"sz4_requires_builtin.<locals>._requires_builtin_wrapper)rA)r�r�r)r�r�_requires_builtin s r�cs#�fdd�}t|��|S)z/Decorator to verify the named module is frozen.cs:tj|�s-tdj|�d|��n�||�S)Nz{!r} is not a frozen modulerC)rj� is_frozenr�r/)rGr�)r�rr�_requires_frozen_wrapper-sz2_requires_frozen.<locals>._requires_frozen_wrapper)rA)r�r�r)r�r�_requires_frozen+s r�cCsW|j|�\}}|dkrSt|�rSd}tj|j|d�t�n|S)z�Try to find a loader for the specified module by delegating to self.find_loader().
This method is deprecated in favor of finder.find_spec().
r�cCs�i}|dk r||d<nd}|dk r>||d<n|dd�}|dd�}|dd�}|tkr�dj||�}td |�t||��nzt|�dkr�d j|�}td |�t|��n=t|�dkr%dj|�}td |�t|��n|dk r�yt|d�} Wntk rYYnAXt|�| kr�d j|�}td |�t||��ny|dd@} Wntk r�Yq�Xt|�| kr�td j|�|��q�n|dd�S)azValidate the header of the passed-in bytecode against source_stats (if given) and returning the bytecode that can be compiled by compile().
All other arguments are used to enhance error reporting.
ImportError is raised when the magic number is incorrect or the bytecode is found to be stale. EOFError is raised when the data is found to be truncated.
NrCz <bytecode>r#r��zbad magic number in {!r}: {!r}z{}z+reached EOF while reading timestamp in {!r}z0reached EOF while reading size of source in {!r}�mtimezbytecode is stale for {!r}�sizel��) �MAGIC_NUMBERr/r�r�r�EOFErrorrrOr)r5�source_statsrCr#Zexc_detailsZmagicZ raw_timestampZraw_sizer��source_mtime�source_sizerrr�_validate_bytecode_headerWsL
r�cCsstj|�}t|t�rNtd|�|dk rJtj||�n|Stdj|�d|d|��dS)z<Compile bytecode as returned by _validate_bytecode_header().zcode object from {!r}NzNon-code object in {!r}rCr#) �marshalZloads� isinstance� _code_typer�rjZ_fix_co_filenamer�r/)r5rCr�r��coderrr�_compile_bytecode�s r�rTcCsLtt�}|jt|��|jt|��|jtj|��|S)zPCompile a code object into bytecode for writing out to a byte-compiled file.)� bytearrayr��extendrr�Zdumps)r�r�r�r5rrr�_code_to_bytecode�s r�cCsYddl}tj|�j}|j|�}tjdd�}|j|j|d��S)zyDecode bytes representing source code and return the string.
Universal newline support is used in the decoding. rTNT)�tokenizer1ZBytesIOZreadlineZdetect_encodingZIncrementalNewlineDecoder�decode)�source_bytesr�Zsource_bytes_readline�encodingZnewline_decoderrrr� decode_source�s r�c#Cst|dd�}t|d�rJy|j|�SWqJtk rFYqJXny |j}Wntk rkYnX|dk r�t|�j�Sy |j}Wntk r�d}YnXy |j}Wn;tk r�|dkr�dj |�Sdj ||�SYnXdj ||�SdS)N� __loader__�module_repr�?z <module {!r}>z<module {!r} ({!r})>z<module {!r} from {!r}>) r>r<r�� Exception�__spec__�AttributeErrorr�r9�__file__r/)r�r�r�rCr�rrr�_module_repr�s.
r�c@s4eZdZdd�Zdd�Zdd�ZdS)�_installed_safelycCs||_|j|_dS)N)�_moduler��_spec)rGr�rrrrH�s z_installed_safely.__init__cCs&d|j_|jtj|jj<dS)NT)r�� _initializingr�rrIrC)rGrrrrK�sz_installed_safely.__enter__cGsyze|j}tdd�|D��rNytj|j=Wqdtk rJYqdXntd|j|j�Wdd|j_XdS)Ncss|]}|dk VqdS)Nr)rrLrrrrM�sz-_installed_safely.__exit__.<locals>.<genexpr>zimport {!r} # {!r}F) r�rNrrIrCrOr�r�r�)rGrPr�rrrrQ�s z_installed_safely.__exit__N)r9r8r:rHrKrQrrrrr��sr�c@s�eZdZdZdddddddd�Zdd �Zd d�Zedd ��Zej dd ��Zedd��Z edd��Zej dd��ZdS)� ModuleSpeca�The specification for a module, used for loading.
A module's spec is the source for information about the module. For data associated with the module, including source, use the spec's loader.
`name` is the absolute name of the module. `loader` is the loader to use when loading the module. `parent` is the name of the package the module is in. The parent is derived from the name.
`is_package` determines if the module is considered a package or not. On modules this is reflected by the `__path__` attribute.
`origin` is the specific location used by the loader from which to load the module, if that information is available. When filename is set, origin will match.
`has_location` indicates that a spec's "origin" reflects a location. When this is True, `__file__` attribute of the module is set.
`cached` is the location of the cached bytecode file, if any. It corresponds to the `__cached__` attribute.
`submodule_search_locations` is the sequence of path entries to search when importing submodules. If set, is_package should be True--and False otherwise.
Packages are simply modules that (may) have submodules. If a spec has a non-None value in `submodule_search_locations`, the import system will consider modules loaded from the spec as packages.
Only finders (see importlib.abc.MetaPathFinder and importlib.abc.PathEntryFinder) should modify ModuleSpec instances.
�originN�loader_state� is_packagecCsO||_||_||_||_|r0gnd|_d|_d|_dS)NF)rCr�r�r��submodule_search_locations� _set_fileattr�_cached)rGrCr�r�r�r�rrrrHs zModuleSpec.__init__cCs�dj|j�dj|j�g}|jdk rO|jdj|j��n|jdk rz|jdj|j��ndj|jjdj|��S)Nz name={!r}zloader={!r}zorigin={!r}zsubmodule_search_locations={}z{}({})z, ) r/rCr�r��appendr�� __class__r9r)rGrPrrrre"szModuleSpec.__repr__cCs�|j}yk|j|jkor|j|jkor|j|jkor||jkor|j|jkor|j|jkSWntk r�dSYnXdS)NF)r�rCr�r��cached�has_locationr�)rG�other�smslrrr�__eq__,s zModuleSpec.__eq__cCs�|jdkr�|jdk r�|jr�|j}|jtt��rpyt|�|_Wq�tk rlYq�Xq�|jtt��r�||_q�q�n|jS)N) r�r�r��endswith�tupler�r�r{�BYTECODE_SUFFIXES)rGr�rrrr�8s zModuleSpec.cachedcCs ||_dS)N)r�)rGr�rrrr�FscCs.|jdkr#|jjd�dS|jSdS)z The name of the module's parent.NrtrT)r�rCr )rGrrr�parentJszModuleSpec.parentcCs|jS)N)r�)rGrrrr�RszModuleSpec.has_locationcCst|�|_dS)N)�boolr�)rG�valuerrrr�Vs)r9r8r:r;rHrer��propertyr��setterr�r�rrrrr��s# r�r�r�cCs�t|d�rS|dkr+t|d|�S|r7gnd}t|d|d|�S|dkr�t|d�r�y|j|�}Wq�tk r�d}Yq�Xq�d}nt||d|d|�S)z5Return a module spec based on various loader methods.�get_filenameNr�r�r�Fr�)r<�spec_from_file_locationr�r�r�)rCr�r�r�Zsearchrrrr�[s r�r�r�c Csn|dkrOd}t|d�rOy|j|�}WqLtk rHYqLXqOnt||d|�}d|_|dkr�xOt�D]=\}}|jt|��r�|||�}||_Pq�q�WdSn|t kr&t|d�r/y|j |�}Wntk r Yq#X|r#g|_q#q/n ||_|jgkrj|rjt|�d}|jj |�qjn|S)a=Return a module spec based on a file location.
To indicate that the module is a package, set submodule_search_locations to a list of directory paths. An empty list is sufficient, though its not otherwise useful to the import system.
The loader must take a spec as its only __init__() arg.
r�c@s�eZdZdZdd�Zdd�Zdddd d d�Zdd �Zdd�Zdd�Z dd�Z dd�Zdd�ZdS)r�zMConvenience wrapper around spec objects to provide spec-specific methods.cCs ||_dS)N)r�)rGr�rrrrH�sz_SpecMethods.__init__cCs�|j}|jdkrdn|j}|jdkrh|jdkrRdj|�Sdj||j�Sn2|jr�dj||j�Sdj|j|j�SdS)z&Return the repr to use for the module.Nr�z <module {!r}>z<module {!r} ({!r})>z<module {!r} from {!r}>z<module {!r} ({})>)r�rCr�r�r/r�)rGr�rCrrrr��s z_SpecMethods.module_repr� _overrideF�_force_nameTc;CsK|j}|s-|s-t|dd�dkrUy|j|_WqUtk rQYqUXn|sst|dd�dkr�|j}|dkr�|jdk r�tjt�}|j|_ q�ny ||_ Wq�tk r�Yq�Xn|s�t|dd�dkr#y|j|_Wq#tk rYq#Xny ||_ Wntk rDYnX|sct|dd�dkr�|jdk r�y|j|_Wq�tk r�Yq�Xq�n|jrG|s�t|dd�dkr�y|j|_Wq�tk r�Yq�Xn|s t|dd�dkrG|jdk rDy|j|_WqAtk r=YqAXqDqGndS)aSet the module's attributes.
All missing import-related module attributes will be set. Here is how the spec attributes map onto the module:
z_SpecMethods.init_module_attrscCse|j}t|jd�r0|jj|�}nd}|dkrTt|j�}n|j|�|S)z�Return a new module to be loaded.
The import-related module attributes are also set with the appropriate values from the spec.
� create_moduleN)r�r<r�rrDrCr�)rGr�r�rrr�createKs z_SpecMethods.createcCs|jjj|�dS)z�Do everything necessary to execute the module.
The namespace of `module` is used as the target of execution. This method uses the loader's `exec_module()` method.
N)r�r��exec_module)rGr�rrr�_execbsz_SpecMethods._execcCs|jj}tj�t|���tjj|�|k r_dj|�}t |d|��n|jj dkr�|jjdkr�t dd|jj��n|j|dd�|S|j|dd�t |jj d�s�|jj j|�n |j|�WdQXtj|S)z3Execute the spec in an existing module's namespace.zmodule {!r} not in sys.modulesrCNzmissing loaderr�Tr)r�rCrj�acquire_lockrgrrIr]r/r�r�r�r�r<�load_moduler)rGr�rCr�rrrr�ls
If 'path' is ever specified then the search is considered a failure.
This method is deprecated. Use find_spec() instead.
N)rr�)rr�r#r�rrr�find_module�s zBuiltinImporter.find_modulec Cs;t|��ttj|�}WdQX||_d|_|S)zLoad a built-in module.Nr)rErrrjZinit_builtinr�r�)rr�r�rrrrs
zBuiltinImporter.load_modulecCsdS)z9Return None as built-in modules do not have code objects.Nr)rr�rrr�get_codeszBuiltinImporter.get_codecCsdS)z8Return None as built-in modules do not have source code.Nr)rr�rrr� get_sourceszBuiltinImporter.get_sourcecCsdS)z4Return False as built-in modules are never packages.Fr)rr�rrrr�szBuiltinImporter.is_package)r9r8r:r;�staticmethodr��classmethodrrr�rrrr�rrrrr�s rc@s�eZdZdZedd��Zedddd��Zeddd��Zed d ��Z edd��Z eed d���Zeedd���Z eedd���ZdS)�FrozenImporterz�Meta path import for frozen modules.
All methods are either class or static methods to avoid the need to instantiate the class.
cCsdj|j�S)zsReturn repr for the module.
The method is deprecated. The import machinery does the job itself.
z<module {!r} (frozen)>)r/r9)�mrrrr�/szFrozenImporter.module_reprNcCs*tj|�r"t||dd�SdSdS)Nr�Zfrozen)rjr�r�)rr�r#r rrrr8szFrozenImporter.find_speccCstj|�r|SdS)z]Find a frozen module.
This method is deprecated. Use find_spec() instead.
N)rjr�)rr�r#rrrr?szFrozenImporter.find_modulecCs_|jj}tj|�s9tdj|�d|��nttj|�}t||j �dS)Nz{!r} is not a frozen modulerC) r�rCrjr�r�r/rr�get_frozen_objectr�r?)r�rCr�rrrrHszFrozenImporter.exec_modulecCs t||�S)z_Load a frozen module.
This method is deprecated. Use exec_module() instead.
)r�)rr�rrrrQszFrozenImporter.load_modulecCs tj|�S)z-Return the code object for the frozen module.)rjr)rr�rrrrZszFrozenImporter.get_codecCsdS)z6Return None as frozen modules do not have source code.Nr)rr�rrrr`szFrozenImporter.get_sourcecCs tj|�S)z.Return True if the frozen module is a package.)rjZis_frozen_package)rr�rrrr�fszFrozenImporter.is_package)r9r8r:r;rr�rrrrrr�rrr�rrrrr&s rc@syeZdZdZdZdZdZedd��Zedd��Z ed d d d��Z ed dd ��Zd S)�WindowsRegistryFinderz>Meta path finder for modules declared in the Windows registry.z;Software\Python\PythonCore\{sys_version}\Modules\{fullname}zASoftware\Python\PythonCore\{sys_version}\Modules\{fullname}\DebugFcCsCytjtj|�SWn%tk r>tjtj|�SYnXdS)N)�_winregZOpenKeyZHKEY_CURRENT_USERr(ZHKEY_LOCAL_MACHINE)r�keyrrr�_open_registryys z$WindowsRegistryFinder._open_registrycCs�|jr|j}n |j}|jd|dtjdd��}y.|j|��}tj|d�}WdQXWnt k r�dSYnX|S)Nr�Zsys_versionr�r) �DEBUG_BUILD�REGISTRY_KEY_DEBUG�REGISTRY_KEYr/r�versionrrZ QueryValuer()rr�Zregistry_keyrZhkey�filepathrrr�_search_registry�s z&WindowsRegistryFinder._search_registryNcCs�|j|�}|dkrdSyt|�Wntk rEdSYnXxNt�D]C\}}|jt|��rPt||||�d|�}|SqPWdS)Nr�)r r'r(r�r�r�r�)rr�r#r rr�r~r�rrrr�s zWindowsRegistryFinder.find_speccCs-|j||�}|dk r%|jSdSdS)zlFind module named in the registry.
This method is deprecated. Use exec_module() instead.
N)rr�)rr�r#r�rrrr�sz!WindowsRegistryFinder.find_module)r9r8r:r;rrrrrr rrrrrrrmsrc@s4eZdZdZdd�Zdd�ZeZdS)� _LoaderBasicszSBase class of common code needed by both SourceLoader and SourcelessFileLoader.cCsXt|j|��d}|jdd�d}|jd�d}|dkoW|dkS)z�Concrete implementation of InspectLoader.is_package by checking if the path returned by get_filename has a filename of '__init__.py'.rrtrTrsrH)r&r�r"r )rGr�r�Z filename_baseZ tail_namerrrr��sz_LoaderBasics.is_packagecCsP|j|j�}|dkr9tdj|j���ntt||j�dS)zExecute the module.Nz4cannot load module {!r} when get_code() returns None)rr9r�r/rrr�r?)rGr�r�rrrr�s z_LoaderBasics.exec_moduleN)r9r8r:r;r�rr�rrrrrr!�sr!c@sjeZdZdd�Zdd�Zdd�Zdd�Zd d �Zddd d�Zdd�Z dS)�SourceLoadercCs t�dS)z�Optional method that returns the modification time (an int) for the specified path, where path is a str.
Raises IOError when the path cannot be handled. N)�IOError)rGr#rrr� path_mtime�szSourceLoader.path_mtimecCsi|j|�d6S)a�Optional method returning a metadata dict for the specified path to by the path (str). Possible keys: - 'mtime' (mandatory) is the numeric timestamp of last source code modification; - 'size' (optional) is the size in bytes of the source code.
Implementing this method allows the loader to read bytecode files. Raises IOError when the path cannot be handled. r�)r$)rGr#rrr� path_stats�szSourceLoader.path_statscCs|j||�S)z�Optional method which writes data (bytes) to a file path (a str).
Implementing this method allows for the writing of bytecode files.
The source path is needed in order to correctly transfer permissions )�set_data)rGr�Z cache_pathr5rrr�_cache_bytecode�szSourceLoader._cache_bytecodecCsdS)z�Optional method which writes data (bytes) to a file path (a str).
Implementing this method allows for the writing of bytecode files. Nr)rGr#r5rrrr&�szSourceLoader.set_datacCsi|j|�}y|j|�}Wn:tk r^}ztdd|�|�WYdd}~XnXt|�S)z4Concrete implementation of InspectLoader.get_source.z'source not available through get_data()rCN)r��get_datar(r�r�)rGr�r#r��excrrrr�s zSourceLoader.get_source� _optimizerc Cstt||dddd|�S)z�Return the code object compiled from source.
The 'data' argument can be any object type that compile() supports. r��dont_inheritTrv)rr�compile)rGr5r#r*rrr�source_to_code�szSourceLoader.source_to_codec +Cs�|j|�}d}yt|�}Wntk r?d}Yn�Xy|j|�}Wntk rgYn�Xt|d�}y|j|�}Wntk r�YnjXy"t|d|d|d|�}Wnt t fk r�Yn-Xtd||�t|d|d|d|�S|j|�}|j ||�} td |�tjr�|dk r�|dk r�t| |t|��}y$|j|||�td |�Wq�tk r�Yq�Xn| S)z�Concrete implementation of InspectLoader.get_code.
Reading of bytecode requires path_stats to be implemented. To write bytecode, set_data must also be implemented.
Nr�r�rCr#z {} matches {}r�r�zcode object from {}z wrote {!r})r�r�r{r%r#rr(r(r�r�r�r�r�r-r�dont_write_bytecoder�rr') rGr�r�r�r��str5� bytes_datar�Zcode_objectrrrr�sN
r"cspeZdZdZdd�Zdd�Zdd�Ze�fdd ��Zed d��Z dd �Z �S)� FileLoaderzgBase file loader class which implements the loader protocol methods that require file system usage.cCs||_||_dS)zKCache the module name and the path to the file found by the finder.N)rCr#)rGr�r#rrrrH7s zFileLoader.__init__cCs"|j|jko!|j|jkS)N)r�r?)rGr�rrrr�=szFileLoader.__eq__cCst|j�t|j�AS)N)�hashrCr#)rGrrr�__hash__AszFileLoader.__hash__cstt|�j|�S)zdLoad a module from a file.
This method is deprecated. Use exec_module() instead.
)�superr1r)rGr�)r�rrrDs zFileLoader.load_modulecCs|jS)z:Return the path to the source file as found by the finder.)r#)rGr�rrrr�PszFileLoader.get_filenamecCs)tj|d��}|j�SWdQXdS)z'Return the data from path as raw bytes.�rN)r1r2Zread)rGr#r6rrrr(UszFileLoader.get_data)r9r8r:r;rHr�r3r�rr�r(rr)r�rr12sr1c@s@eZdZdZdd�Zdd�Zdddd �Zd S)r z>Concrete implementation of SourceLoader using the file system.cCs$t|�}i|jd6|jd6S)z!Return the metadata for the path.r�r�)r'�st_mtimeZst_size)rGr#r/rrrr%_szSourceFileLoader.path_statscCs"t|�}|j||d|�S)N�_mode)r�r&)rGr�r�r5r*rrrr'dsz SourceFileLoader._cache_bytecoder7i�c Cs5t|�\}}g}x6|rPt|�rPt|�\}}|j|�qWx�t|�D]v}t||�}ytj|�Wq^tk r�w^Yq^tk r�}zt d||�dSWYdd}~Xq^Xq^Wy!t |||�t d|�Wn5tk r0}zt d||�WYdd}~XnXdS)zWrite bytes data to a file.zcould not create {!r}: {!r}Nzcreated {!r})r&r.r�r!rrZmkdir�FileExistsErrorr(r�r7) rGr#r5r7r�r�rrr)rrrr&is& zSourceFileLoader.set_dataN)r9r8r:r;r%r'r&rrrrr [sr c@s.eZdZdZdd�Zdd�ZdS)rz-Loader which handles sourceless file imports.cCsL|j|�}|j|�}t|d|d|�}t|d|d|�S)NrCr#r�)r�r(r�r�)rGr�r#r5r0rrrr�szSourcelessFileLoader.get_codecCsdS)z'Return None as there is no source code.Nr)rGr�rrrr�szSourcelessFileLoader.get_sourceN)r9r8r:r;rrrrrrr�src@s�eZdZdZdd�Zdd�Zdd�Zedd ��Zd d�Z dd �Z dd�Zedd��ZdS)�ExtensionFileLoaderz]Loader for extension modules.
The constructor is designed to work with FileFinder.
cCs||_||_dS)N)rCr#)rGrCr#rrrrH�s zExtensionFileLoader.__init__cCs"|j|jko!|j|jkS)N)r�r?)rGr�rrrr��szExtensionFileLoader.__eq__cCst|j�t|j�AS)N)r2rCr#)rGrrrr3�szExtensionFileLoader.__hash__cCs�t|��ttj||j�}WdQXtd|j�|j|�}|r|t|d�r|t|j�dg|_ n||_ |j|_|s�|jj d�d|_n|S)zLoad an extension module.Nz!extension module loaded from {!r}r�rTrt)rErrrjZload_dynamicr#r�r�r<r&r�r�r9r�r )rGr�r�r�rrrr�s zExtensionFileLoader.load_modulecs0t|j�d�t�fdd�tD��S)z1Return True if the extension module is a package.rc3s|]}�d|kVqdS)rHNr)r�suffix)� file_namerrrM�sz1ExtensionFileLoader.is_package.<locals>.<genexpr>)r&r#rN�EXTENSION_SUFFIXES)rGr�r)r;rr��szExtensionFileLoader.is_packagecCsdS)z?Return None as an extension module cannot create a code object.Nr)rGr�rrrr�szExtensionFileLoader.get_codecCsdS)z5Return None as extension modules have no source code.Nr)rGr�rrrr�szExtensionFileLoader.get_sourcecCs|jS)z:Return the path to the source file as found by the finder.)r#)rGr�rrrr��sz ExtensionFileLoader.get_filenameN) r9r8r:r;rHr�r3r�rr�rrr�rrrrr9�sr9c@s�eZdZdZdd�Zdd�Zdd�Zdd �Zd d�Zdd �Z dd�Z dd�Zdd�ZdS)�_NamespacePatha&Represents a namespace package's path. It uses the module name to find its parent module, and from there it looks up the parent's __path__. When this changes, the module's own path is recomputed, using path_finder. For top-level modules, the parent module's path is sys.path.cCs4||_||_t|j��|_||_dS)N)rFr�r��_get_parent_path�_last_parent_path�_path_finder)rGrCr#�path_finderrrrrH�s z_NamespacePath.__init__cCs5|jjd�\}}}|dkr+dS|dfS)z>Returns a tuple of (parent-module-name, parent-path-attr-name)rtrrr#r�)zsyszpath)rFr )rGr��dotr^rrr�_find_parent_path_names�sz&_NamespacePath._find_parent_path_namescCs&|j�\}}ttj||�S)N)rCr>rrI)rGZparent_module_nameZpath_attr_namerrrr>�sz_NamespacePath._get_parent_pathcCst|j��}||jkrx|j|j|�}|dk rl|jdkrl|jrl|j|_qln||_n|jS)N)r�r>r?r@rFr�r�r�)rGZparent_pathr�rrr�_recalculate�s z_NamespacePath._recalculatecCst|j��S)N)�iterrD)rGrrr�__iter__�sz_NamespacePath.__iter__cCst|j��S)N)rrD)rGrrr�__len__�sz_NamespacePath.__len__cCsdj|j�S)Nz_NamespacePath({!r}))r/r�)rGrrrresz_NamespacePath.__repr__cCs||j�kS)N)rD)rG�itemrrr�__contains__sz_NamespacePath.__contains__cCs|jj|�dS)N)r�r�)rGrHrrrr�sz_NamespacePath.appendN) r9r8r:r;rHrCr>rDrFrGrerIr�rrrrr=�s
r=c@sjeZdZdd�Zedd��Zdd�Zdd�Zd d �Zdd�Z d d�Z dS)r�cCst|||�|_dS)N)r=r�)rGrCr#rArrrrHsz_NamespaceLoader.__init__cCsdj|j�S)zsReturn repr for the module.
The method is deprecated. The import machinery does the job itself.
z<module {!r} (namespace)>)r/r9)rr�rrrr�sz_NamespaceLoader.module_reprcCsdS)NTr)rGr�rrrr�sz_NamespaceLoader.is_packagecCsdS)Nrr)rGr�rrrrsz_NamespaceLoader.get_sourcecCstddddd�S)Nrz<string>r�r+T)r,)rGr�rrrrsz_NamespaceLoader.get_codecCsdS)Nr)rGr�rrrr!sz_NamespaceLoader.exec_modulecCstd|j�t||�S)zbLoad a namespace module.
This method is deprecated. Use exec_module() instead.
z&namespace module loaded with path {!r})r�r�r�)rGr�rrrr$sz_NamespaceLoader.load_moduleN)r9r8r:rHrr�r�rrrrrrrrr�s r�c@s�eZdZdZedd��Zedd��Zedd��Zedd ��Zed dd��Z ed d d d��Z ed dd��Zd S)� PathFinderz>Meta path finder for sys.path and package __path__ attributes.cCs:x3tjj�D]"}t|d�r|j�qqWdS)z}Call the invalidate_caches() method on all path entry finders stored in sys.path_importer_caches (where implemented).�invalidate_cachesN)r�path_importer_cache�valuesr<rK)r�finderrrrrK5szPathFinder.invalidate_cachescCs^tjstjdt�nx;tjD],}y||�SWq&tk rQw&Yq&Xq&WdSdS)zqSearch sequence of hooks for a finder for 'path'.
If 'hooks' is false then use sys.path_hooks.
zsys.path_hooks is emptyN)r� path_hooksr�r�r�r�)rr#Zhookrrr�_path_hooks=s zPathFinder._path_hookscCsa|dkrtj�}nytj|}Wn.tk r\|j|�}|tj|<YnX|S)z�Get the finder for the path entry from sys.path_importer_cache.
If the path entry is not in the cache, find the appropriate finder and cache it. If no finder is available, store None.
r)rr-rrLrOrP)rr#rNrrr�_path_importer_cacheNs zPathFinder._path_importer_cachecCsqt|d�r'|j|�\}}n|j|�}g}|dk rUt||�St|d�}||_|S)Nr�)r<r�rr�r�r�)rr�rNr�r�r�rrr�_legacy_get_spec_s zPathFinder._legacy_get_specNc Cs�g}x�|D]�}t|ttf�s.q n|j|�}|dk r t|d�rm|j||�}n|j||�}|dkr�q n|jdk r�|S|j}|dkr�t d��n|j |�q q Wt|d�}||_|SdS)z?Find the loader or namespace_path for this module/package name.Nrzspec missing loader)r��str�bytesrQr<rrRr�r�r�r�r�) rr�r#r �namespace_pathZentryrNr�r�rrr� _get_specns( zPathFinder._get_speccCs�|dkrtj}n|j|||�}|dkr=dS|jdkr�|j}|r�d|_t|||j�|_|SdSn|SdS)zbfind the module on sys.path or 'path' based on sys.path_hooks and sys.path_importer_cache.NZ namespace)rr#rVr�r�r�r=)rr�r#r r�rUrrrr�s zPathFinder.find_speccCs)|j||�}|dkr"dS|jS)z�find the module on sys.path or 'path' based on sys.path_hooks and sys.path_importer_cache.
This method is deprecated. Use find_spec() instead.
N)rr�)rr�r#r�rrrr�szPathFinder.find_module)r9r8r:r;rrKrPrQrRrVrrrrrrrJ1srJc@s�eZdZdZdd�Zdd�ZeZdd�Zdd �Z d dd�Z d d�Zedd��Z dd�Zd S)� FileFinderz�File-based finder.
Interactions with the file system are cached for performance, being refreshed when the directory the finder is handling has been modified.
cszg}x4|D],\�}|j�fdd�|D��q W||_|pOd|_d|_t�|_t�|_dS)z�Initialize with the path to search on and a variable number of 2-tuples containing the loader and the file suffixes the loader recognizes.c3s|]}|�fVqdS)Nr)rr:)r�rrrM�sz&FileFinder.__init__.<locals>.<genexpr>rtrNr�)r��_loadersr#�_path_mtime�set�_path_cache�_relaxed_path_cache)rGr#�loader_detailsZloadersr~r)r�rrH�s$ zFileFinder.__init__cCs d|_dS)zInvalidate the directory mtime.rNr�)rY)rGrrrrK�szFileFinder.invalidate_cachescCs;|j|�}|dkr%dgfS|j|jp7gfS)z�Try to find a loader for the specified module, or the namespace package portions. Returns (loader, list-of-portions).
This method is deprecated. Use find_spec() instead.
N)rr�r�)rGr�r�rrrr��s zFileFinder.find_loadercCs(|||�}t||d|d|�S)Nr�r�)r�)rGr�r�r#r�r r�rrrrV�szFileFinder._get_specNcCs�d}|jd�d}y"t|jp1tj��j}Wntk rUd }YnX||jkr{|j�||_nt �r�|j }|j�}n|j}|}||kr3t |j|�}xg|jD]M\} } d| }t ||�}t|�r�|j| |||g|�Sq�Wt|�}nx~|jD]s\} } t |j|| �}tdj|�dd�|| |kr=t|�r�|j| ||d|�Sq=q=W|r�td j|��t|d�} |g| _| SdS)z}Try to find a loader for the specified module, or the namespace package portions. Returns (loader, list-of-portions).FrtrsrrHz trying {}r�Nzpossible namespace for {}r�)r r'r#rr-r6r(rY�_fill_cacherr\r�r[rrXr,rVr.r�r/r�r�)rGr�r Zis_namespaceZtail_moduler�ZcacheZcache_moduleZ base_pathr:r�Z init_filenameZ full_pathr�rrrr�sD"
zFileFinder.find_specc Cs|j}ytj|p!tj��}Wn!tttfk rKg}YnXtjj d�spt |�|_not �}xZ|D]R}|jd�\}}}|r�dj ||j��}n|}|j|�q�W||_tjj t�r dd�|D�|_ndS)zDFill the cache of potential modules and packages for this directory.rrtz{}.{}cSsh|]}|j��qSr)r�)rZfnrrr� <setcomp>*s z)FileFinder._fill_cache.<locals>.<setcomp>N)r#rZlistdirr-�FileNotFoundError�PermissionError�NotADirectoryErrorrrr rZr[r�r/r��addr r\) rGr#ZcontentsZlower_suffix_contentsrHrCrBr:Znew_namerrrr^ s" zFileFinder._fill_cachecs��fdd�}|S)aA class method which returns a closure to use on sys.path_hook which will return an instance using the specified loaders and the path called on the closure.
If the path called on the closure is not a directory, ImportError is raised.
cs.t|�s!tdd|��n�|��S)z-Path hook for importlib.machinery.FileFinder.zonly directories are supportedr#)r.r�)r#)rr]rr�path_hook_for_FileFinder6sz6FileFinder.path_hook.<locals>.path_hook_for_FileFinderr)rr]rdr)rr]r� path_hook,s zFileFinder.path_hookcCsdj|j�S)NzFileFinder({!r}))r/r#)rGrrrre>szFileFinder.__repr__)r9r8r:r;rHrKr�rr�rVrr^rrererrrrrW�s-rWc@s.eZdZdZdd�Zdd�ZdS)�_ImportLockContextz$Context manager for the import lock.cCstj�dS)zAcquire the import lock.N)rjr)rGrrrrKHsz_ImportLockContext.__enter__cCstj�dS)z<Release the import lock regardless of any raised exceptions.N)rjrk)rGZexc_typeZ exc_valueZ exc_tracebackrrrrQLsz_ImportLockContext.__exit__N)r9r8r:r;rKrQrrrrrfDsrfcCs[|jd|d�}t|�|kr7td��n|d}|rWdj||�S|S)z2Resolve a relative module name to an absolute one.rtrz2attempted relative import beyond top-level packagerTz{}.{})r"rr�r/)rC�package�levelZbitsr�rrr� _resolve_nameQs
ricCs/|j||�}|dkr"dSt||�S)N)rr�)rNrCr#r�rrr�_find_spec_legacyZsrjc Cs"tjstjdt�n|tjk}x�tjD]�}t��]y |j}Wn6tk r�t |||�}|dkr�w5nYnX||||�}WdQX|dk r5|r|tjkrtj|}y |j }Wntk r�|SYqX|dkr|S|Sq|Sq5q5WdSdS)zFind a module's loader.zsys.meta_path is emptyN)r� meta_pathr�r�r�rIrfrr�rjr�) rCr#r Z is_reloadrNrr�r�r�rrr� _find_speccs0
rlcCs�t|t�s-tdjt|����n|dkrHtd��n|r�t|t�sltd��q�|tjkr�d}t|j|���q�n|r�|dkr�td��ndS)zVerify arguments are "sane".zmodule name must be str, not {}rTzlevel must be >= 0z__package__ not set to a stringz=Parent module {!r} not loaded, cannot perform relative importzEmpty module nameN) r�rS� TypeErrorr/rBr�rrI�SystemError)rCrgrhr�rrr� _sanity_check�srozNo module named z{!r}cCs4d}|jd�d}|r�|tjkr>t||�n|tjkrXtj|Stj|}y |j}Wq�tk r�tdj||�}t|d|��Yq�Xnt ||�}|dkr�ttj|�d|��nt |�j�}|r0tj|}t||jd�d|�n|S)NrtrTz; {!r} is not a packagerCrs) r rrIrrr�r��_ERR_MSGr/r�rlr�rr=)rC�import_r#r�Z parent_moduler�r�r�rrr�_find_and_load_unlocked�s*
rrc Cs$t|��t||�SWdQXdS)z6Find and load the module, and release the import lock.N)rgrr)rCrqrrr�_find_and_load�s rscCs�t|||�|dkr1t|||�}ntj�|tjkrWt|t�Stj|}|dkr�tj�dj |�}t |d|��nt|�|S)a2Import and return the module based on its name, the package the call is being made from, and the level adjustment.
This function represents the greatest common denominator of functionality between import_module and __import__. This includes setting __package__ if the loader did not.
rTNz(import of {} halted; None in sys.modulesrC)rorirjrrrIrs�_gcd_importrkr/r�rp)rCrgrhr�r�rrrrt�s
rtcCst|d�r�d|krYt|�}|jd�t|d�rY|j|j�qYnx�|D]�}t||�s`dj|j|�}yt||�Wq�tk r�}z5t |�j t�r�|j|kr�w`q�n�WYdd}~Xq�Xq`q`Wn|S)z�Figure out what __import__ should return.
The import_ parameter is a callable which takes the name of module to import. It is required to decouple the function from assuming importlib's import implementation is desired.
rzcCsN|jd�}|dkrJ|d}d|krJ|jd�d}qJn|S)z�Calculate what __package__ should be.
__package__ is not guaranteed to be defined or could be set to None to represent that its proper value is unknown.
r�Nr9r�rtrT)r]r )�globalsrgrrr�_calc___package__�s r|cCs7ttj�f}ttf}ttf}|||gS)z_Returns a list of file-based module loaders.
Each item is a tuple (loader, suffixes). )r9rj�extension_suffixesr r�rr�)Z extensionsZsourceZbytecoderrrr� sr�c Cs�|dkrt|�}n6|dk r-|ni}t|�}t|||�}|s�|dkrzt|jd�d�S|s�|St|�t|jd�d�}tj|jdt|j�|�Snt||t�SdS)a�Import a module.
The 'globals' argument is used to infer where the import is occuring from to handle relative imports. The 'locals' argument is ignored. The 'fromlist' argument specifies what should exist as attributes on the module being imported (e.g. ``from module import <fromlist>``). The 'level' argument represents the package location to import from in a relative import (e.g. ``from ..pkg import mod`` would have a 'level' of 2).
rTNrt)rtr|r�rrrIr9rz) rCr{�localsryrhr�Zglobals_rgZcut_offrrr� __import__ s#(rcCsDtj|�}|dkr.td|��nt|�}|j�S)Nzno built-in module named )rrr�r�r)rCr�r�rrr�_builtin_from_name5 s r�cCs�|a|atjjr!tantatt�}x�tjj �D]y\}}t ||�rC|tjkrvt}ntj |�rCt}nqCt||�}t|�}|j|�qCqCWtjt}xIdD]A} | tjkr�t| �} n tj| } t|| | �q�Wddgfdddgff}x�|D]~\}} td d �| D��slt�| d}|tjkr�tj|}PqAyt|�}PWqAtk r�wAYqAXqAWtd��t|d |�t|d|�t|ddj| ��ytd�}Wntk r2d}YnXt|d|�td�}t|d|�|dkr�td�}t|d|�nt|dt��tjtj��|dkr�tjd�dtkr�dt_ q�ndS)z�Setup importlib by importing needed built-in modules and injecting them into the global namespace.
As sys is needed for sys.modules access and _imp is needed to load built-in modules, those two modules must be explicitly passed in.
ABL�X�eG� I� O A l����E�D v CA���dH V A��h�"HY����"HY����?H r���� ���EAA $����E�N W AEH��0\���A�A�D j AAFLAAL��t�lB�B�D �A(�D0m (D ABBE� (D ABBJ8�����B�E�D �C(�G�} (A ABBAL����F�E�A �A(�L0Q (A ABBH` (A ABBBl�h��Dw E����HT\����T�I�E �B(�A0�A8�F@�8C�0A�(B� B�B�B�W@������@����M�D�D �N ABJM GBJACB D��}Kg F` H\h�\�UA�z ET�����H � H��0�9dT��X�!D\8��p�oE�N�N�r�F�R�A�� AAFL����F�O�I �B(�A0�A8�G�s 8A0A(B BBBJ`�4��H0� J\|���F�O�H �A(�G�r�F�R�A��M�K�A�� (A ABBJ(����E�A�G�� AAA���8���F�F�A �3 ABEV ABGX�\��M��t���������k��h���#RM������ HW������#RM������iE�Z�����D�,�h���TD0J AH�����AJ�m�<d���vO�F�P �F(�F0�n(H BBBC�����@�� ����B�B�E �D(�A0�D@ 0A(A BBBH��|�����x���9VN(������O�F�D }N�C�@����,T����yE�F0R ABp8N@R8A0��`���lDg������9dT����Kdf ������E�D0� AEH�������F�B�I �D(�D0R (C DBBJd(F ABB@<�����G�VR UJAI FAAB pI� G8������lB�B�A �A(�F`4 (A ABBJ�����H f BH��l���dB�B�B �B(�D0�D8�D`Q 8A0A(B BBBAL$�����B�E�D �D(�D0I (D ABBKd (D ABBC4t����F�D�D �U ABJgABH��h���F�B�D �D(�G0R (D ABBFw(D ABB4�����iB�D�D �~ ABEUAB00���bE�D�G [ DAHdDA4d�P��hF�A�D �^ ABDtAB�����7E�f EF0�����=F�A�A �D08 AABH ������Tz BLL�0��NB�B�B �A(�A0�� (A BBBHY (A BBBH`d�0��mB�E�H �B(�A0�D8�DP� 8F0A(B BBBGF 8A0A(B BBBH��<����8�� ��4��H�0��+F�E�E �B(�A0�D8�D`� 8D0A(B BBBBP� ��'HKJ I4p�$ ��|F�B�A �A(�D0d(D ABBH��l ���F�E�G �A(�D0J (D ABBFD(F ABB`��� ��1F�E�E �B(�A0�A8�JP� 8A0A(B BBBHU 8C0A(B BBBA$X�| ��:E�D�G gAA��� �� ��� �� P��� ��hL�E�E �D(�D0�g (A BBBDK(C BBBA�����8��� ���F�B�B �A(�D0�k(D BBB48�� ��tF�B�A �D(�D0X(D ABBPp�D��F�B�B �A(�D0�D@mHCPFHA@� 0A(A BBBF(����WE�K�D@� AAD��D ���E�����+L�W AF,�(��+L�W AF L�8��iE�Q D AE p����iE�Q D AE ������E�N0� AA��|�� ��x��4E�] NC�����4E�] NC(����nF�D�I �r ABH8�����E��GNU���P� �A����X5`��fOl ��?���+���l l l �����l l x�l l l ��l ��E��D��y���l l l l l l l l l l l l l l l l l l l l l l l l ��^9���l s�E�*������]�������l ;�3���l l �����I�0C�l ��E�l ���t�8���*��-������x�l ]�g)� �����*��������>�?��z?��l l �S*/*�l h�����l l l ,���&�E�,&�6�z���l S--�,������X��U�l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l _9SbOʿ����ȿ**!*+*8*B* M*@X*�a*`GhGpG xG �G�G�G ^GfGnGvG~G�G�G�G�G�G�G�G�G�G �G!�G"�G#�G$�G%�G�G�G�G�G�G�G�G�G�G�G�G�GHHGH(=H)SH*H&H'"H*H+5H,9H.CH0OH1YH/dHlHsHl@�[Ho �G�Ro �G_���]o �G�1�A�L�Y�c�����0 ��A�A���o`�X3 M��A���{X5 ���o���oXz���o�o^k���o���A 101@1P1`1p1�1�1�1�1�1�1�1�122 202@2P2`2p2�2�2�2�2�2�2�2�233 303@3P3`3p3�3�3�3�3�3�3�3�344 404@4P4`4p4�4�4�4�4�4�4�4�455 505@5P5`5p5�5�5�5�5�5�5�5�566 606@6P6`6p6�6�6�6�6�6�6�6�677 707@7P7`7p7�7�7�7�7�7�7�7�788 808@8P8`8p8�8�8�8�8�8�8�8�899 909@9P9`9p9�9�9�9�9�9�9�9�9:: :0:@:P:`:p:�:�:�:�:�:�:�:�:;; ;0;@;P;`;p;�;�;�;�;�;�;�;�;<< <0<@<P<`<p<�<�<�<�<�<�<�<�<== =0=@=P=`=p=�=�=�=�=�=�=�=�=>> >0>@>P>`>p>�>�>�>�>�>�>�>�>?? ?0?@?P?`?p?�?�?�?�?�?�?�?�?@@ @0@@@P@`@p@�@�@�@�@�@�@�@�@AA A0A@APA`ApA�A�A�A�A�A�A�A�ABB B0B@BPB`BpB�B�B�B�B�B�B�B�BCC C0C@CPC`CpC�C�C�C�C�C�C�C�CDD D0D@DPD`DpD�D�D�D�D�D�D�D�DEE E0E@EPE`EpE�E�E�E�E�E�E�E�EFF F0F@FPF`FpF�F�F�F�F�F�F�F�FGG G0G@GPG`GpG�G�G�G�G�G�G�G�GHH H0H@HPH`HpH�H�H�H�H�H�H�H�HII I0I@IPI`IpI�I�I�I�I�I�I�I�IJJ J0J@JPJ`JpJ�J�J�J�J�J�J�J�JKK K0K@KPK`KpK�K�K�K�K�K�K�K�KLL L0L@LPL`LpL�L�L�L�L�L�L�L�LMM M0M@MPM`MpM�M�M�M�M�M�M�M�MNN N0N@NPN`NpN�N�N�N�N�N�N�N�NOO O0O@OPO`OpO�O�O�O�O�O�O�O�OPP P0P@PPP`PpP�P�P�P�P�P�P�P�PQQ Q0Q@QPQ`QpQ�Q�Q�Q�Q�Q�Q�Q�QRR R0R@RPR`RpR�R�R�R�R�R�R�R�RSS S0S@SPS`SpS�S�S�S�S�S�S�S�STT T0T@TPT`TpT�T�T�T�T�T�T�T�TUU U0U@UPU`UpU�U�U�U�U�U�U�U�UVV V0V@VPV`VpV�V�V�V�V�V�V�V�VWW W0W@WPW`WpW�W�W�W�W�W�W�W�WXX X0X@XPX`XpX�X�X�X�X�X�X�X�XYY Y0Y@YPY`YpY�Y�Y�Y�Y�Y�Y�Y�YZZ Z0Z@ZPZ`ZpZ�Z�Z�Z�Z�Z�Z�Z�Z[[ [0[@[P[`[p[�[�[�[�[�[�[�[�[\\ \0\@\P\`\p\�\�\�\�\�\�\�\�\]] ]0]@]P]`]p]�]�]�]�]�]�]�]�]^^ ^0^@^P^`^p^�^�^�^�^�^�^�^�^__ _0_@_P_`_p_�_�_�_�_�_�_�_�_`` `0`@`P```p`�`�`�`�`�`�`�`�`aa a0a@aPa`apa�a�a�a�a�a�a�a�abb b0b@bPb`bpb�b�b�b�b�b�b�b�bcc c0c@cPc`cpc�c�c�c�c�c�c�c�cdd d0d@dPd`dpd�d�d�d�d�d�d�d�dee e0e@ePe`epe�e�e�e�e�e�e�e�eff f0f@fPf`fpf�f�f�f�f�f�f�f�fgg g0g@gPg`gpg�g�g�g�g�g�g�g�ghh h0h@hPh`hph�h�h�h�h�h�h�h�hii i0i@iPi`ipi�i�i�i�i�i�i�i�ijj j0j@jPj`jpj�j�j�j�j�j�j�j�jkk k0k@kPk`kpk�k�k�k�k�k�k�k�kll l0l@lPl`lpl�l�l�l�l�l�l�l�lmm m0m@mPm`mpm�m�m�m�m�m�m�m�mnn n0n@nPn`npn�n�n�n�n�n�n�n�noo o0o@oPo`opo�o�o�o�o�o�o�o�opp p0p@pPp`ppp�p�p�p�p�p�p�p�pqq q0q@qPq`qpq�q�q�q�q�q�q�q�qrr r0r@rPr`rpr�r�r�r�r�r�r�r�rss s0s@sPs`sps�s�s�s�s�s�s�s�stt t0t@tPt`tpt�t�t�t�t�t�t�t�tuu u0u@uPu`upu�u�u�u�u�u�u�u�uvv v0v@vPv`vpv�v�v�v�v�v�v�v�vww w0w@wPw`wpw�w�w�w�w�w�w�w�wxx x0x@xPx`xpx�x�x�x�x�x�x�x�xyy y0y@yPy`ypy�y�y�y�y�y�y�y�yzz z0z@zPz`zpz�z�z�z�z�z�z�z�z{{ {0{@{P{`{p{�{�{�{�{�{�{�{�{|| |0|@|P|`|p|�|�|�|�|�|�|�|�|}} }0}@}P}`}p}�}�}�}�}�}�}�}�}~~ ~0~@~P~`~p~�~�~�~�~�~�~�~�~ 0@P`p���������� �0�@�P�`�p�����������Ѐ���� �0�@�P�`�p�����������Ё���� �0�@�P�`�p�����������Ђ���� �0�@�P�`�p�����������Ѓ���� �0�@�P�`�p�����������Є���� �0�@�P�`�p�����������Ѕ���� �0�@�P�`�
Returns True when the argument x is true, False otherwise. The builtins True and False are the only two instances of the class bool. The class bool is a subclass of the class int, and cannot be subclassed.�(���P�� ��:B ��9BМSet state information for unpickling.Private method returning an estimate of len(list(it)).bytearray(iterable_of_ints) -> bytearray bytearray(string, encoding[, errors]) -> bytearray bytearray(bytes_or_buffer) -> mutable copy of bytes_or_buffer bytearray(int) -> bytes array of size given by the parameter initialized with null bytes bytearray() -> empty bytes array
Construct an mutable bytearray object from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - a bytes or a buffer object - any object implementing the buffer API. - an integerB.__sizeof__() -> int
Returns the size of B in memory, in bytesReturn state information for pickling.Return state information for pickling.bytearray.fromhex(string) -> bytearray (static method)
Create a bytearray object from a string of hexadecimal numbers. Spaces between two numbers are accepted. Example: bytearray.fromhex('B9 01EF') -> bytearray(b'\xb9\x01\xef').B.splitlines([keepends]) -> list of lines
Return a list of the lines in B, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.B.join(iterable_of_bytes) -> bytearray
Concatenate any number of bytes/bytearray objects, with B in between each pair, and return the result as a new bytearray.B.__alloc__() -> int
Return the number of bytes actually allocated.B.decode(encoding='utf-8', errors='strict') -> str
Decode B using the codec registered for encoding. Default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that is able to handle UnicodeDecodeErrors.B.rstrip([bytes]) -> bytearray
Strip trailing bytes contained in the argument and return the result as a new bytearray. If the argument is omitted, strip trailing ASCII whitespace.B.lstrip([bytes]) -> bytearray
Strip leading bytes contained in the argument and return the result as a new bytearray. If the argument is omitted, strip leading ASCII whitespace.B.strip([bytes]) -> bytearray
Strip leading and trailing bytes contained in the argument and return the result as a new bytearray. If the argument is omitted, strip ASCII whitespace.B.remove(int) -> None
Remove the first occurrence of a value in B.B.pop([index]) -> int
Remove and return a single item from B. If no index argument is given, will pop the last value.B.extend(iterable_of_ints) -> None
Append all the elements from the iterator or sequence to the end of B.B.append(int) -> None
Append a single item to the end of B.B.insert(index, int) -> None
Insert a single item into the bytearray before the given index.B.reverse() -> None
Reverse the order of the values in B in place.B.rsplit(sep=None, maxsplit=-1) -> list of bytearrays
Return a list of the sections in B, using sep as the delimiter, starting at the end of B and working to the front. If sep is not given, B is split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). If maxsplit is given, at most maxsplit splits are done.B.rpartition(sep) -> (head, sep, tail)
Search for the separator sep in B, starting at the end of B, and return the part before it, the separator itself, and the part after it. If the separator is not found, returns two empty bytearray objects and B.B.partition(sep) -> (head, sep, tail)
Search for the separator sep in B, and return the part before it, the separator itself, and the part after it. If the separator is not found, returns B and two empty bytearray objects.B.split(sep=None, maxsplit=-1) -> list of bytearrays
Return a list of the sections in B, using sep as the delimiter. If sep is not given, B is split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). If maxsplit is given, at most maxsplit splits are done.B.replace(old, new[, count]) -> bytearray
Return a copy of B with all occurrences of subsection old replaced by new. If the optional argument count is given, only the first count occurrences are replaced.B.translate(table[, deletechars]) -> bytearray
Return a copy of B, where all characters occurring in the optional argument deletechars are removed, and the remaining characters have been mapped through the given translation table, which must be a bytes object of length 256.B.endswith(suffix[, start[, end]]) -> bool
Return True if B ends with the specified suffix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. suffix can also be a tuple of bytes to try.B.startswith(prefix[, start[, end]]) -> bool
Return True if B starts with the specified prefix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. prefix can also be a tuple of bytes to try.B.rindex(sub[, start[, end]]) -> int
Like B.rfind() but raise ValueError when the subsection is not found.B.rfind(sub[, start[, end]]) -> int
Return the highest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation.
Return -1 on failure.B.index(sub[, start[, end]]) -> int
Like B.find() but raise ValueError when the subsection is not found.B.copy() -> bytearray
Return a copy of B.B.clear() -> None
Remove all items from B.B.count(sub[, start[, end]]) -> int
Return the number of non-overlapping occurrences of subsection sub in bytes B[start:end]. Optional arguments start and end are interpreted as in slice notation.B.find(sub[, start[, end]]) -> int
Return the lowest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation.
Return -1 on failure.B.zfill(width) -> copy of B
Pad a numeric string B with zeros on the left, to fill a field of the specified width. B is never truncated.B.center(width[, fillchar]) -> copy of B
Return B centered in a string of length width. Padding is done using the specified fill character (default is a space).B.rjust(width[, fillchar]) -> copy of B
Return B right justified in a string of length width. Padding is done using the specified fill character (default is a space)B.ljust(width[, fillchar]) -> copy of B
Return B left justified in a string of length width. Padding is done using the specified fill character (default is a space).B.expandtabs(tabsize=8) -> copy of B
Return a copy of B where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.?���k�7F�7F��4_��k�P� >B4�0� AB���=B �� �P��-� �@��p�@\B�8P����fB�\B��\B`>B��P�@`B @��CB4�@� AB^�@B( ��@B3 -�IB:�6���XB C�,�UBE���UBl��VB�-P�@DBJ��@QBp��ZBS@* IB����VB�@#`ABhb�UB��!�IBZ �b�j��r��z`��0����`� CB�ZBt���@��FB��!�`�MB�� �HB��@HB���@OB�0�@JB�`�TB����SB �p@YB���LB$P��JBi@�FB�)�NB[��`BB���`RBR���GB�0����r� PB�P�B���WB �`�P�p)�p2Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).bytes(iterable_of_ints) -> bytes bytes(string, encoding[, errors]) -> bytes bytes(bytes_or_buffer) -> immutable copy of bytes_or_buffer bytes(int) -> bytes object of size given by the parameter initialized with null bytes bytes() -> empty bytes object
Construct an immutable array of bytes from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - any object implementing the buffer API. - an integerbytes.fromhex(string) -> bytes
Create a bytes object from a string of hexadecimal numbers. Spaces between two numbers are accepted. Example: bytes.fromhex('B9 01EF') -> b'\xb9\x01\xef'.B.splitlines([keepends]) -> list of lines
Return a list of the lines in B, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.B.decode(encoding='utf-8', errors='strict') -> str
Decode B using the codec registered for encoding. Default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registerd with codecs.register_error that is able to handle UnicodeDecodeErrors.B.endswith(suffix[, start[, end]]) -> bool
Return True if B ends with the specified suffix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. suffix can also be a tuple of bytes to try.B.startswith(prefix[, start[, end]]) -> bool
Return True if B starts with the specified prefix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. prefix can also be a tuple of bytes to try.B.replace(old, new[, count]) -> bytes
Return a copy of B with all occurrences of subsection old replaced by new. If the optional argument count is given, only first count occurances are replaced.B.translate(table[, deletechars]) -> bytes
Return a copy of B, where all characters occurring in the optional argument deletechars are removed, and the remaining characters have been mapped through the given translation table, which must be a bytes object of length 256.B.count(sub[, start[, end]]) -> int
Return the number of non-overlapping occurrences of substring sub in string B[start:end]. Optional arguments start and end are interpreted as in slice notation.B.rstrip([bytes]) -> bytes
Strip trailing bytes contained in the argument. If the argument is omitted, strip trailing ASCII whitespace.B.lstrip([bytes]) -> bytes
Strip leading bytes contained in the argument. If the argument is omitted, strip leading ASCII whitespace.B.strip([bytes]) -> bytes
Strip leading and trailing bytes contained in the argument. If the argument is omitted, strip leading and trailing ASCII whitespace.B.rindex(sub[, start[, end]]) -> int
Like B.rfind() but raise ValueError when the substring is not found.B.rfind(sub[, start[, end]]) -> int
Return the highest index in B where substring sub is found, such that sub is contained within B[start:end]. Optional arguments start and end are interpreted as in slice notation.
Return -1 on failure.B.index(sub[, start[, end]]) -> int
Like B.find() but raise ValueError when the substring is not found.B.find(sub[, start[, end]]) -> int
Return the lowest index in B where substring sub is found, such that sub is contained within B[start:end]. Optional arguments start and end are interpreted as in slice notation.
Return -1 on failure.B.join(iterable_of_bytes) -> bytes
Concatenate any number of bytes objects, with B in between each pair. Example: b'.'.join([b'ab', b'pq', b'rs']) -> b'ab.pq.rs'.B.rsplit(sep=None, maxsplit=-1) -> list of bytes
Return a list of the sections in B, using sep as the delimiter, starting at the end of B and working to the front. If sep is not given, B is split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). If maxsplit is given, at most maxsplit splits are done.B.rpartition(sep) -> (head, sep, tail)
Search for the separator sep in B, starting at the end of B, and return the part before it, the separator itself, and the part after it. If the separator is not found, returns two empty bytes objects and B.B.partition(sep) -> (head, sep, tail)
Search for the separator sep in B, and return the part before it, the separator itself, and the part after it. If the separator is not found, returns B and two empty bytes objects.B.split(sep=None, maxsplit=-1) -> list of bytes
Return a list of the sections in B, using sep as the delimiter. If sep is not specified or is None, B is split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). If maxsplit is given, at most maxsplit splits are done.B.zfill(width) -> copy of B
Pad a numeric string B with zeros on the left, to fill a field of the specified width. B is never truncated.B.center(width[, fillchar]) -> copy of B
Return B centered in a string of length width. Padding is done using the specified fill character (default is a space).B.rjust(width[, fillchar]) -> copy of B
Return B right justified in a string of length width. Padding is done using the specified fill character (default is a space)B.ljust(width[, fillchar]) -> copy of B
Return B left justified in a string of length width. Padding is done using the specified fill character (default is a space).B.expandtabs(tabsize=8) -> copy of B
Return a copy of B where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.��k�7F�7F���#4_��k�@7�gB4��=@gB�;gB;p3��p3���3�=PW�# P<@�3p;��Bq�!`3p�@�B�B@;���B�gB9�<�B ��#�8:P�6���|Bl0S qB�-P8 kBJ`>�lB@�B�@B�uB����iBhb�F`uBZ08b8j�7r�7z�7��7�p7��_�vB���@~Bt����rB�`7!���zB�@z oB�K`tB�O�sB ����}B�@wyB$�m�wBi0�rB�)�c�zB[b`jB�P@nBRp�@sB��a��ar`�pB�PaB` |B�`��@� ����B�'��instancemethod(function)
Bind a function to a class.method(function, instance)
Create a code object. Not for the faint of heart.P)�@������B���`�B��B��(���)�)�) ** *((*02*8;*@G*HS*PU�`_*hg*pv*xcomplex(real[, imag]) -> complex number
Create a complex number from a real part and an optional imaginary part. This is equivalent to (real + imag*1j) where imag defaults to 0.complex.__format__() -> str
Convert to a string according to format_spec.complex.conjugate() -> complex
Return the complex conjugate of its argument. (3-4j).conjugate() == 3+4j.�.�.�.�����P��������� �����`��.�-�.�-�.@�@�B�#�e.`��B[. �����B ��� �B@���B �B��property(fget=None, fset=None, fdel=None, doc=None) -> property attribute
fget is a function to be used for getting an attribute value, and likewise fset is a function for setting, and fdel a function for del'ing, an attribute. Typical use is to define a managed attribute x:
class C(object): def getx(self): return self._x def setx(self, value): self._x = value def delx(self): del self._x x = property(getx, setx, delx, "I'm the 'x' property.")
Decorators make defining new properties or modifying existing ones easy:
class C(object): @property def x(self): "I am the 'x' property." return self._x @x.setter def x(self, value): self._x = value @x.deleter def x(self): del self._x Descriptor to change the deleter on a property.Descriptor to change the setter on a property.Descriptor to change the getter on a property.I(,0�<1060�(-0�0�n�nEK�(:0G0�?8�@�B\0��Bc0���B,0�<10 I((z0��(P:0`I(�0`�(4�p-0` X5�0@ �0�n �5�n �5E�6P@0I(�:0P�0@I(�:0PI(0:0PI(�:0P�0 z0�(4�0�/8D��B�@�B��B�B���k0 `�@�@� �B��B��B�/��BP�B @p@�B �08`�!@P@�B��B��B@!�00`�@P��B �B���00`�@P@�B��B��B0`�00`�` @P@�B��B �B��00`��@P@�B��B �B�Set state information for unpickling.Private method returning an estimate of len(list(it)).reversed(sequence) -> reverse iterator over values of the sequence
Return a reverse iteratorenumerate(iterable[, start]) -> iterator for index, value of iterable
Return an enumerate object. iterable must be another object that supports iteration. The enumerate object yields pairs containing a count (from start, which defaults to zero) and a value yielded by the iterable argument. enumerate is useful for obtaining an indexed list: (0, seq[0]), (1, seq[1]), (2, seq[2]), ...Return state information for pickling.l6�b<��*��B4��(�B '��B4��(�BF6 p%D�B`#�'��B�%<60�$D`�B@( )�B�#Exception.with_traceback(tb) -- set self.__traceback__ to tb and return self.�B:@�+DHE@B+@�B2�1��B:@�+DxE@B+@�B2�1@�B:@�+D�E@B+@�B2�1��B�9@�+DXF@B+@�B2�1��B�9@�+D�F@B+@�B2�1 �B�9@�+D�F@B+@�B2�1��B�9@�+D0G@B+@�B2�1`�B�9@�+D`G@B+@�B2�1�B�9@�+D�G@B+@�B2�1��B�9@�+D�G@B+@�B2�1@�B$:@�+DH@B+#C2�1��B�9@�+D_;@B+#C2�1��B�9@pEDm;@B+#C2PR �Bz9@�+D@H@B+#C2�1��Bn9@�+DpH@B+#C2�1`�B\9@�+D I@B+@�B2�1�BN9@�+D`I@B+@�B2�1��B;9@�+D�I@B+@�B2�1@�B+9@�+D�I@B+#C2�1��B9@�+D|;@B+#C2�1��B9h01?D�;E�0`�B`�B=�1 �B�8h01�4D�;E�0`�B`�B@�1��B�8h01�=D�;E�0`�B`�B�;�1�@�;�NH�;<P�;<X <%<`<`�B�8@�+D,<@B+�B2�1�B�8@�+D�I@B+#C2�1��B�8@�+�HDC<@B+��B2@�B�8@�+DZ<@B+��B2�1��B:;@�+Dw<@B+#C2�1��B�8pP0DJ`D@/ �B P �B�8pP0D�<`D@/��B P��B�8pP0`9D�<`D@/`�B#C P�<@�<�>H�>�<P�<�<X�<�<`�<=h�<��B8@�+D=@B+#C2�1 �Bm8@�+D0J@B+��B2�1��Bc8@�+D-=@B+#C2�1`�BO8@�+D`J@B+�B2�1�BB8@�+DF=@B+#C2�1��B98@�+Db=@B+#C2�1@�BF;h�.D{=�C0.�C�L�B3;h�.D�=�C0.�C�L��B#;h�.D�=�C0.�C�L C;h�.D�=�C0.�C�L�C�:h�.D�J�C0.�C�L`C�:h�.D�J�C0.�C�LC�:h�.D�=�C0.�C�L�C�:h�.D�=�C0.�C�L@ C�:h�.D�=�C0.`C�L� C�:h�.D>�C0.`C�L�C�:h�.D>�C0.`C�L Cf:h�.D->�C0.`C�L�Cv:h�.D:>�C0.�C�L`C,:h�.DO>�C0.�C�LC<:h�.Da>�C0.�C�L�CR7h�.ID�J�C0.�C�C@C#C�LpJZ7�M�74� 3��@|>�>H�>�>P�>�>X�>�C�`X�-�HDKpCP-��G`C#C�5�<@�>��H���>P�> C8@�+D�>@B+�%C2�1�C8H-D@KC�,`C�%C�FP)@�>�C�7@�+DhK@B+�%C2�1`C�7Hp,D�K�B0,!C#Cp2?@?`!C�7@�+D?@B+#C2�1#C�7@�+D�K@B+�%C2�1�%C7?84��2�G�?PT��B�7@�+�4`HD@�K@B+%C�$C 'C2�1?��_�SGL?@C�EZ?�UVf?x?�TU�?Return the name of the generator's associated code object.throw(typ[,val[,tb]]) -> raise exception in generator, return next yielded value or raise StopIteration.close() -> raise GeneratorExit inside generator.send(arg) -> send 'arg' into generator, return next yielded value or raise StopIteration.EL=�ZLcLnL �(�� (CKL0����@0�(��`,C�)C`*CUL )CEL`�`(C=�Б�(C�O]� ��O��O���O�OP��O=��4��O�4��O`�4��@�4�]���4��Op�.C`-C ���float(x) -> floating point number
Convert a string or number to a floating point number, if possible.float.__format__(format_spec) -> string
Formats the float according to format_spec.float.__setformat__(typestr, fmt) -> None
You probably don't want to use this function. It exists mainly to be used in Python's test suite.
typestr must be 'double' or 'float'. fmt must be one of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian', and in addition can only be one of the latter two if it appears to match the underlying C reality.
Override the automatic determination of C-level floating point type. This affects how floats are converted to and from binary strings.float.__getformat__(typestr) -> string
You probably don't want to use this function. It exists mainly to be used in Python's test suite.
typestr must be 'double' or 'float'. This function returns whichever of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian' best describes the format of floating point numbers used by the C type named by typestr.float.as_integer_ratio() -> (int, int)
Return a pair of integers, whose ratio is exactly equal to the original float and with a positive denominator. Raise OverflowError on infinities and a ValueError on NaNs.
Create a floating-point number from a hexadecimal string. >>> float.fromhex('0x1.ffffp10') 2047.984375 >>> float.fromhex('-0x1p-1074') -5e-324float.hex() -> string
Return a hexadecimal representation of a floating-point number. >>> (-0.1).hex() '-0x1.999999999999ap-4' >>> 3.14159.hex() '0x1.921f9f01b866ep+1'sys.float_info
A structseq holding information about the float type. It contains low level information about the precision and internal representation. Please study your system's :file:`float.h` for more information.�(� �0���P����� �p�`��� ���P��. ��-�.��-�. ��U����U�PP�V�P0��4C�� 6C���6C�P ��V�#��PЪ@3C�O �@1Ce.���0CQ�7C�;C���VQ�VQ8Wx��W%Q�W-QXOQ8QJQ@XSQ`X[Q�XxQaQ}P0�@��8C0�@�`0C��@:C�9C��F.__sizeof__() -> size of F in memory, in bytesF.clear(): clear most references held by the frameHZ C���>C(��@>CUZ��^Z ���gZ����oZvZ }Z(�Z0�Zx����@P���>C�?C@?Cstaticmethod(function) -> method
Convert a function to be a static method.
A static method does not receive an implicit first argument. To declare a static method, use this idiom:
class C: def f(arg1, arg2, ...): ... f = staticmethod(f)
It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). The instance is ignored except for its class.
Static methods in Python are similar to those found in Java or C++. For a more advanced concept, see the classmethod builtin.classmethod(function) -> method
Convert a function to be a class method.
A class method receives the class as implicit first argument, just like an instance method receives the instance. To declare a class method, use this idiom:
class C: def f(cls, arg1, arg2, ...): ... f = classmethod(f)
It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). The instance is ignored except for its class. If a class method is called for a derived class, the derived class object is passed as the implied first argument.
Class methods are different than C++ or Java static methods. If you want those, see the staticmethod builtin.function(code, globals[, name[, argdefs[, closure]]])
Create a function object from a code object and a dictionary. The optional name string overrides the name from the code object. The optional argdefs tuple specifies the default argument values. The optional closure tuple supplies the bindings for free variables.P)�����_�_�(�(`0I(8#`/`Xi_ P�D�BC�0��HCLC� � G0� ?�]_ �D�DC��� IC NC G0p ?�~dp��`���@@GC` P�IC@PC@�H �_����_ @ �_0 � `p�@ ?��(�� :0�` Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).[` � @� �UC� 0 @� p �UC4�@ �QC�� RC4�` �QC �QCSet state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).list() -> new empty list list(iterable) -> new list initialized from iterable's itemsL.sort(key=None, reverse=False) -> None -- stable sort *IN PLACE*L.reverse() -- reverse *IN PLACE*L.count(value) -> integer -- return number of occurrences of valueL.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.L.remove(value) -> None -- remove first occurrence of value. Raises ValueError if the value is not present.L.pop([index]) -> item -- remove and return item at index (default last). Raises IndexError if list is empty or index is out of range.L.insert(index, object) -- insert object before indexL.extend(iterable) -> None -- extend list by appending elements from the iterableL.append(object) -> None -- append object to endL.copy() -> list -- a shallow copy of LL.clear() -> None -- remove all items from LL.__sizeof__() -- size of L in memory, in bytesL.__reversed__() -- return a reverse iterator over the listx.__getitem__(y) <==> x[y]H� q��� �VC4�[ �VC�" @VC�# �VC4�`[ �VC " @VC pW �R Z Y $ PR P' p icpW H�[Cl6�! �[C(� `[C CP [CE�R �ZC3@, �ZC��( ZCS�$ @ZC�Q `YC��P �XChb `XClP XC�0 �WC�bP? `WCFc �! @` � @\C[c � @� �\C{b( + p, `]C@]CDWC� � p) 0# �]C�' sys.int_info
A struct sequence that holds information about Python's internal representation of integers. The attributes are read only.int(x=0) -> integer int(x, base=10) -> integer
Convert a number or string to an integer, or return 0 if no arguments are given. If x is a number, return x.__int__(). For floating point numbers, this truncates towards zero.
If x is not a number or if base is given, then x must be a string, bytes, or bytearray instance representing an integer literal in the given base. The literal can be preceded by '+' or '-' and be surrounded by whitespace. The base defaults to 10. Valid bases are 0 and 2-36. Base 0 means to interpret the base from the string as an integer literal. >>> int('0b100', base=0) 4int.from_bytes(bytes, byteorder, *, signed=False) -> int
Return the integer represented by the given array of bytes.
The bytes argument must either support the buffer protocol or be an iterable object producing bytes. Bytes and bytearray are examples of built-in objects that support the buffer protocol.
The byteorder argument determines the byte order used to represent the integer. If byteorder is 'big', the most significant byte is at the beginning of the byte array. If byteorder is 'little', the most significant byte is at the end of the byte array. To request the native byte order of the host system, use `sys.byteorder' as the byte order value.
The signed keyword-only argument indicates whether two's complement is used to represent the integer.int.to_bytes(length, byteorder, *, signed=False) -> bytes
Return an array of bytes representing an integer.
The integer is represented using length bytes. An OverflowError is raised if the integer is not representable with the given number of bytes.
The byteorder argument determines the byte order used to represent the integer. If byteorder is 'big', the most significant byte is at the beginning of the byte array. If byteorder is 'little', the most significant byte is at the end of the byte array. To request the native byte order of the host system, use `sys.byteorder' as the byte order value.
The signed keyword-only argument determines whether two's complement is used to represent the integer. If signed is False and a negative integer is given, an OverflowError is raised.int.bit_length() -> int
Number of bits necessary to represent self in binary. >>> bin(37) '0b100101' >>> (37).bit_length() 6%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %%%%%%%
!"#%%%%%%
!"#%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%�lClMlq�ClMl�(TlYl�dC�oCflul�l�i�� `� 0� � 0� `� � � �� �a �� �� �� �� �� @� � �� �� @| � �.� �-�.Ќ �-�l� j�l�� 8j�.� pj�l� �mCl � �jC�k�� �gC�� �j�l� �j�l� �j�P�� k�# � e.@h (�� xk%{a Pt �oC�h Pt eC�j �qCqC@� Return True if the view and the given iterable have a null intersection.Return state information for pickling.Private method returning an estimate of len(list(it)).dict() -> new empty dictionary dict(mapping) -> new dictionary initialized from a mapping object's (key, value) pairs dict(iterable) -> new dictionary initialized as if via: d = {} for k, v in iterable: d[k] = v dict(**kwargs) -> new dictionary initialized with the name=value pairs in the keyword argument list. For example: dict(one=1, two=2)D.values() -> an object providing a view on D's valuesD.items() -> a set-like object providing a view on D's itemsD.keys() -> a set-like object providing a view on D's keysD.copy() -> a shallow copy of DD.clear() -> None. Remove all items from D.D.update([E, ]**F) -> None. Update D from dict/iterable E and F. If E is present and has a .keys() method, then does: for k in E: D[k] = E[k] If E is present and lacks a .keys() method, then does: for k, v in E: D[k] = v In either case, this is followed by: for k in F: D[k] = F[k]D.popitem() -> (k, v), remove and return some (key, value) pair as a 2-tuple; but raise KeyError if D is empty.D.pop(k[,d]) -> v, remove specified key and return the corresponding value. If key is not found, d is returned if given, otherwise KeyError is raisedD.setdefault(k[,d]) -> D.get(k,d), also set D[k]=d if k not in DD.get(k[,d]) -> D[k] if k in D, else d. d defaults to None.D.__sizeof__() -> size of D in memory, in bytesx.__getitem__(y) <==> x[y]__contains__($self, key, /) --
True if D has a key k, else False.fromkeys($type, iterable, value=None, /) --
Returns a new dict with keys from iterable and values equal to value.inKn_nn{n�0�� �n� uC�� � �n� uC�
Cast a memoryview to a new format or shape.M.tolist() -> list
Return the data in the buffer as a list of elements.M.tobytes() -> bytes
Return the data in the buffer as a byte string.M.release() -> None
Release the underlying buffer exposed by the memoryview object.A bool indicating whether the memory is contiguous.A bool indicating whether the memory is Fortran contiguous.A bool indicating whether the memory is C contiguous.A tuple of integers used internally for PIL-style arrays.A tuple of ndim integers giving the size in bytes to access each element for each dimension of the array.A tuple of ndim integers giving the shape of the memory as an N-dimensional array.An integer indicating how many dimensions of a multi-dimensional array the memory represents.A string containing the format (in struct module style) for each element in the view.The size in bytes of each element of the memoryview.A bool indicating whether the memory is read only.The amount of space in bytes that the array would use in a contiguous representation.The underlying object of the memoryview.memoryview(object)
Create a new memoryview object which references the given object. ��q�N^�E `�C�qb �C�q�} ��C�qn @�C�q�S �q�E �q�R @�C�q�X �C�q�V ��C�qPX `�C ��X �C�q�X ��C�q X @�C�q�W ��C�q�W ��C�q�V @�C�q�V �C�q`V ��C0T pv 0T �y @Y PF �C |q��N Y �Cp�C`l ��C@��C�C F Ѓ � �C�C� rp0D @pC D �(:0/` I(� �(� :0� �(0� �0� 4�`� ݇(�� � 0� @� `� ��C �C��Cmodule(name[, doc])
Create a module object. The name must be a string; the optional doc argument can have any type.?���60�� � �?�ڪ8К p� D`�C0� �� ( �C`�C�� ��hA simple attribute-based namespace.
SimpleNamespace(**kwargs)Return state information for pickling:�p� p� D�CP� p� 0� �C`�C�� �� 4�� @�C?��@� `� @�CЯ �0� P� ��Cp� 4�0� � ZG0���#������0�C0�C@�C@�CP�CP�C`�C`�Cp�Cp�C��C��C��C��C��C��C��C��C��C��CЭCЭC�C�C�C�C�C�C�C�C �C �C0�C0�C@�C@�CP�CP�C`�C`�Cp�Cp�C��C��C��C��C��C��C��C��C��C��CЮCЮC�C�C�C�C�C�C�C�C �C �C0�C0�C@�C@�CP�CP�C`�C`�Cp�Cp�C��C��C��C��C��C��C��C��C��C��CЯCЯC�C�C�C�C�C�C�C�C �C �C0�C0�C@�C@�CP�CP�C`�C`�Cp�Cp�C��C��C��C��C��C��C��C��C��C��CаCаC�C�C�C�C�C�C�C�C �C �C�� �� �� p� `� `� @� 0� `� @� 0� Capsule objects let you wrap a C "void *" pointer in a Python object. They're a way of passing data through the Python interpreter without creating your own custom type.
Capsules are used for communication between extension modules. They provide a way for an extension module to export a C interface to other extension modules, so that extension modules can use the Python import mechanism to link to one another. ��0�� P� ��CSet state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).rangeobject.index(value, [start, [stop]]) -> integer -- return index of value. Raise ValueError if the value is not present.rangeobject.count(value) -> integer -- return number of occurrences of valueReturn a reverse iterator.range(stop) -> range object range(start, stop[, step]) -> range object
Return an object that produces a sequence of integers from start (inclusive) to stop (exclusive) by step. range(i, j) produces i, i+1, i+2, ..., j-1. start defaults to 0, and stop is omitted! range(4) produces 0, 1, 2, 3. These are exactly the valid indices for a list of 4 elements. When step is given, it specifies the increment (or decrement).ך0�� ��Cۚ0@� �C�7C00� � �C��C� �CP @ �C��C� ��� ��C4�0� `�C�� �C� � ��C4� � `�C�� �C<�� l6��C4��� l`�Chb �C � � � ��frozenset() -> empty frozenset object frozenset(iterable) -> frozenset object
Build an immutable unordered collection of unique elements.set() -> new empty set object set(iterable) -> new set object
Build an unordered collection of unique elements.S.__sizeof__() -> size of S in memory, in bytesRemove an element from a set if it is a member.
If the element is not a member, do nothing.Remove an element from a set; it must be a member.
If the element is not a member, raise a KeyError.x.__contains__(y) <==> y in x.Add an element to a set.
This has no effect if the element is already present.Report whether this set contains another set.Report whether another set contains this set.Return the symmetric difference of two sets as a new set.
(i.e. all elements that are in exactly one of the sets.)Update a set with the symmetric difference of itself and another.Return the difference of two or more sets as a new set.
(i.e. all elements that are in this set but not the others.)Remove all elements of another set from this set.Return True if two sets have a null intersection.Update a set with the intersection of itself and another.Return the intersection of two sets as a new set.
(i.e. all elements that are in both sets.)Return the union of sets as a new set.
(i.e. all elements that are in either set.)Remove all elements from this set.Return a shallow copy of a set.Update a set with the union of itself and others.Return state information for pickling.Private method returning an estimate of len(list(it)).Remove and return an arbitrary set element. Raises KeyError if the set is empty.?� �C�7@4�/@=�nDHp�CE`0��C��0D`�Cw�PB��C�n0 �C��@8@�C��P?�C4�p�C(�`�C�� /��C���<�C�7@4�/@=�Gp3�.�A�70#��C C %`�C�nDHp�CEP0��C��;��C��0D`�Cin�G��Cw�PB��CKnC`�C�n0 �C��@8@�C��P?�C�@��C4�p�C��;�C(�`�C�� /��C_n�+�C���<�Cn`A��C� `C��@�C4���C@�C�n�pm��PF�D�C`�C`D@�C`#@�� �C�9�7�PF�D��C`�CD�C`#@����C@>@+��0�@p��CReturn state information for pickling.S.indices(len) -> (start, stop, stride)
Assuming a sequence of length len, calculate the start and stop indices, and the stride length of the extended slice described by S. Out of bounds indices are clipped in a manner consistent with the handling of normal slices.slice(stop) slice(start, stop[, step])
Create a slice object. This is used for extended slicing (e.g. a[0:10:2]).s@( Q�Q �C�R��C@�C�TH�Q��C�Q@��_�C4��Q��C<�� 4��Sn_unnamed_fieldsn_fieldsn_sequence_fieldsH�o4��`ѝ����e�b��CfSet state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).T.count(value) -> integer -- return number of occurrences of valueT.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.tuple() -> empty tuple tuple(iterable) -> tuple initialized from iterable's items
If the argument is a tuple, the return value is the same object.H��@o`�C4�t �Cpq��C@m }�#�{hb`o�Cl�n��C@m��~�t�n{� 0n@�m�m@�C\��w�t`�C��C�pD��CPm�r�q��C|super() -> same as super(__class__, <first argument>) super(type) -> unbound super object super(type, obj) -> bound super object; requires isinstance(obj, type) super(type, type2) -> bound super object; requires issubclass(type2, type) Typical use to call a cooperative superclass method: class C(B): def meth(self, arg): super().meth(arg) This works for class methods too: class C(B): @classmethod def cmeth(cls, arg): super().cmeth(arg) Abstract classes can override this to customize issubclass().
This is invoked early on by abc.ABCMeta.__subclasscheck__(). It should return True, False or NotImplemented. If it returns NotImplemented, the normal algorithm is used. Otherwise, it overrides the normal algorithm (and the outcome is cached). type(object_or_name, bases, dict) type(object) -> the object's type type(name, bases, dict) -> a new type �4����n#�.�<��#I�[��i��b�Im� v�~��]�����������1�����ǣУأ��������"��+�3�;�C�L�W�b�n�y�����������������ȤѤڤ����� ���'�4�B�N�[�i�v�ic�n:0������o�����(���� еȥ@4�~�@4��H4�]�H4�m�Xp����٥x0�p�8� ���@�h�v��P�����ȥ�P�ض~��4������ �]�����p�����@�������0�� ���� �������@�������p����������������и�����0����`��0���0������0�P��1�(��P�(��8Г��������4����0����ǣ�0���0�У�����h�أ���������0���л��0����������8��������h���0������0�������� �"����h�+����� �3������)�;��������C��p���нL��������W������b�����P�n������y��������������������(�����`���������� ��ȿ��� ����������(��� p���H�Ȥ(P�P�p�Ѥ00�P���ڤ8�P���@��P���H��P�P���P��P����X��P��� �`p�P����hP�P�0��p0�P�h�'�x����4�x����B������N�����H�[���P���i����P���v��������E��0�Уh�ic��P���M����P���Y������E��0�Уh����P������@�����x�ic�0���M���P���Y���@���n���@���Ȥ�P���ڤ�� ��� ���������X�^��e�4�p�e�w�0���Ce.`���(������0� ��������i��OP���@���æ����������P���К��(���Т��?��PP�?��PP�Т���(���:0��`����J/`P�p�Ϧ����?���I(����0`�� �(������#� 2�XZM���(/`E�٥icȥI(?�Y��Ϧn�(������D�C���C����N�������P�@D D �`��n8(��� ��O �D� �C`���p� D@ D�D�� 6`�Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).str(object='') -> str str(bytes_or_buffer[, encoding[, errors]]) -> str
Create a new string object from the given object. If encoding or errors is specified, then the object must expose a data buffer that will be decoded using the given encoding and error handler. Otherwise, returns the result of object.__str__() (if defined) or repr(object). encoding defaults to sys.getdefaultencoding(). errors defaults to 'strict'.S.__sizeof__() -> size of S in memory, in bytesS.__format__(format_spec) -> str
Return a formatted version of S as described by format_spec.S.format_map(mapping) -> str
Return a formatted version of S, using substitutions from mapping. The substitutions are identified by braces ('{' and '}').S.format(*args, **kwargs) -> str
Return a formatted version of S, using substitutions from args and kwargs. The substitutions are identified by braces ('{' and '}').S.endswith(suffix[, start[, end]]) -> bool
Return True if S ends with the specified suffix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. suffix can also be a tuple of strings to try.S.startswith(prefix[, start[, end]]) -> bool
Return True if S starts with the specified prefix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. prefix can also be a tuple of strings to try.S.zfill(width) -> str
Pad a numeric string S with zeros on the left, to fill a field of the specified width. The string S is never truncated.S.upper() -> str
Return a copy of S converted to uppercase.S.translate(table) -> str
Return a copy of the string S in which each character has been mapped through the given translation table. The table must implement lookup/indexing via __getitem__, for instance a dictionary or list, mapping Unicode ordinals to Unicode ordinals, strings, or None. If this operation raises LookupError, the character is left untouched. Characters mapped to None are deleted.maketrans(x, y=None, z=None, /) --
Return a translation table usable for str.translate().
If there is only one argument, it must be a dictionary mapping Unicode ordinals (integers) or characters to Unicode ordinals, strings or None. Character keys will be then converted to ordinals. If there are two arguments, they must be strings of equal length, and in the resulting dictionary, each character in x will be mapped to the character at the same position in y. If there is a third argument, it must be a string, whose characters will be mapped to None in the result.S.swapcase() -> str
Return a copy of S with uppercase characters converted to lowercase and vice versa.S.splitlines([keepends]) -> list of strings
Return a list of the lines in S, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.S.rsplit(sep=None, maxsplit=-1) -> list of strings
Return a list of the words in S, using sep as the delimiter string, starting at the end of the string and working to the front. If maxsplit is given, at most maxsplit splits are done. If sep is not specified, any whitespace string is a separator.S.rpartition(sep) -> (head, sep, tail)
Search for the separator sep in S, starting at the end of S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return two empty strings and S.S.partition(sep) -> (head, sep, tail)
Search for the separator sep in S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return S and two empty strings.S.split(sep=None, maxsplit=-1) -> list of strings
Return a list of the words in S, using sep as the delimiter string. If maxsplit is given, at most maxsplit splits are done. If sep is not specified or is None, any whitespace string is a separator and empty strings are removed from the result.S.rjust(width[, fillchar]) -> str
Return S right-justified in a string of length width. Padding is done using the specified fill character (default is a space).S.rindex(sub[, start[, end]]) -> int
Like S.rfind() but raise ValueError when the substring is not found.S.rfind(sub[, start[, end]]) -> int
Return the highest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation.
Return -1 on failure.S.replace(old, new[, count]) -> str
Return a copy of S with all occurrences of substring old replaced by new. If the optional argument count is given, only the first count occurrences are replaced.S.rstrip([chars]) -> str
Return a copy of the string S with trailing whitespace removed. If chars is given and not None, remove characters in chars instead.S.lstrip([chars]) -> str
Return a copy of the string S with leading whitespace removed. If chars is given and not None, remove characters in chars instead.S.strip([chars]) -> str
Return a copy of the string S with leading and trailing whitespace removed. If chars is given and not None, remove characters in chars instead.S.lower() -> str
Return a copy of the string S converted to lowercase.S.ljust(width[, fillchar]) -> str
Return S left-justified in a Unicode string of length width. Padding is done using the specified fill character (default is a space).S.join(iterable) -> str
Return a string which is the concatenation of the strings in the iterable. The separator between elements is S.S.isprintable() -> bool
Return True if all characters in S are considered printable in repr() or S is empty, False otherwise.S.isidentifier() -> bool
Return True if S is a valid identifier according to the language definition.
Use keyword.iskeyword() to test for reserved identifiers such as "def" and "class". S.isnumeric() -> bool
Return True if there are only numeric characters in S, False otherwise.S.isdigit() -> bool
Return True if all characters in S are digits and there is at least one character in S, False otherwise.S.isdecimal() -> bool
Return True if there are only decimal characters in S, False otherwise.S.isalnum() -> bool
Return True if all characters in S are alphanumeric and there is at least one character in S, False otherwise.S.isalpha() -> bool
Return True if all characters in S are alphabetic and there is at least one character in S, False otherwise.S.isspace() -> bool
Return True if all characters in S are whitespace and there is at least one character in S, False otherwise.S.istitle() -> bool
Return True if S is a titlecased string and there is at least one character in S, i.e. upper- and titlecase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.S.isupper() -> bool
Return True if all cased characters in S are uppercase and there is at least one cased character in S, False otherwise.S.islower() -> bool
Return True if all cased characters in S are lowercase and there is at least one cased character in S, False otherwise.S.index(sub[, start[, end]]) -> int
Like S.find() but raise ValueError when the substring is not found.S.find(sub[, start[, end]]) -> int
Return the lowest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation.
Return -1 on failure.S.expandtabs(tabsize=8) -> str
Return a copy of S where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.S.encode(encoding='utf-8', errors='strict') -> bytes
Encode S using the codec registered for encoding. Default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeEncodeError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that can handle UnicodeEncodeErrors.S.count(sub[, start[, end]]) -> int
Return the number of non-overlapping occurrences of substring sub in string S[start:end]. Optional arguments start and end are interpreted as in slice notation.S.center(width[, fillchar]) -> str
Return S centered in a string of length width. Padding is done using the specified fill character (default is a space)S.casefold() -> str
Return a version of S suitable for caseless comparisons.S.capitalize() -> str
Return a capitalized version of S, i.e. make the first character have upper case and the rest lower case.S.title() -> str
Return a titlecased version of S, i.e. words start with title case characters, all remaining cased characters have lower case.����������k7F�7F����N��k]�e� <Dz��5���P�(��x�D4�`�`DPv D��.��-� 6D�@� �(D�)�9 %D$�V"D���,D: �9D��P�`9D��`:D6�0 �8Dl�� �7D� `5D�� `4D�pI@$Dhb@� �3D�0 �+Dt���+D��. *D��� �'D�� 'D �� `&Di�.�)D��U@#D[ !DR`.�*D�p�� Dr�� �D� ��D��� �DJ0� �Dr��@3D�@��2D����1Dz��1D����`/Dj`��.D�� ��.Db��`0DZ@��/D��@&�-D���@-DB��D ����D�� �@De. ��D� x!`D(�v�D�#� �@pb�ED_^�fP��� @�@ S�� �<D�PЄ0� =D`ID=D��P �D��@>D��` 0���8�b�4�#H�0�b�2�#H�#�(�������������������������0�������������0���������������������p��#P�L08@����MD`MD@MD��0�0���@����@�P��B8@����MD`MD@MD0�0���@����@�P���ND��8�������D����0� ODЙP�Low-level inferface to warnings functionality.Issue a warning, or maybe ignore it or raise an exception._warnings provides basic warning filtering support. It is a helper module to speed up interpreter start-up.�> [0_�> �>�<ڪ��(�)w,�TD�VD���TD���`TD6@�"j���?�ڝ�4���`mm`��{{1?1��1�<��_�����������n��# �n�<��o���?��t����t�������?�?s@�s@?�J���J?��_�����;�+8+8�??�� q?� q���������0�n�0��#
�_# ��
�;�����;���n�n�<�?`�`�ڪ`�A�A�ڪ`�`����<�<#
( �?�?( �n# �n��#
��#
���o�#
o����?���, ?, , ??�������# 4 ��������_# 4 C C 4 �_���<���<# # # # # ?�K ��D0�P��XD eD���(��Built-in functions, exceptions, and other objects.
Noteworthy: None is the `nil' object; Ellipsis represents `...' in slices.zip(iter1 [,iter2 [...]]) --> zip object
Return a zip object whose .__next__() method returns a tuple where the i-th element comes from the i-th iterable argument. The .__next__() method continues until the shortest iterable in the argument sequence is exhausted and then it raises StopIteration.issubclass(C, B) -> bool
Return whether class C is a subclass (i.e., a derived class) of class B. When using a tuple as the second argument issubclass(X, (A, B, ...)), is a shortcut for issubclass(X, A) or issubclass(X, B) or ... (etc.).isinstance(object, class-or-type-or-tuple) -> bool
Return whether an object is an instance of a class or of a subclass thereof. With a type as second argument, return whether that is the object's type. The form using a tuple, isinstance(x, (A, B, ...)), is a shortcut for isinstance(x, A) or isinstance(x, B) or ... (etc.).sum(iterable[, start]) -> value
Return the sum of an iterable of numbers (NOT strings) plus the value of parameter 'start' (which defaults to 0). When the iterable is empty, return start.vars([object]) -> dictionary
Without arguments, equivalent to locals(). With an argument, equivalent to object.__dict__.sorted(iterable, key=None, reverse=False) --> new sorted listround(number[, ndigits]) -> number
Round a number to a given precision in decimal digits (default 0 digits). This returns an int when called with one argument, otherwise the same type as the number. ndigits may be negative.repr(object) -> string
Return the canonical string representation of the object. For most object types, eval(repr(object)) == object.input([prompt]) -> string
Read a string from standard input. The trailing newline is stripped. If the user hits EOF (Unix: Ctl-D, Windows: Ctl-Z+Return), raise EOFError. On Unix, GNU readline is used if enabled. The prompt string, if given, is printed without a trailing newline before reading.print(value, ..., sep=' ', end='\n', file=sys.stdout, flush=False)
Prints the values to a stream, or to sys.stdout by default. Optional keyword arguments: file: a file-like object (stream); defaults to the current sys.stdout. sep: string inserted between values, default a space. end: string appended after the last value, default a newline. flush: whether to forcibly flush the stream.pow(x, y[, z]) -> number
With two arguments, equivalent to x**y. With three arguments, equivalent to (x**y) % z, but may be more efficient (e.g. for ints).ord(c) -> integer
Return the integer ordinal of a one-character string.oct(number) -> string
Return the octal representation of an integer.
>>> oct(342391) '0o1234567' max(iterable, *[, default=obj, key=func]) -> value max(arg1, arg2, *args, *[, key=func]) -> value
With a single iterable argument, return its biggest item. The default keyword-only argument specifies an object to return if the provided iterable is empty. With two or more arguments, return the largest argument.min(iterable, *[, default=obj, key=func]) -> value min(arg1, arg2, *args, *[, key=func]) -> value
With a single iterable argument, return its smallest item. The default keyword-only argument specifies an object to return if the provided iterable is empty. With two or more arguments, return the smallest argument.locals() -> dictionary
Update and return a dictionary containing the current scope's local variables.len(object)
Return the number of items of a sequence or collection.iter(iterable) -> iterator iter(callable, sentinel) -> iterator
Get an iterator from an object. In the first form, the argument must supply its own iterator, or be a sequence. In the second form, the callable is called until it returns the sentinel.hex(number) -> string
Return the hexadecimal representation of an integer.
Return a hash value for the object. Two objects with the same value have the same hash value. The reverse is not necessarily true, but likely.delattr(object, name)
Delete a named attribute on an object; delattr(x, 'y') is equivalent to ``del x.y''.setattr(object, name, value)
Set a named attribute on an object; setattr(x, 'y', v) is equivalent to ``x.y = v''.next(iterator[, default])
Return the next item from the iterator. If default is given and the iterator is exhausted, it is returned instead of raising StopIteration.map(func, *iterables) --> map object
Make an iterator that computes the function using arguments from each of the iterables. Stops when the shortest iterable is exhausted.id(object) -> integer
Return the identity of an object. This is guaranteed to be unique among simultaneously existing objects. (Hint: it's the object's memory address.)hasattr(object, name) -> bool
Return whether the object has an attribute with the given name. (This is done by calling getattr(object, name) and catching AttributeError.)globals() -> dictionary
Return the dictionary containing the current scope's global variables.getattr(object, name[, default]) -> value
Get a named attribute from an object; getattr(x, 'y') is equivalent to x.y. When a default argument is given, it is returned when the attribute doesn't exist; without it, an exception is raised in that case.exec(object[, globals[, locals]])
Read and execute code from an object, which can be a string or a code object. The globals and locals are dictionaries, defaulting to the current globals and locals. If only globals is given, locals defaults to it.eval(source[, globals[, locals]]) -> value
Evaluate the source in the context of globals and locals. The source may be a string representing a Python expression or a code object as returned by compile(). The globals must be a dictionary and locals can be any mapping, defaulting to the current globals and locals. If only globals is given, locals defaults to it. divmod(x, y) -> (div, mod)
Return the tuple ((x-x%y)/y, x%y). Invariant: div*y + mod == x.dir([object]) -> list of strings
If called without an argument, return the names in the current scope. Else, return an alphabetized list of names comprising (some of) the attributes of the given object, and of attributes reachable from it. If the object supplies a method named __dir__, it will be used; otherwise the default dir() logic is used and returns: for a module object: the module's attributes. for a class object: its attributes, and recursively the attributes of its bases. for any other object: its attributes, its class's attributes, and recursively the attributes of its class's base classes.compile(source, filename, mode[, flags[, dont_inherit]]) -> code object
Compile the source (a Python module, statement or expression) into a code object that can be executed by exec() or eval(). The filename will be used for run-time error messages. The mode must be 'exec' to compile a module, 'single' to compile a single (interactive) statement, or 'eval' to compile an expression. The flags argument, if present, controls which future statements influence the compilation of the code. The dont_inherit argument, if non-zero, stops the compilation inheriting the effects of any future statements in effect in the code calling compile; if absent or zero these statements do influence the compilation, in addition to any features explicitly specified.chr(i) -> Unicode character
Return a Unicode string of one character with ordinal i; 0 <= i <= 0x10ffff.format(value[, format_spec]) -> string
Returns value.__format__(format_spec) format_spec defaults to ""filter(function or None, iterable) --> filter object
Return an iterator yielding those items of iterable for which function(item) is true. If function is None, return the items that are true.Return state information for pickling.callable(object) -> bool
Return whether the object is callable (i.e., some kind of function). Note that classes are callable, as are instances of classes with a __call__() method.bin(number) -> string
As repr(), return a string containing a printable representation of an object, but escape the non-ASCII characters in the string returned by repr() using \x, \u or \U escapes. This generates a string similar to that returned by repr() in Python 2.any(iterable) -> bool
Return True if bool(x) is True for any x in the iterable. If the iterable is empty, return False.all(iterable) -> bool
Return True if bool(x) is True for all values x in the iterable. If the iterable is empty, return True.abs(number) -> number
Return the absolute value of the argument.__import__(name, globals=None, locals=None, fromlist=(), level=0) -> module
Import a module. Because this function is meant for use by the Python interpreter and not for general use it is better to use importlib.import_module() to programmatically import a module.
The globals argument is only used to determine the context; they are not modified. The locals argument is unused. The fromlist should be a list of names to emulate ``from name import ...'', or an empty list to emulate ``import name''. When importing a module from a package, note that __import__('A.B', ...) returns package A when fromlist is empty, but its submodule B when fromlist is not empty. Level is used to determine whether to perform absolute or relative imports. 0 is absolute while a positive number is the number of parent directories to search relative to the current module.__build_class__(func, name, *bases, metaclass=None, **kwds) -> class
Internal helper function used by the class statement.����WZ�A�4_�>�O=KcKpK q'n7F<}O�O1�yK�b q�Z@gD����������D�K�w��D�Jw �D�v��D �d@�D�K�c��DB��v��D�K`c �DA��j`�D�J�v@�DK��@�D�J�}�xDv��D�J�u`�D�J���~D�J��}D �0u��D�(0t�|D��u�|D�J@s�{D�Ks�wD�@c@wD�s{D��k�nD-J`kjD"J�jiDo�P~@vD2;�j�uDWZ�U`uD��pj�rDx�Pj tDr��e�yD�K c`rD��arD�6a`qD�I�]�oDB��]�mD�Ip\�lD�J0}yD�I[�lD�I�U`kDv�| lD4��N �D4��Q �D4�`N �D"jbJJJ�b�K�O�O�k��P�HZ_K(@PD�gD M0R�D�S�� �OD@zD�L0S �D�P�I �OD@�D�L�N`�DpM�������?�T�q�q�J�KUL�RT��"e�Hkh#Zk���mo#hk�@n��k���n��vkP�o2O�k���o�k�k���� ��k����=�<�<�>�<�</`"jZI ���m\�ka>`���� � � �
Loads an extension module.is_frozen($module, name, /) --
Returns True if the module name corresponds to a frozen module.is_builtin($module, name, /) --
Returns True if the module name corresponds to a built-in module.is_frozen_package($module, name, /) --
Returns True if the module name is of a frozen package.get_frozen_object($module, name, /) --
Create a code object for a frozen module.init_frozen($module, name, /) --
Initializes a frozen module.init_builtin($module, name, /) --
Initializes a built-in module.extension_suffixes($module, /) --
Returns the list of file suffixes used to identify extension modules._fix_co_filename($module, code, path, /) --
Changes code.co_filename to specify the passed-in file path.
code Code object to change. path File path to use.release_lock($module, /) --
Release the interpreter's import lock.
On platforms without threads, this function does nothing.acquire_lock($module, /) --
Acquires the interpreter's import lock for the current thread.
This lock should be used by import hooks to ensure thread-safety when importing modules. On platforms without threads, this function does nothing.lock_held($module, /) --
Return True if the import lock is currently held, else False.
On platforms without threads, return False.��������������2���J��v��(�@�O�5a_���D`Ed�@F�Ew�PE�E��pL�E���LE��D�E���C`Ei�Z`E���a E"�pE�EB�I�E3��G EP��I@EJJ��bJ��"j���>������Ë͋؋q���|��=KQThis module contains functions that can read and write Python values in a binary format. The format is specific to Python, but independent of machine architecture issues.
Not all Python object types are supported; in general, only objects whose value is independent from a particular invocation of Python can be written and read by this module. The following types are supported: None, integers, floating point numbers, strings, bytes, bytearrays, tuples, lists, sets, dictionaries, and code objects, where it should be understood that tuples, lists and dictionaries are only supported as long as the values contained therein are themselves supported; and recursive lists and dictionaries should not be written (they will cause infinite loops).
Variables:
version -- indicates the format that the module uses. Version 0 is the historical format, version 1 shares interned strings and version 2 uses a binary format for floating point numbers. Version 3 shares common object references (New in version 3.4).
Functions:
dump() -- write value to a file load() -- read value from a file dumps() -- write value to a string loads() -- read value from a stringloads(bytes)
Convert the bytes object to a value. If no valid value is found, raise EOFError, ValueError or TypeError. Extra characters in the input are ignored.dumps(value[, version])
Return the string that would be written to a file by dump(value, file). The value must be a supported type. Raise a ValueError exception if value has (or contains an object that has) an unsupported type.
The version argument indicates the data format that dumps should use.load(file)
Read one value from the open file and return it. If no valid value is read (e.g. because the data has a different Python version’s incompatible marshal format), raise EOFError, ValueError or TypeError. The file must be an open file object opened in binary mode ('rb' or 'r+b').
Note: If an object containing an unsupported type was marshalled with dump(), load() will substitute None for the unmarshallable type.dump(value, file[, version])
Write the value on the open file. The value must be a supported type. The file must be an open file object such as sys.stdout or returned by open() or os.popen(). It must be opened in binary mode ('wb' or 'w+b').
If the value has (or contains an object that has) an unsupported type, a ValueError exception is raised — but garbage data will also be written to the file. The object will not be properly read back by load()
The version argument indicates the data format that dump should use.]��TS��� E E��P� E�`�`E��� Ep���`E0�`�@��<�<�<�>�</`=P)��g��O�W�q� ���^"jbJJJ������͋Ë؋�Ou�ZZ�p�^p^ E��� i�>*(0q�D{�H�n@�<Psys.version_info
Version information as a named tuple.sys.flags
Flags provided through command line arguments or environment vars.This module provides access to some objects used or maintained by the interpreter and to functions that interact strongly with the interpreter.
Dynamic objects:
argv -- command line arguments; argv[0] is the script pathname if known path -- module search path; path[0] is the script directory, else '' modules -- dictionary of loaded modules
displayhook -- called to show results in an interactive session excepthook -- called to handle any uncaught exception other than SystemExit To customize printing in an interactive session or to install a custom top-level exception handler, assign other functions to replace these.
stdin -- standard input file object; used by input() stdout -- standard output file object; used by print() stderr -- standard error object; used for error messages By assigning other file objects (or objects that behave like files) to these, it is possible to redirect all of the interpreter's I/O.
last_type -- type of last uncaught exception last_value -- value of last uncaught exception last_traceback -- traceback of last uncaught exception These three are only available in an interactive session after a traceback has been printed.
Static objects:
builtin_module_names -- tuple of module names built into this interpreter copyright -- copyright notice pertaining to this interpreter exec_prefix -- prefix used to find the machine-specific Python library executable -- absolute path of the executable binary of the Python interpreter float_info -- a struct sequence with information about the float implementation. float_repr_style -- string indicating the style of repr() output for floats hash_info -- a struct sequence with information about the hash algorithm. hexversion -- version information encoded as a single integer implementation -- Python implementation information. int_info -- a struct sequence with information about the int implementation. maxsize -- the largest supported length of containers. maxunicode -- the value of the largest Unicode code point platform -- platform identifier prefix -- prefix used to find the Python library thread_info -- a struct sequence with information about the thread implementation. version -- the version of this interpreter as a string version_info -- version information as a named tuple __stdin__ -- the original stdin; don't touch! __stdout__ -- the original stdout; don't touch! __stderr__ -- the original stderr; don't touch! __displayhook__ -- the original displayhook; don't touch! __excepthook__ -- the original excepthook; don't touch!
Functions:
displayhook() -- print an object to the screen, and save it in builtins._ excepthook() -- print an exception and its traceback to sys.stderr exc_info() -- return thread-safe information about the current exception exit() -- exit the interpreter by raising SystemExit getdlopenflags() -- returns flags to be used for dlopen() calls getprofile() -- get the global profiling function getrefcount() -- return the reference count for an object (plus one :-) getrecursionlimit() -- return the max recursion depth for the interpreter getsizeof() -- return the size of an object in bytes gettrace() -- get the global debug tracing function setcheckinterval() -- control how often the interpreter checks for events setdlopenflags() -- set the flags to be used for dlopen() calls setprofile() -- set the global profiling function setrecursionlimit() -- set the max recursion depth for the interpreter settrace() -- set the global debug tracing function _clear_type_cache() -> None Clear the internal type lookup cache._debugmallocstats()
Print summary info to stderr about the state of pymalloc's structures.
In Py_DEBUG mode, also perform some expensive internal consistency checks. callstats() -> tuple of integers
Return a tuple of function call statistics, if CALL_PROFILE was defined when Python was built. Otherwise, return None.
When enabled, this function returns detailed, implementation-specific details about the number of function calls executed. The return value is a 11-tuple where the entries in the tuple are counts of: 0. all function calls 1. calls to PyFunction_Type objects 2. PyFunction calls that do not create an argument tuple 3. PyFunction calls that do not create an argument tuple and bypass PyEval_EvalCodeEx() 4. PyMethod calls 5. PyMethod calls on bound methods 6. PyType calls 7. PyCFunction calls 8. generator calls 9. All other calls 10. Number of stack pops performed by call_function()call_tracing(func, args) -> object
Call func(*args), while tracing is enabled. The tracing state is saved, and restored afterwards. This is intended to be called from a debugger from a checkpoint, to recursively debug some other code._current_frames() -> dictionary
Return a dictionary mapping each current thread T's thread id to T's current stack frame.
This function should be used for specialized purposes only._getframe([depth]) -> frameobject
Return a frame object from the call stack. If optional integer depth is given, return the frame object that many calls below the top of the stack. If that is deeper than the call stack, ValueError is raised. The default for depth is zero, returning the frame at the top of the call stack.
This function should be used for internal and specialized purposes only.getallocatedblocks() -> integer
Return the number of memory blocks currently allocated, regardless of their size.getrefcount(object) -> integer
Return the reference count of object. The count returned is generally one higher than you might expect, because it includes the (temporary) reference as an argument to getrefcount().getsizeof(object, default) -> int
Return the size of object in bytes.getdlopenflags() -> int
Return the current value of the flags that are used for dlopen calls. The flag constants are defined in the os module.setdlopenflags(n) -> None
Set the flags used by the interpreter for dlopen calls, such as when the interpreter loads extension modules. Among other things, this will enable a lazy resolving of symbols when importing a module, if called as sys.setdlopenflags(0). To share symbols across extension modules, call as sys.setdlopenflags(os.RTLD_GLOBAL). Symbolic names for the flag modules can be found in the os module (RTLD_xxx constants, e.g. os.RTLD_LAZY).getrecursionlimit()
Return the current value of the recursion limit, the maximum depth of the Python interpreter stack. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python.setrecursionlimit(n)
Set the maximum depth of the Python interpreter stack to n. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python. The highest possible limit is platform- dependent.hash_info
A struct sequence providing parameters used for computing hashes. The attributes are read only.getswitchinterval() -> current thread switch interval; see setswitchinterval().setswitchinterval(n)
Set the ideal thread switching delay inside the Python interpreter The actual frequency of switching threads can be lower if the interpreter executes long sequences of uninterruptible code (this is implementation-specific and workload-dependent).
The parameter must represent the desired switching delay in seconds A typical value is 0.005 (5 milliseconds).getcheckinterval() -> current check interval; see setcheckinterval().setcheckinterval(n)
Tell the Python interpreter to check for asynchronous events every n instructions. This also affects how often thread switches occur.dgetprofile()
Return the profiling function set with sys.setprofile. See the profiler chapter in the library manual.setprofile(function)
Set the profiling function. It will be called on each function call and return. See the profiler chapter in the library manual.gettrace()
Return the global debug tracing function set with sys.settrace. See the debugger chapter in the library manual.settrace(function)
Set the global debug tracing function. It will be called on each function call. See the debugger chapter in the library manual.intern(string) -> string
``Intern'' the given string. This enters the string in the (global) table of interned strings whose purpose is to speed up dictionary lookups. Return the string itself or the previously interned string object with the same value.getfilesystemencoding() -> string
Return the encoding used to convert Unicode filenames in operating system filenames.getdefaultencoding() -> string
Return the current default string encoding used by the Unicode implementation.exit([status])
Exit the interpreter by raising SystemExit(status). If the status is omitted or None, it defaults to zero (i.e., success). If the status is an integer, it will be used as the system exit status. If it is another kind of object, it will be printed and the system exit status will be one (i.e., failure).exc_info() -> (type, value, traceback)
Return information about the most recent exception caught by an except clause in the current stack frame or in an older stack frame.excepthook(exctype, value, traceback) -> None
Handle an exception by displaying it with a traceback on sys.stderr. displayhook(object) -> None
Print an object to sys.stdout and also save it in builtins._ ��N'n�`E���������HEѿܿ��E@EE:���1� ��%�:�p�G�N�d�E�EE I�n�q�y�|�y�pK�������������������������� ���9E�FE ������$��(�P��.x�R���,���6�@�\� �]�"jbJ�>�ZEz(֣ �@-E� � ,E)��@1E�R��DE9���BEu����CEw���AEB��AEU���`5Ed�И�3Ew����@E��� 4E�����7E@�0�5E��0�2EO��`?E�����<E���� <E��М�:E��p�@:E����6E���=E�@� =El���8E����>E��@>E@�0�@0E����,E�?(��@p����NE�MEo�w�f� \�$�� ��> �=��W�m�q��$�(���@}H������������������sys.thread_info
A struct sequence holding information about the thread implementation..��OE`PE��@�2Sh�w����������������������������������!�.�8���_��Z�B�,]�/:This module provides access to the garbage collector for reference cycles.
enable() -- Enable automatic garbage collection. disable() -- Disable automatic garbage collection. isenabled() -- Returns true if automatic collection is enabled. collect() -- Do a full collection right now. get_count() -- Return the current collection counts. get_stats() -- Return list of dictionaries containing per-generation stats. set_debug() -- Set debugging flags. get_debug() -- Get debugging flags. set_threshold() -- Set the collection thresholds. get_threshold() -- Return the current the collection thresholds. get_objects() -- Return a list of all objects tracked by the collector. is_tracked() -- Returns true if a given object is tracked. get_referrers() -- Return the list of objects that refer to an object. get_referents() -- Return the list of objects that an object refers to. is_tracked(obj) -> bool
Returns true if the object is tracked by the garbage collector. Simple atomic objects will return false. get_stats() -> [...]
Return a list of dictionaries containing per-generation statistics. get_objects() -> [...]
Return a list of objects tracked by the collector (excluding the list returned). get_referents(*objs) -> list Return the list of objects that are directly referred to by objs.get_referrers(*objs) -> list Return the list of objects that directly refer to any of objs.get_count() -> (count0, count1, count2)
Return the current collection counts get_threshold() -> (threshold0, threshold1, threshold2)
Return the current collection thresholds set_threshold(threshold0, [threshold1, threshold2]) -> None
Sets the collection thresholds. Setting threshold0 to zero disables collection. get_debug() -> flags
Get the garbage collection debugging flags. set_debug(flags) -> None
Set the garbage collection debugging flags. Debugging information is written to sys.stderr.
flags is an integer and can have the following bits turned on:
DEBUG_STATS - Print statistics during collection. DEBUG_COLLECTABLE - Print collectable objects found. DEBUG_UNCOLLECTABLE - Print unreachable but uncollectable objects found. DEBUG_SAVEALL - Save objects to gc.garbage rather than freeing them. DEBUG_LEAK - Debug leaking programs (everything but STATS). collect([generation]) -> n
With no arguments, run a full collection. The optional argument may be an integer specifying which generation to collect. A ValueError is raised if the generation number is invalid.
The number of unreachable objects is returned. isenabled() -> status
Returns true if automatic garbage collection is enabled. disable() -> None
Enable automatic garbage collection. ���B��RE��������_Eqj�^E3�0��]E;�@�`]E���@ZEE���YEO���`XE����@YEY����XEg�в@\Eo��� WE{�@��VE���� VE���XE����WEaEaEaE� aE aE @aE@aE A lock object is a synchronization primitive. To create a lock, call the PyThread_allocate_lock() function. Methods are:
acquire() -- lock the lock, possibly blocking until it can be obtained release() -- unlock of the lock locked() -- test whether the lock is currently locked
A lock is not owned by the thread that locked it; another thread may unlock it. A thread attempting to lock a lock that it has already locked will block until another thread unlocks it. Deadlocks may ensue.This module provides primitive operations to write multi-threaded programs. The 'threading' module provides a more convenient interface.stack_size([size]) -> size
Return the thread stack size used when creating new threads. The optional size argument specifies the stack size (in bytes) to be used for subsequently created threads, and must be 0 (use platform or configured default) or a positive integer value of at least 32,768 (32k). If changing the thread stack size is unsupported, a ThreadError exception is raised. If the specified size is invalid, a ValueError exception is raised, and the stack size is unmodified. 32k bytes currently the minimum supported stack size value to guarantee sufficient stack space for the interpreter itself.
Note that some platforms may have particular restrictions on values for the stack size, such as requiring a minimum stack size larger than 32kB or requiring allocation in multiples of the system memory page size - platform documentation should be referred to for more information (4kB pages are common; using multiples of 4096 for the stack size is the suggested approach in the absence of more specific information)._set_sentinel() -> lock
Set a sentinel lock that will be released when the current thread state is finalized (after it is untied from the interpreter).
This is a private API for the threading module._count() -> integer
Return the number of currently running Python threads, excluding the main thread. The returned number comprises all threads created through `start_new_thread()` as well as `threading.Thread`, and not yet finished.
This function is meant for internal and specialized purposes only. In most applications `threading.enumerate()` should be used instead.get_ident() -> integer
Return a non-zero integer that uniquely identifies the current thread amongst other threads that exist simultaneously. This may be used to identify per-thread resources. Even though on some platforms threads identities may appear to be allocated consecutive numbers starting at 1, this behavior should not be relied upon, and the number should be seen purely as a magic cookie. A thread's identity may be reused for another thread after it exits.allocate_lock() -> lock object (allocate() is an obsolete synonym)
Create a new lock object. See help(LockType) for information about locks.interrupt_main()
Raise a KeyboardInterrupt in the main thread. A subthread can use this function to interrupt the main thread.exit() (exit_thread() is an obsolete synonym)
This is synonymous to ``raise SystemExit''. It will cause the current thread to exit silently unless the exception is caught.start_new_thread(function, args[, kwargs]) (start_new() is an obsolete synonym)
Start a new thread and return its identifier. The thread will call the function with positional arguments from the tuple args and keyword arguments taken from the optional dictionary kwargs. The thread exits when the function returns; the return value is ignored. The thread will also exit when the function raises an unhandled exception; a stack trace will be printed unless the exception is SystemExit. _is_owned() -> bool
For internal use by `threading.Condition`._release_save() -> tuple
For internal use by `threading.Condition`._acquire_restore(state) -> None
For internal use by `threading.Condition`.release()
Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, and must be locked by the same thread that unlocks it; otherwise a `RuntimeError` is raised.
Do note that if the lock was acquire()d several times in a row by the current thread, release() needs to be called as many times for the lock to be available for other threads.acquire(blocking=True) -> bool
Lock the lock. `blocking` indicates whether we should wait for the lock to be available or not. If `blocking` is False and another thread holds the lock, the method will return False immediately. If `blocking` is True and another thread holds the lock, the method will wait for the lock to be released, take it and then return True. (note: the blocking operation is interruptible.)
In all other cases, the method will return True immediately. Precisely, if the current thread already holds the lock, its internal counter is simply incremented. If nobody holds the lock, the lock is taken and its internal counter initialized to 1.locked() -> bool (locked_lock() is an obsolete synonym)
Return whether the lock is in the locked state.release() (release_lock() is an obsolete synonym)
Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, but it needn't be locked by the same thread that unlocks it.acquire([wait]) -> bool (acquire_lock() is an obsolete synonym)
Lock the lock. Without argument, this blocks if the lock is already locked (even by the same thread), waiting for another thread to release the lock, and return True once the lock is acquired. With an argument, this will only block if the argument is true, and the return value reflects whether the lock is acquired. The blocking operation is interruptible.������`cE���������yE���@nE����@nE��p�`lE$�p�`lE����mEw���mE���mE��0��jER�кiE��@�dE���� hE��@�p���D��p�@�(p�� �$�9��sE^��@qEE�p�@pE�� ��pEO����pE�q�sE�q��@qE��@� wE9�@� wE���� vE^�� vEj�м�uERм�uE�q@� wE�q�� vE"j7�0P��(@~E��]�(��@EThis module provides mechanisms to use signal handlers in Python.
Functions:
alarm() -- cause SIGALRM after a specified time [Unix only] setitimer() -- cause a signal (described below) after a specified float time and the timer may restart then [Unix only] getitimer() -- get current value of timer [Unix only] signal() -- set the action for a given signal getsignal() -- get the signal action for a given signal pause() -- wait until a signal arrives [Unix only] default_int_handler() -- default SIGINT handler
signal constants: SIG_DFL -- used to refer to the system default handler SIG_IGN -- used to ignore the signal NSIG -- number of defined signals SIGINT, SIGTERM, etc. -- signal numbers
itimer constants: ITIMER_REAL -- decrements in real time, and delivers SIGALRM upon expiration ITIMER_VIRTUAL -- decrements only when the process is executing, and delivers SIGVTALRM upon expiration ITIMER_PROF -- decrements both when the process is executing and when the system is executing on behalf of the process. Coupled with ITIMER_VIRTUAL, this timer is usually used to profile the time spent by the application in user and kernel space. SIGPROF is delivered upon expiration.
*** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame.pthread_kill(thread_id, signum)
Send a signal to a thread.sigtimedwait(sigset, (timeout_sec, timeout_nsec)) -> struct_siginfo
Like sigwaitinfo(), but with a timeout specified as a tuple of (seconds, nanoseconds).sigwaitinfo(sigset) -> struct_siginfo
Wait synchronously for a signal until one of the signals in *sigset* is delivered. Returns a struct_siginfo containing information about the signal.struct_siginfo: Result from sigwaitinfo or sigtimedwait.
This object may be accessed either as a tuple of (si_signo, si_code, si_errno, si_pid, si_uid, si_status, si_band), or via the attributes si_signo, si_code, and so on.sigwait(sigset) -> signum
Wait a signal.sigpending() -> list
Examine pending signals.pthread_sigmask(how, mask) -> old mask
Fetch and/or change the signal mask of the calling thread.getitimer(which)
Returns current value of given itimer.setitimer(which, seconds[, interval])
Sets given itimer (one of ITIMER_REAL, ITIMER_VIRTUAL or ITIMER_PROF) to fire after value seconds and after that every interval seconds. The itimer can be cleared by setting seconds to zero.
Returns old values as a tuple: (delay, interval).set_wakeup_fd(fd) -> fd
Sets the fd to be written to (with '\0') when a signal comes in. A library can use this to wakeup select or poll. The previous fd is returned.
The fd must be non-blocking.siginterrupt(sig, flag) -> None change system call restart behaviour: if flag is False, system calls will be restarted when interrupted by signal sig, else system calls will be interrupted.getsignal(sig) -> action
Return the current action for the given signal. The return value can be: SIG_IGN -- if the signal is being ignored SIG_DFL -- if the default action for the signal is in effect None -- if an unknown handler is in effect anything else -- the callable Python object used as a handlersignal(sig, action) -> action
Set the action for the given signal. The action can be SIG_DFL, SIG_IGN, or a callable Python object. The previous action is returned. See getsignal() for possible return values.
*** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame.pause()
Wait until a signal arrives.alarm(seconds)
Arrange for SIGALRM to arrive after the given number of seconds.default_int_handler(...)
The default handler for SIGINT installed by Python. It raises KeyboardInterrupt.��������E����������E.� � �E����`�E{�P� �E����`�EQ�p� �E6�����El���`�EE�`��E������E8�����E%�p���EK���`�E�� � �E]� �`�E������EV� �E��El�u�������������������������set_inheritable(fd, inheritable)
Set the inheritable flag of the specified file descriptor.get_inheritable(fd) -> bool
Get the close-on-exe flag of the specified file descriptor.cpu_count() -> integer
Return the number of CPUs in the system, or None if this value cannot be established.Return the size of the terminal window as (columns, lines).
The optional argument fd (default standard output) specifies which file descriptor should be queried.
If the file descriptor is not connected to a terminal, an OSError is thrown.
This function will only be defined if an implementation is available for this system.
shutil.get_terminal_size is the high-level function which should normally be used, os.get_terminal_size is the low-level implementation.A tuple of (columns, lines) for holding terminal window sizeurandom(n) -> str
Return n random bytes suitable for cryptographic use.listxattr(path='.', *, follow_symlinks=True)
Return a list of extended attributes on path.
path may be either None, a string, or an open file descriptor. if path is None, listxattr will examine the current directory. If follow_symlinks is False, and the last element of the path is a symbolic link, listxattr will examine the symbolic link itself instead of the file the link points to.removexattr(path, attribute, *, follow_symlinks=True)
Remove extended attribute attribute on path. path may be either a string or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, removexattr will modify the symbolic link itself instead of the file the link points to.setxattr(path, attribute, value, flags=0, *, follow_symlinks=True)
Set extended attribute attribute on path to value. path may be either a string or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, setxattr will modify the symbolic link itself instead of the file the link points to.getxattr(path, attribute, *, follow_symlinks=True) -> value
Return the value of extended attribute attribute on path.
path may be either a string or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, getxattr will examine the symbolic link itself instead of the file the link points to.getresgid() -> (rgid, egid, sgid)
Get tuple of the current process's real, effective, and saved group ids.getresuid() -> (ruid, euid, suid)
Get tuple of the current process's real, effective, and saved user ids.setresgid(rgid, egid, sgid)
Set the current process's real, effective, and saved group ids.setresuid(ruid, euid, suid)
Set the current process's real, effective, and saved user ids.device_encoding(fd) -> str
Return a string describing the encoding of the device if the output is a terminal; else return None.getloadavg() -> (float, float, float)
Return the number of processes in the system run queue averaged over the last 1, 5, and 15 minutes or raises OSError if the load average was unobtainableabort() -> does not return!
Abort the interpreter immediately. This 'dumps core' or otherwise fails in the hardest way possible on the hosting operating system.sysconf(name) -> integer
Return an integer-valued system configuration variable.confstr(name) -> string
Return a string-valued system configuration variable.pathconf(path, name) -> integer
Return the configuration limit name for the file or directory path. If there is no limit, return -1. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.fpathconf(fd, name) -> integer
Return the configuration limit name for the file descriptor fd. If there is no limit, return -1.statvfs(path)
Perform a statvfs system call on the given path.
path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.fstatvfs(fd) -> statvfs result
Perform an fstatvfs system call on the given fd. Equivalent to statvfs(fd).WSTOPSIG(status) -> integer
Return the signal that stopped the process that provided the 'status' value.WTERMSIG(status) -> integer
Return the signal that terminated the process that provided the 'status' value.WEXITSTATUS(status) -> integer
Return the process return code from 'status'.WIFEXITED(status) -> bool
Return true if the process returning 'status' exited using the exit() system call.WIFSIGNALED(status) -> bool
Return True if the process returning 'status' was terminated by a signal.WIFSTOPPED(status) -> bool
Return True if the process returning 'status' was stopped.WIFCONTINUED(status) -> bool
Return True if the process returning 'status' was continued from a job control stop.WCOREDUMP(status) -> bool
Return True if the process returning 'status' was dumped to a core file.strerror(code) -> string
Translate an error code to a message string.unsetenv(key)
Delete an environment variable.putenv(key, value)
Change or add an environment variable.posix_fadvise(fd, offset, len, advice)
Announces an intention to access data in a specific pattern thus allowing the kernel to make optimizations. The advice applies to the region of the file specified by fd starting at offset and continuing for len bytes. advice is one of POSIX_FADV_NORMAL, POSIX_FADV_SEQUENTIAL, POSIX_FADV_RANDOM, POSIX_FADV_NOREUSE, POSIX_FADV_WILLNEED or POSIX_FADV_DONTNEED.posix_fallocate(fd, offset, len)
Ensures that enough disk space is allocated for the file specified by fd starting from offset and continuing for len bytes.truncate(path, length)
Truncate the file given by path to length bytes. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.ftruncate(fd, length)
Truncate a file to a specified length.makedev(major, minor) -> device number Composes a raw device number from the major and minor device numbers.minor(device) -> minor number Extracts a device minor number from a raw device number.major(device) -> major number Extracts a device major number from a raw device number.mknod(path, mode=0o600, device=0, *, dir_fd=None)
Create a filesystem node (file, device special file or named pipe) named path. mode specifies both the permissions to use and the type of node to be created, being combined (bitwise OR) with one of S_IFREG, S_IFCHR, S_IFBLK, and S_IFIFO. For S_IFCHR and S_IFBLK, device defines the newly created device special file (probably using os.makedev()), otherwise it is ignored.
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.mkfifo(path, mode=0o666, *, dir_fd=None)
Create a FIFO (a POSIX named pipe).
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.pwrite(fd, string, offset) -> byteswritten
Write string to a file descriptor, fd, from offset, leaving the file offset unchanged.writev(fd, buffers) -> byteswritten
Write the contents of *buffers* to file descriptor *fd*. *buffers* must be a sequence of bytes-like objects.
writev writes the contents of each object to the file descriptor and returns the total number of bytes written.pipe2(flags) -> (read_end, write_end)
Create a pipe with flags set atomically. flags can be constructed by ORing together one or more of these values: O_NONBLOCK, O_CLOEXEC. pipe() -> (read_end, write_end)
Create a pipe.isatty(fd) -> bool
Return True if the file descriptor 'fd' is an open file descriptor connected to the slave end of a terminal.fstat(fd) -> stat result
Like stat(), but for an open file descriptor. Equivalent to stat(fd=fd).sendfile(out, in, offset, count) -> byteswritten sendfile(out, in, offset, count[, headers][, trailers], flags=0) -> byteswritten Copy count bytes from file descriptor in to file descriptor out.write(fd, data) -> byteswritten
Write bytes to a file descriptor.pread(fd, buffersize, offset) -> string
Read from a file descriptor, fd, at a position of offset. It will read up to buffersize number of bytes. The file offset remains unchanged.readv(fd, buffers) -> bytesread
Read from a file descriptor fd into a number of mutable, bytes-like objects ("buffers"). readv will transfer data into each buffer until it is full and then move on to the next buffer in the sequence to hold the rest of the data.
readv returns the total number of bytes read (which may be less than the total capacity of all the buffers.read(fd, buffersize) -> bytes
Read a file descriptor.lseek(fd, pos, how) -> newpos
Set the current position of a file descriptor. Return the new cursor position in bytes, starting from the beginning.lockf(fd, cmd, len)
Apply, test or remove a POSIX lock on an open file descriptor.
fd is an open file descriptor. cmd specifies the command to use - one of F_LOCK, F_TLOCK, F_ULOCK or F_TEST. len specifies the section of the file to lock.dup2(old_fd, new_fd)
Duplicate file descriptor.dup(fd) -> fd2
Return a duplicate of a file descriptor.closerange(fd_low, fd_high)
Closes all file descriptors in [fd_low, fd_high), ignoring errors.close(fd)
Close a file descriptor (for low level IO).open(path, flags, mode=0o777, *, dir_fd=None)
Open a file for low level IO. Returns a file handle (integer).
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.tcsetpgrp(fd, pgid)
Set the process group associated with the terminal given by a fd.tcgetpgrp(fd) -> pgid
Return the process group associated with the terminal given by a fd.setpgid(pid, pgrp)
Call the system call setpgid().setsid()
Call the system call setsid().getsid(pid) -> sid
Call the system call getsid().��������times() -> times_result
Return an object containing floating point numbers indicating process times. The object behaves like a named tuple with these fields: (utime, stime, cutime, cstime, elapsed_time)times_result: Result from os.times().
This object may be accessed either as a tuple of (user, system, children_user, children_system, elapsed), or via the attributes user, system, children_user, children_system, and elapsed.
See os.times for more information.symlink(src, dst, target_is_directory=False, *, dir_fd=None)
Create a symbolic link pointing to src named dst.
target_is_directory is required on Windows if the target is to be interpreted as a directory. (On Windows, symlink requires Windows 6.0 or greater, and raises a NotImplementedError otherwise.) target_is_directory is ignored on non-Windows platforms.
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.readlink(path, *, dir_fd=None) -> path
Return a string representing the path to which the symbolic link points.
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.wait() -> (pid, status)
Wait for completion of a child process.waitpid(pid, options) -> (pid, status)
Wait for completion of a given child process.waitid(idtype, id, options) -> waitid_result
Wait for the completion of one or more child processes.
idtype can be P_PID, P_PGID or P_ALL. id specifies the pid to wait on. options is constructed from the ORing of one or more of WEXITED, WSTOPPED or WCONTINUED and additionally may be ORed with WNOHANG or WNOWAIT. Returns either waitid_result or None if WNOHANG is specified and there are no children in a waitable state.wait4(pid, options) -> (pid, status, rusage)
Wait for completion of a given child process.wait3(options) -> (pid, status, rusage)
Wait for completion of a child process.setgroups(list)
Set the groups of the current process to list.setgid(gid)
Set the current process's group id.setregid(rgid, egid)
Set the current process's real and effective group ids.setreuid(ruid, euid)
Set the current process's real and effective user ids.setegid(gid)
Set the current process's effective group id.seteuid(uid)
Set the current process's effective user id.setuid(uid)
Set the current process's user id.killpg(pgid, sig)
Kill a process group with a signal.kill(pid, sig)
Kill a process with a signal.getuid() -> uid
Return the current process's user id.getlogin() -> string
Return the actual login name.getppid() -> ppid
Return the parent's process id. If the parent process has already exited, Windows machines will still return its id; others systems will return the id of the 'init' process (1).setpgrp()
Make this process the process group leader.getpgrp() -> pgrp
Return the current process group id.getpgid(pid) -> pgid
Call the system call getpgid().initgroups(username, gid) -> None
Call the system initgroups() to initialize the group access list with all of the groups of which the specified username is a member, plus the specified group id.getgroups() -> list of group IDs
Return list of supplemental group IDs for the process.getgrouplist(user, group) -> list of groups to which a user belongs
Returns a list of groups to which a user belongs.
user: username to lookup group: base group id of the usergetpid() -> pid
Return the current process idgetgid() -> gid
Return the current process's group id.geteuid() -> euid
Return the current process's effective user id.getegid() -> egid
Return the current process's effective group id.forkpty() -> (pid, master_fd)
Fork a new process with a new pseudo-terminal as controlling tty.
Like fork(), return 0 as pid to child process, and PID of child to parent. To both, return fd of newly opened pseudo-terminal. openpty() -> (master_fd, slave_fd)
Open a pseudo-terminal, returning open fd's for both master and slave end. sched_getaffinity(pid, ncpus) -> cpu_set
Return the affinity of the process with PID *pid*. The returned cpu_set will be of size *ncpus*.sched_setaffinity(pid, cpu_set)
Set the affinity of the process with PID *pid* to *cpu_set*.sched_yield()
Voluntarily relinquish the CPU.sched_rr_get_interval(pid) -> float
Return the round-robin quantum for the process with PID *pid* in seconds.sched_setparam(pid, param)
Set scheduling parameters for a process with PID *pid*. A PID of 0 means the calling process.sched_getparam(pid) -> sched_param
Returns scheduling parameters for the process with *pid* as an instance of the sched_param class. A PID of 0 means the calling process.sched_setscheduler(pid, policy, param)
Set the scheduling policy, *policy*, for *pid*. If *pid* is 0, the calling process is changed. *param* is an instance of sched_param.sched_param(sched_priority): A scheduling parameter.
Current has only one field: sched_prioritysched_getscheduler(pid)
Get the scheduling policy for the process with a PID of *pid*. Passing a PID of 0 returns the scheduling policy for the calling process.sched_get_priority_min(policy)
Get the minimum scheduling priority for *policy*.sched_get_priority_max(policy)
Get the maximum scheduling priority for *policy*.fork() -> pid
Fork a child process. Return 0 to child process and PID of child to parent process.execve(path, args, env)
Execute a path with arguments and environment, replacing current process.
path: path of executable file args: tuple or list of arguments env: dictionary of strings mapping to strings
On some platforms, you may specify an open file descriptor for path; execve will execute the program the file descriptor is open to. If this functionality is unavailable, using it raises NotImplementedError.execv(path, args)
Execute an executable path with arguments, replacing current process.
path: path of executable file args: tuple or list of strings_exit(status)
Exit to the system with specified status, without normal exit processing.utime(path, times=None, *[, ns], dir_fd=None, follow_symlinks=True) Set the access and modified time of path.
path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.
If times is not None, it must be a tuple (atime, mtime); atime and mtime should be expressed as float seconds since the epoch. If ns is specified, it must be a tuple (atime_ns, mtime_ns); atime_ns and mtime_ns should be expressed as integer nanoseconds since the epoch. If times is None and ns is unspecified, utime uses the current time. Specifying tuples for both times and ns is an error.
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. If follow_symlinks is False, and the last element of the path is a symbolic link, utime will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be available on your platform. If they are unavailable, using them will raise a NotImplementedError.uname_result: Result from os.uname().
This object may be accessed either as a tuple of (sysname, nodename, release, version, machine), or via the attributes sysname, nodename, release, version, and machine.
See os.uname for more information.uname() -> uname_result
Return an object identifying the current operating system. The object behaves like a named tuple with the following fields: (sysname, nodename, release, version, machine)remove(path, *, dir_fd=None)
Remove a file (same as unlink()).
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.unlink(path, *, dir_fd=None)
Remove a file (same as remove()).
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.umask(new_mask) -> old_mask
Set the current numeric umask and return the previous umask.system(command) -> exit_status
Execute the command (a string) in a subshell.rmdir(path, *, dir_fd=None)
Remove a directory.
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.replace(src, dst, *, src_dir_fd=None, dst_dir_fd=None)
Rename a file or directory, overwriting the destination.
If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. src_dir_fd and dst_dir_fd, may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.rename(src, dst, *, src_dir_fd=None, dst_dir_fd=None)
Rename a file or directory.
If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. src_dir_fd and dst_dir_fd, may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.setpriority(which, who, prio) -> None
Set program scheduling priority.getpriority(which, who) -> current_priority
Get program scheduling priority.nice(inc) -> new_priority
Decrease the priority of process by inc and return the new priority.mkdir(path, mode=0o777, *, dir_fd=None)
Create a directory.
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.
The mode argument is ignored on Windows.listdir(path='.') -> list_of_filenames
Return a list containing the names of the files in the directory. The list is in arbitrary order. It does not include the special entries '.' and '..' even if they are present in the directory.
path can be specified as either str or bytes. If path is bytes, the filenames returned will also be bytes; in all other circumstances the filenames returned will be str. On some platforms, path may also be specified as an open file descriptor; the file descriptor must refer to a directory. If this functionality is unavailable, using it raises NotImplementedError.link(src, dst, *, src_dir_fd=None, dst_dir_fd=None, follow_symlinks=True)
Create a hard link to a file.
If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. If follow_symlinks is False, and the last element of src is a symbolic link, link will create a link to the symbolic link itself instead of the file the link points to. src_dir_fd, dst_dir_fd, and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.getcwdb() -> path
Return a bytes string representing the current working directory.getcwd() -> path
Return a unicode string representing the current working directory.lchown(path, uid, gid)
Change the owner and group id of path to the numeric uid and gid. This function will not follow symbolic links. Equivalent to os.chown(path, uid, gid, follow_symlinks=False).fchown(fd, uid, gid)
Change the owner and group id of the file given by file descriptor fd to the numeric uid and gid. Equivalent to os.chown(fd, uid, gid).chown(path, uid, gid, *, dir_fd=None, follow_symlinks=True)
Change the owner and group id of path to the numeric uid and gid.
path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. If follow_symlinks is False, and the last element of the path is a symbolic link, chown will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.fdatasync(fildes)
force write of file with filedescriptor to disk. does not force update of metadata.sync()
Force write of everything to disk.fsync(fildes)
force write of file with filedescriptor to disk.chroot(path)
Change root directory to path.fchmod(fd, mode)
Change the access permissions of the file given by file descriptor fd. Equivalent to os.chmod(fd, mode).chmod(path, mode, *, dir_fd=None, follow_symlinks=True)
Change the access permissions of a file.
path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. If follow_symlinks is False, and the last element of the path is a symbolic link, chmod will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.fchdir(fd)
Change to the directory of the given file descriptor. fd must be opened on a directory, not a file. Equivalent to os.chdir(fd).chdir(path)
Change the current working directory to the specified path.
path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.ctermid() -> string
Return the name of the controlling terminal for this process.ttyname($module, fd, /) --
Return the name of the terminal device connected to 'fd'.
Use the real uid/gid to test for access to a path.
path Path to be tested; can be string, bytes, or open-file-descriptor int. mode Operating-system mode bitfield. Can be F_OK to test existence, or the inclusive-OR of R_OK, W_OK, and X_OK. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. effective_ids If True, access will use the effective uid/gid instead of the real uid/gid. follow_symlinks If False, and the last element of the path is a symbolic link, access will examine the symbolic link itself instead of the file the link points to.
dir_fd, effective_ids, and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.
Note that most operations will use the effective uid/gid, therefore this routine can be used in a suid/sgid environment to test if the invoking user has the specified access to the path.lstat(path, *, dir_fd=None) -> stat result
Like stat(), but do not follow symbolic links. Equivalent to stat(path, follow_symlinks=False).stat($module, /, path, *, dir_fd=None, follow_symlinks=True) --
Perform a stat system call on the given path.
path Path to be examined; can be string, bytes, or open-file-descriptor int. dir_fd If not None, it should be a file descriptor open to a directory, and path should be a relative string; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, stat will examine the symbolic link itself instead of the file the link points to.
dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.
It's an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor.stat_float_times([newval]) -> oldval
Determine whether os.[lf]stat represents time stamps as float objects. If newval is True, future calls to stat() return floats, if it is False, future calls return ints. If newval is omitted, return the current setting. waitid_result: Result from waitid.
This object may be accessed either as a tuple of (si_pid, si_uid, si_signo, si_status, si_code), or via the attributes si_pid, si_uid, and so on.
See os.waitid for more information.statvfs_result: Result from statvfs or fstatvfs.
This object may be accessed either as a tuple of (bsize, frsize, blocks, bfree, bavail, files, ffree, favail, flag, namemax), or via the attributes f_bsize, f_frsize, f_blocks, f_bfree, and so on.
See os.statvfs for more information.stat_result: Result from stat, fstat, or lstat.
This object may be accessed either as a tuple of (mode, ino, dev, nlink, uid, gid, size, atime, mtime, ctime) or via the attributes st_mode, st_ino, st_dev, st_nlink, st_uid, and so on.
Posix/windows: If your platform supports st_blksize, st_blocks, st_rdev, or st_flags, they are available as attributes only.
See os.stat for more information.This module provides access to operating system functionality that is standardized by the C Standard and the POSIX standard (a thinly disguised Unix interface). Refer to the library manual and corresponding Unix manual entries for more information on calls.�>JI��>�OJ8I��>�>�OJI��>��UJI�����FQI��>�>J�>�OJ�>J����FQ�>J����\J�>J�>����p�>=K�OJL�~F�eJS@�<l�>�OJ�>�O�J�>�l�>�>���>"0?=KI��>"0I��>"0I��>I����������-<JWfr~������������F���������Fs����F�P}�F��|F��P<�F�0���E�0|�EE�0�@�E�`{��E� ;��E� ��E�z�F;`�E#;�E��7`�E�0w��Ee���F��6`�E���v�E+v��E7�e@�E��4��E���u��E��u��E���3`�E��pr�F��@1`�E���0�E���q��ECp/�E��@.@�E�@.��Ec��H�E��pp`�Ev�P-��En�,�Ec��&@�E"Tp��E~��o`�Ee�0o�EO�&@�EP��n@�E8� n@�E'��m��E��l�EI�l�E�P#��E����EU���E]�k��Ee� �Em���Eu���E|�����E|�� �E��@�E����E�p��E��� �E��`�E�Pk��E���j��E�Pj`�E��i �E�Pi��E�����E��h �E��0h��E���E��`g@�E���f�Es��f��E� f`�E��`@�E|����EO�@� �E'� ���E��e �E��d��E��Pd��E}��c@�Eq�`c�E ��`�E=�p] �E���E\�0`�EV����EO�p@�Eh��b@�ED����E�T� `�ES��`�E2�p �E]��a��E2����EI�^�E$�`�EX��`�E����E���E��\��E�����E���E:����E1�p� �E��P��E1�\`�E�p��E�P[�E ��Z@�E���E����E�>�Y`�E��Y�F��Y��E�p@�E��Y��E�����E� �`�En����E`�@���ET���E����E�� �E�����Ek� P �Ew��P �E�0�E���R��E�0V��E� `�E����E��U�E���T��E��@T�E���S��E��� �E ���E@� F�E,��C@�E�`A��E��>�E �`�E�N�EB�`���E��pR �E&@�E*F7���L�?_N/Z0e`t1�2�4�3�a�.�����W V0$?%M&]'n-�e�f�g���(��)�* E' F; hF iQ <\ k +w G� j� � l� � � � �
$ w1 x? yL zW {d |r S� T� m� � � � X� U� 5� 8� >=&91@A?QA^7l6w: � � �,���o�p�; '!8Qq]ri"yn���C�M�N�I�J�O P, QC R\ Du K� L� � #� H� � B� s� t� <uv"-k9}M~bu��\�]�������^�[YZ(b6cDdRf�����������������LM;NTOrP�Q�R0�S�T�U�VW/XKYhZP�[� �� �������" -9Kav���@�E�5F�����������p����E@6F��E�6F&.D��^Mwf���F7F����l������� F�7F ������������F`8F ���%:ARYks�����������0� `�$AKfnThis module makes available standard errno system symbols.
The value of each symbol is the corresponding integer value, e.g., on most systems, errno.ENOENT equals the integer 2.
The dictionary errno.errorcode maps numeric codes to symbol names, e.g., errno.errorcode[2] could be the string 'ENOENT'.
Symbols that are not relevant to the underlying system are not defined.
To map error codes to error messages, use the function os.strerror(), e.g. os.strerror(2) could return 'No such file or directory'.���9F���������fIgetpwall() -> list_of_entries Return a list of all available password database entries, in arbitrary order. See help(pwd) for more on password database entries.getpwnam(name) -> (pw_name,pw_passwd,pw_uid, pw_gid,pw_gecos,pw_dir,pw_shell) Return the password database entry for the given user name. See help(pwd) for more on password database entries.getpwuid(uid) -> (pw_name,pw_passwd,pw_uid, pw_gid,pw_gecos,pw_dir,pw_shell) Return the password database entry for the given numeric user ID. See help(pwd) for more on password database entries.This module provides access to the Unix password database. It is available on all Unix versions.
Password database entries are reported as 7-tuples containing the following items from the password database (see `<pwd.h>'), in order: pw_name, pw_passwd, pw_uid, pw_gid, pw_gecos, pw_dir, pw_shell. The uid and gid items are integers, all others are strings. An exception is raised if the entry asked for cannot be found.pwd.struct_passwd: Results from getpw*() routines.
This object may be accessed either as a tuple of (pw_name,pw_passwd,pw_uid,pw_gid,pw_gecos,pw_dir,pw_shell) or via the object attributes as named in the above tuple.���>F���������AFK���=F?г�<F�� <F�`@F`BF�����������expand(template) -> str. Return the string obtained by doing backslash substitution on the string template, as done by the sub() method.groupdict([default=None]) -> dict. Return a dictionary containing all the named subgroups of the match, keyed by the subgroup name. The default argument is used for groups that did not participate in the matchgroups([default=None]) -> tuple. Return a tuple containing all the subgroups of the match, from 1. The default argument is used for groups that did not participate in the matchspan([group]) -> tuple. For MatchObject m, return the 2-tuple (m.start(group), m.end(group)).end([group=0]) -> int. Return index of the end of the substring matched by group.start([group=0]) -> int. Return index of the start of the substring matched by group.group([group1, ...]) -> str or tuple. Return subgroup(s) of the match by indices or names. For 0 returns the entire match.The result of re.match() and re.search(). Match objects always have a boolean value of True.Compiled regular expression objectssubn(repl, string[, count = 0]) -> (newstring, number of subs) Return the tuple (new_string, number_of_subs_made) found by replacing the leftmost non-overlapping occurrences of pattern with the replacement repl.sub(repl, string[, count = 0]) -> newstring. Return the string obtained by replacing the leftmost non-overlapping occurrences of pattern in string by the replacement repl.finditer(string[, pos[, endpos]]) -> iterator. Return an iterator over all non-overlapping matches for the RE pattern in string. For each match, the iterator returns a match object.findall(string[, pos[, endpos]]) -> list. Return a list of all non-overlapping matches of pattern in string.split(string[, maxsplit = 0]) -> list. Split string by the occurrences of pattern.search(string[, pos[, endpos]]) -> match object or None. Scan through string looking for a match, and return a corresponding match object instance. Return None if no position in the string matches.fullmatch(string[, pos[, endpos]]) -> match object or None. Matches against all of the stringmatch(string[, pos[, endpos]]) -> match object or None. Matches zero or more characters at the beginning of the string SRE 2.2.2 Copyright (c) 1997-2002 by Secret Labs AB �m*j*�)�m*j*�)�m*j*�)q*�lq*�l��4_�m*j*4_�m*j*4_'n'n����������`OFK�v*`��* ��* ���QF�QF�)�)�V�)`w�*X0��GF`UF�SF�TF� (m*0j*8�*���*���*@�5)@�`FF<��FF<���EF()`� EF��0�`DF`)���CFV)���BF�*���*p��*``�0�`GF@ YF@XF�)0=K8���* �)X`LF�)�S�KF�)`xKF�)@��HF�)���GF�)p��JF�)`{ JF�*�@IF{)@��*��*нlookup_error(errors) -> handler
Return the error handler for the specified error handling name or raise a LookupError, if no handler exists under this name.register_error(errors, handler)
Register the specified error handler under the name errors. handler must be a callable object, that will be called with an exception instance containing information about the location of the encoding/decoding error and must return a (replacement, new position) tuple._forget_codec($module, encoding, /) --
Purge the named codec from the internal codec lookup cachedecode(obj, [encoding[,errors]]) -> object
Decodes obj using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that is able to handle ValueErrors.encode(obj, [encoding[,errors]]) -> object
Encodes obj using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that can handle ValueErrors.lookup(encoding) -> CodecInfo
Looks up a codec tuple in the Python codec registry and returns a CodecInfo object.register(search_function)
Register a codec search function. Search functions are expected to take one argument, the encoding name in all lower case letters, and either return None, or a tuple of functions (encoder, decoder, stream_reader, stream_writer) (or a CodecInfo object).�����������bFdj`�aF.��`F�-`��^F�-��]F�-г�-@��-@��-p�-��n-��Z-��D-��/-��-Ы-��,��,��,��,��,��,�o,0�X,P�=,0� ,@�,���+P��+P��+`�7.М�+��+P�w+`�f+ЙR+��>+�*+��+�(.�@[F+0��ZF.���\Fproxy(object[, callback]) -- create a proxy object that weakly references 'object'. 'callback', if given, is called with a reference to the proxy when 'object' is about to be finalized.getweakrefs(object) -- return a list of all weak reference objects that point to 'object'.getweakrefcount($module, object, /) --
Return the number of weak references to 'object'.���.���������iF�. �iF�.���hF<���gFTools that operate on functions.reduce(function, sequence[, initial]) -> value
Apply a function of two arguments cumulatively to the items of a sequence, from left to right, so as to reduce the sequence to a single value. For example, reduce(lambda x, y: x+y, [1, 2, 3, 4, 5]) calculates ((((1+2)+3)+4)+5). If initial is present, it is placed before the items of the sequence in the calculation, and serves as a default when the sequence is empty.Convert a cmp= function into a key= function.partial(func, *args, **keywords) - new function with partial application of the given arguments and keywords. �q/��`jF���������mF�.��jF�.P�`lF�q(04������P0�_�0� �0/ ����`� nF?�//8@��� �D�lF��0�nF�nF qF(0�methodcaller(name, ...) --> methodcaller object
Return a callable object that calls the given method on its operand. After f = methodcaller('name'), the call f(r) returns r.name(). After g = methodcaller('name', 'date', foo=1), the call g(r) returns r.name('date', foo=1).attrgetter(attr, ...) --> attrgetter object
Return a callable object that fetches the given attribute(s) from its operand. After f = attrgetter('name'), the call f(r) returns r.name. After g = attrgetter('name', 'date'), the call g(r) returns (r.name, r.date). After h = attrgetter('name.first', 'name.last'), the call h(r) returns (r.name.first, r.name.last).itemgetter(item, ...) --> itemgetter object
Return a callable object that fetches the given item(s) from its operand. After f = itemgetter(2), the call f(r) returns r[2]. After g = itemgetter(2, 5, 3), the call g(r) returns (r[2], r[5], r[3])compare_digest(a, b) -> bool
Return 'a == b'. This function uses an approach designed to prevent timing analysis, making it appropriate for cryptography. a and b must both be of the same type: either str (ASCII only), or any type that supports the buffer protocol (e.g. bytes).
Note: If a and b are of different lengths, or if an error occurs, a timing attack could theoretically reveal information about the types and lengths of a and b--but not their values. length_hint(obj, default=0) -> int Return an estimate of the number of items in obj. This is useful for presizing containers when building from an iterable.
If the object supports len(), the result will be exact. Otherwise, it may over- or under-estimate by an arbitrary amount. The result will be an integer >= 0.Operator interface.
This module exports a set of functions implemented in C corresponding to the intrinsic operators of Python. For example, operator.add(x, y) is equivalent to the expression x+y. The function names are those used for special methods; variants without leading and trailing '__' are also provided for convenience.���yF���������{FF8��1�7��02�7��p2�7`��2�6�L8�6���2hbP�3�7��i8�)p��8�7��8�7��83�7 �`3�7���8�8���8m*���8�� 9#9p�'9=9��D9�7��3�7���3]9`�b9�7��|9�7���9|7��9t7���3l70��3d7��4W7P�84K7��`4C7p��487��4-7���4%7 �57��(57@�P57��x57`��5�6��58P�6�7��86�6���9�6`�`6�6���9��p�:�6��!:�6p�;:�6��U:�6p�n:�:��vF�6p��xF8(0���@ sFp���8 ����@@tFP��28 ���@�uF0�0�High performance data structures. - deque: ordered collection accessible from endpoints only - defaultdict: dict subclass with a default value factory _count_elements(mapping, iterable) -> None
Count elements in the iterable, updating the mapppingdefaultdict(default_factory[, ...]) --> dict with default factory
The default factory is called without arguments to produce a new value when a key is not present, in __getitem__ only. A defaultdict compares equal to a dict with the same items. All remaining arguments are treated the same as if they were passed to the dict constructor, including keyword arguments. D.copy() -> a shallow copy of D.__missing__(key) # Called by __getitem__ for missing key; pseudo-code: if self.default_factory is None: raise KeyError((key,)) self[key] = value = self.default_factory() return value Private method returning an estimate of len(list(it)).deque([iterable[, maxlen]]) --> deque object
Build an ordered collection with optimized access from its endpoints.D.__reversed__() -- return a reverse iterator over the dequeD.__sizeof__() -- size of D in memory, in bytesReturn state information for pickling.Return a shallow copy of a deque.Remove all elements from the deque.D.remove(value) -- remove first occurrence of value.D.count(value) -> integer -- return number of occurrences of valueD.reverse() -- reverse *IN PLACE*Rotate the deque n steps to the right (default n=1). If n is negative, rotates left.Extend the left side of the deque with elements from the iterableExtend the right side of the deque with elements from the iterableAdd an element to the left side of the deque.Add an element to the right side of the deque.Remove and return the leftmost element.Remove and return the rightmost element.M�-0?��n���F����������F�:����Ft;(�<{n ��FE���F�*���F4� ��F�����F4����F3��F�;`��F C�`�F�*� �Fl��FS�@�F�;� �F��`�F�;�� �F4�`��F���Fl6�`�F���@�F(;0��F(���FP�@���/;@�=�;0 �p�D �F`���@�F�F���<8��@�p��F��;8��@��F��;P�`�@�FD�F`� �H`�@�F��F`@�Functional tools for creating and using iterators.
Infinite iterators: count(start=0, step=1) --> start, start+step, start+2*step, ... cycle(p) --> p0, p1, ... plast, p0, p1, ... repeat(elem [,n]) --> elem, elem, elem, ... endlessly or up to n times
Iterators terminating on the shortest input sequence: accumulate(p[, func]) --> p0, p0+p1, p0+p1+p2 chain(p, q, ...) --> p0, p1, ... plast, q0, q1, ... chain.from_iterable([p, q, ...]) --> p0, p1, ... plast, q0, q1, ... compress(data, selectors) --> (d[0] if s[0]), (d[1] if s[1]), ... dropwhile(pred, seq) --> seq[n], seq[n+1], starting when pred fails groupby(iterable[, keyfunc]) --> sub-iterators grouped by value of keyfunc(v) filterfalse(pred, seq) --> elements of seq where pred(elem) is False islice(seq, [start,] stop [, step]) --> elements from seq[start:stop:step] starmap(fun, seq) --> fun(*seq[0]), fun(*seq[1]), ... tee(it, n=2) --> (it1, it2 , ... itn) splits one iterator into n takewhile(pred, seq) --> seq[0], seq[1], until pred fails zip_longest(p, q, ...) --> (p[0], q[0]), (p[1], q[1]), ...
Return an zip_longest object whose .__next__() method returns a tuple where the i-th element comes from the i-th iterable argument. The .__next__() method continues until the longest iterable in the argument sequence is exhausted and then it raises StopIteration. When the shorter iterables are exhausted, the fillvalue is substituted in their place. The fillvalue defaults to None or can be specified by a keyword argument. repeat(object [,times]) -> create an iterator which returns the object for the specified number of times. If not specified, returns the object endlessly.Private method returning an estimate of len(list(it)).count(start=0, step=1) --> count object
Return a count object whose .__next__() method returns consecutive values. Equivalent to:
def count(firstval=0, step=1): x = firstval while 1: yield x x += step filterfalse(function or None, sequence) --> filterfalse object
Return those items of sequence for which function(item) is false. If function is None, return the items that are false.compress(data, selectors) --> iterator over selected data
Return data elements corresponding to true selector elements. Forms a shorter iterator from selected data elements using the selectors to choose the data elements.accumulate(iterable[, func]) --> accumulate object
Return series of accumulated sums (or other binary function results).permutations(iterable[, r]) --> permutations object
Return successive r-length permutations of elements in the iterable.
Return successive r-length combinations of elements in the iterable allowing individual elements to have successive repeats. combinations_with_replacement('ABC', 2) --> AA AB AC BB BC CCcombinations(iterable, r) --> combinations object
Return successive r-length combinations of elements in the iterable.
Cartesian product of input iterables. Equivalent to nested for-loops.
For example, product(A, B) returns the same as: ((x,y) for x in A for y in B). The leftmost iterators are in the outermost for-loop, so the output tuples cycle in a manner similar to an odometer (with the rightmost element changing on every iteration).
To compute the product of an iterable with itself, specify the number of repetitions with the optional repeat keyword argument. For example, product(A, repeat=4) means the same as product(A, A, A, A).
Alternate chain() contructor taking a single iterable argument that evaluates lazily.chain(*iterables) --> chain object
Return a chain object whose .__next__() method returns elements from the first iterable until it is exhausted, then elements from the next iterable, until all of the iterables are exhausted.starmap(function, sequence) --> starmap object
Return an iterator whose values are returned from the function evaluated with an argument tuple taken from the given sequence.islice(iterable, stop) --> islice object islice(iterable, start, stop[, step]) --> islice object
Return an iterator whose next() method returns selected values from an iterable. If start is specified, will skip all preceding elements; otherwise, start defaults to zero. Step defaults to one. If specified as another value, step determines how many values are skipped between successive calls. Works like a slice() on a list but returns an iterator.takewhile(predicate, iterable) --> takewhile object
Return successive entries from an iterable as long as the predicate evaluates to true for each entry.dropwhile(predicate, iterable) --> dropwhile object
Drop items from the iterable while predicate(item) is true. Afterwards, return every element until the iterable is exhausted.cycle(iterable) --> cycle object
Return elements from the iterable until it is exhausted. Then repeat the sequence indefinitely.tee(iterable, n=2) --> tuple of n independent iterators.Iterator wrapped to make it copyableReturns an independent iterator.Data container common to multiple tee objects.groupby(iterable[, keyfunc]) -> create an iterator which returns (key, sub-iterator) grouped by each value of key(value). Set state information for unpickling.Return state information for pickling.�b��b_>�b_>j_y?<��b_>�N���b q�*����F�������� �F�@`)��F4��+@�F`�F��d�F4�d@�F4�@d@�F4�p,@�F4��,@�F4�`-@�F��F4�Pf@�F0F�F(�A�F4��h@�F�j�F(B�F4��i@�F�J�F( B�F4�Pe@�F@B�F(�A�F8@�a@�F4��d@�F��F4��,@�F4��g@�F0J�F4��,@�Fp\�F4�-@�F�]�F4�0-@�F��F�*�&�F4�p+@�F��F4��*@�F4��+@�F4��c@�F��F�?8/D`�F�b H`�F�K�? �. eD`�F0��Fp9�?(�/�kD@�F��l �F@O�? �/D@�Fp�Z`�FpR�? P0D�F �[��F6�?(�2D�F b�Q�F7�?@�=D`�Fp` @�F�C�B8�?D@�F �"��F>@8PAD`�F��$@�F�?&@00=D �F�P��F`:F@ �0D�F0 N@�F�aV@ 1D�F��^��FpSh@8p1D��F���FpTy@(�1D��FP�\`�F�W�@(2D �F�]��F�X�@(p2D�F�`_ �F�Y�@(�3@��F��3 �b��FP3�@��-@@�F�`��F�'�@ �-@04@�Fm�@8.D��F0`�7��F 5allow programmer to define multiple exit functions to be executedupon normal program termination.
Two public functions, register and unregister, are defined. unregister(func) -> None
Unregister an exit function which was previously registered using atexit.register
func - function to be unregistered_ncallbacks() -> int
Return the number of registered exit functions._clear() -> None
Clear the list of previously registered exit functions._run_exitfuncs() -> None
Run all registered exit functions.register(func, *args, **kwargs) -> func
Register a function to be executed upon normal program termination
func - function to be called at exit args - optional arguments to pass to func kwargs - optional keyword arguments to pass to func
func is returned to facilitate usage as a decorator.dj0p��F C@t�FSj�t�FC u`�FCp��F��`�F��F�o tptS_IFMT_: file type bits S_IFDIR: directory S_IFCHR: character device S_IFBLK: block device S_IFREG: regular file S_IFIFO: fifo (named pipe) S_IFLNK: symbolic link S_IFSOCK: socket file S_IFDOOR: door S_IFPORT: event port S_IFWHT: whiteout
S_ISUID: set UID bit S_ISGID: set GID bit S_ENFMT: file locking enforcement S_ISVTX: sticky bit S_IREAD: Unix V7 synonym for S_IRUSR S_IWRITE: Unix V7 synonym for S_IWUSR S_IEXEC: Unix V7 synonym for S_IXUSR S_IRWXU: mask for owner permissions S_IRUSR: read by owner S_IWUSR: write by owner S_IXUSR: execute by owner S_IRWXG: mask for group permissions S_IRGRP: read by group S_IWGRP: write by group S_IXGRP: execute by group S_IRWXO: mask for others (not in group) permissions S_IROTH: read by others S_IWOTH: write by others S_IXOTH: execute by others
UF_NODUMP: do not dump file UF_IMMUTABLE: file may not be changed UF_APPEND: file may only be appended to UF_OPAQUE: directory is opaque when viewed through a union stack UF_NOUNLINK: file may not be renamed or deleted UF_COMPRESSED: OS X: file is hfs-compressed UF_HIDDEN: OS X: file should not be displayed SF_ARCHIVED: file may be archived SF_IMMUTABLE: file may not be changed SF_APPEND: file may only be appended to SF_NOUNLINK: file may not be renamed or deleted SF_SNAPSHOT: file is a snapshot file
ST_MODE ST_INO ST_DEV ST_NLINK ST_UID ST_GID ST_SIZE ST_ATIME ST_MTIME ST_CTIME Convert a file's mode to a string of the form '-rwxrwxrwx'Return the portion of the file's mode that describes the file type.Return the portion of the file's mode that can be set by os.chmod().S_ISWHT(mode) -> bool
Return True if mode is from a whiteout.S_ISPORT(mode) -> bool
Return True if mode is from an event port.S_ISDOOR(mode) -> bool
Return True if mode is from a door.S_ISSOCK(mode) -> bool
Return True if mode is from a socket.S_ISLNK(mode) -> bool
Return True if mode is from a symbolic link.S_ISFIFO(mode) -> bool
Return True if mode is from a FIFO (named pipe).S_ISREG(mode) -> bool
Return True if mode is from a regular file.S_ISBLK(mode) -> bool
Return True if mode is from a block special device file.S_ISCHR(mode) -> bool
Return True if mode is from a character special device file.S_ISDIR(mode) -> bool
Return True if mode is from a directory.� �F��������`�FEpz��FE0z@�FE�y��FE�y��F#Epy �F,E0y��F4E�x��F=E�x@�FFE�x��FOE�x��FWEPx@�F_Ex��FfE v��Fbind_textdomain_codeset(domain, codeset) -> string Bind the C library's domain to codeset.bindtextdomain(domain, dir) -> string Bind the C library's domain to dir.textdomain(domain) -> string Set the C library's textdmain to domain, returning the new domain.dcgettext(domain, msg, category) -> string Return translation of msg in domain and category.dgettext(domain, msg) -> string Return translation of msg in domain.gettext(msg) -> string Return translation of msg.nl_langinfo(key) -> string Return the value for the locale information associated with key.strxfrm(string) -> string.
Return a string that can be used as a key for locale-aware comparisons.string,string -> int. Compares two strings according to the locale.() -> dict. Returns numeric and monetary locale-specific parameters.(integer,string=None) -> string. Activates/queries locale processing.Support for POSIX locales.�0�F����������F�E���FG���F�E@� �FxE���F�E�@�F/G���F$G ���F-G��@�F;G����F7GP���FFG� �Fopen(file, mode='r', buffering=-1, encoding=None, errors=None, newline=None, closefd=True, opener=None) -> file object
Open file and return a stream. Raise IOError upon failure.
file is either a text or byte string giving the name (and the path if the file isn't in the current working directory) of the file to be opened or an integer file descriptor of the file to be wrapped. (If a file descriptor is given, it is closed when the returned I/O object is closed, unless closefd is set to False.)
mode is an optional string that specifies the mode in which the file is opened. It defaults to 'r' which means open for reading in text mode. Other common values are 'w' for writing (truncating the file if it already exists), 'x' for creating and writing to a new file, and 'a' for appending (which on some Unix systems, means that all writes append to the end of the file regardless of the current seek position). In text mode, if encoding is not specified the encoding used is platform dependent: locale.getpreferredencoding(False) is called to get the current locale encoding. (For reading and writing raw bytes use binary mode and leave encoding unspecified.) The available modes are:
========= =============================================================== Character Meaning --------- --------------------------------------------------------------- 'r' open for reading (default) 'w' open for writing, truncating the file first 'x' create a new file and open it for writing 'a' open for writing, appending to the end of the file if it exists 'b' binary mode 't' text mode (default) '+' open a disk file for updating (reading and writing) 'U' universal newline mode (deprecated) ========= ===============================================================
The default mode is 'rt' (open for reading text). For binary random access, the mode 'w+b' opens and truncates the file to 0 bytes, while 'r+b' opens the file without truncation. The 'x' mode implies 'w' and raises an `FileExistsError` if the file already exists.
Python distinguishes between files opened in binary and text modes, even when the underlying operating system doesn't. Files opened in binary mode (appending 'b' to the mode argument) return contents as bytes objects without any decoding. In text mode (the default, or when 't' is appended to the mode argument), the contents of the file are returned as strings, the bytes having been first decoded using a platform-dependent encoding or using the specified encoding if given.
'U' mode is deprecated and will raise an exception in future versions of Python. It has no effect in Python 3. Use newline to control universal newlines mode.
buffering is an optional integer used to set the buffering policy. Pass 0 to switch buffering off (only allowed in binary mode), 1 to select line buffering (only usable in text mode), and an integer > 1 to indicate the size of a fixed-size chunk buffer. When no buffering argument is given, the default buffering policy works as follows:
* Binary files are buffered in fixed-size chunks; the size of the buffer is chosen using a heuristic trying to determine the underlying device's "block size" and falling back on `io.DEFAULT_BUFFER_SIZE`. On many systems, the buffer will typically be 4096 or 8192 bytes long.
* "Interactive" text files (files for which isatty() returns True) use line buffering. Other text files use the policy described above for binary files.
encoding is the name of the encoding used to decode or encode the file. This should only be used in text mode. The default encoding is platform dependent, but any encoding supported by Python can be passed. See the codecs module for the list of supported encodings.
errors is an optional string that specifies how encoding errors are to be handled---this argument should not be used in binary mode. Pass 'strict' to raise a ValueError exception if there is an encoding error (the default of None has the same effect), or pass 'ignore' to ignore errors. (Note that ignoring encoding errors can lead to data loss.) See the documentation for codecs.register or run 'help(codecs.Codec)' for a list of the permitted encoding error strings.
newline controls how universal newlines works (it only applies to text mode). It can be None, '', '\n', '\r', and '\r\n'. It works as follows:
* On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated.
* On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '' or '\n', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string.
If closefd is False, the underlying file descriptor will be kept open when the file is closed. This does not work when a file name is given and must be True in that case.
A custom opener can be used by passing a callable as *opener*. The underlying file descriptor for the file object is then obtained by calling *opener* with (*file*, *flags*). *opener* must return an open file descriptor (passing os.open as *opener* results in functionality similar to passing None).
open() returns a file object whose type depends on the mode, and through which the standard file operations such as reading and writing are performed. When open() is used to open a file in a text mode ('w', 'r', 'wt', 'rt', etc.), it returns a TextIOWrapper. When used to open a file in a binary mode, the returned class varies: in read binary mode, it returns a BufferedReader; in write binary and append binary modes, it returns a BufferedWriter, and in read/write mode, it returns a BufferedRandom.
It is also possible to use a string or bytearray as a file for both reading and writing. For strings StringIO can be used like a file opened in a text mode, and for bytes a BytesIO can be used like a file opened in a binary mode. The io module provides the Python interfaces to stream handling. The builtin open function is defined in this module.
At the top of the I/O hierarchy is the abstract base class IOBase. It defines the basic interface to a stream. Note, however, that there is no separation between reading and writing to streams; implementations are allowed to raise an IOError if they do not support a given operation.
Extending IOBase is RawIOBase which deals simply with the reading and writing of raw bytes to a stream. FileIO subclasses RawIOBase to provide an interface to OS files.
BufferedIOBase deals with buffering on a raw byte stream (RawIOBase). Its subclasses, BufferedWriter, BufferedReader, and BufferedRWPair buffer streams that are readable, writable, and both respectively. BufferedRandom provides a buffered interface to random access streams. BytesIO is a simple stream of in-memory bytes.
Another IOBase subclass, TextIOBase, deals with the encoding and decoding of streams into text. TextIOWrapper, which extends it, is a buffered text interface to a buffered raw stream (`BufferedIOBase`). Finally, StringIO is an in-memory stream for text.
Argument names are not part of the specification, and only the arguments of open() are intended to be used as keyword arguments.
data:
DEFAULT_BUFFER_SIZE
An int containing the default buffer size used by the module's buffered I/O classes. open() uses the file's blksize (as obtained by os.stat) if possible. =��O�O��@G G���p� �Б`�FRead until EOF, using multiple read() call.Base class for raw binary I/O.Return a list of lines from the stream.
hint can be specified to control the number of lines read: no more lines will be read if the total size (in bytes/characters) of all lines so far exceeds hint.Read and return a line from the stream.
If limit is specified, at most limit bytes will be read.
The line terminator is always b'\n' for binary files; for text files, the newlines argument to open can be used to select the line terminator(s) recognized. Return whether this is an 'interactive' stream.
Return False if it can't be determined. Returns underlying file descriptor if one exists.
An IOError is raised if the IO object does not use a file descriptor. Return whether object was opened for writing.
If False, write() will raise UnsupportedOperation.Return whether object was opened for reading.
If False, read() will raise UnsupportedOperation.Return whether object supports random access.
If False, seek(), tell() and truncate() will raise UnsupportedOperation. This method may need to do a test seek().Flush and close the IO object.
This method has no effect if the file is already closed. Flush write buffers, if applicable.
This is not implemented for read-only and non-blocking streams. Truncate file to size bytes.
File pointer is left unchanged. Size defaults to the current IO position as reported by tell(). Returns the new size.Return current stream position.Change stream position.
Change the stream position to the given byte offset. The offset is interpreted relative to the position indicated by whence. Values for whence are:
* 0 -- start of stream (the default); offset should be zero or positive * 1 -- current stream position; offset may be negative * 2 -- end of stream; offset is usually negative
Return the new absolute position.The abstract base class for all I/O classes, acting on streams of bytes. There is no public constructor.
This class provides dummy implementations for many methods that derived classes can override selectively; the default implementations represent a file that cannot be read, written or seeked.
Even though IOBase does not declare read, readinto, or write because their signatures will vary, implementations and clients should consider those methods part of the interface. Also, implementations may raise UnsupportedOperation when operations they do not support are called.
The basic type used for binary data read from or written to a file is bytes. bytearrays are accepted too, and in some cases (such as readinto) needed. Text I/O classes work with str data.
Note that calling any method (except additional calls to close(), which are ignored) on a closed stream should raise a ValueError.
IOBase (and its subclasses) support the iterator protocol, meaning that an IOBase object can be iterated over yielding the lines in a stream.
IOBase also supports the :keyword:`with` statement. In this example, fp is closed after the suite of the with statement is complete:
with open('spam.txt', 'r') as fp: fp.write('Spam and eggs!') wI�SnTS M�T�wI`�`G�TjMM�G #G$M ��D�G0�P�0���'G'G�?��O0��S�G�IP��G��@G�OP��G=���`G�I���G�X@� GUX0��G0M=MLM[M�O� G���G�qб�q��0��G�L���G�L`�writable() -> bool. True if file was opened in a write mode.readable() -> bool. True if file was opened in a read mode.seekable() -> bool. True if file supports random-access.isatty() -> bool. True if the file is connected to a TTY device.close() -> None. Close the file.
A closed file cannot be used for further I/O operations. close() may be called more than once without error.readinto() -> Same as RawIOBase.readinto().tell() -> int. Current file position.
Can raise OSError for non seekable files.truncate([size: int]) -> int. Truncate the file to at most size bytes and return the truncated size.
Size defaults to the current file position, as returned by tell(). The current file position is changed to the value of size.seek(offset: int[, whence: int]) -> int. Move to new file position and return the file position.
Argument offset is a byte count. Optional argument whence defaults to SEEK_SET or 0 (offset from start of file, offset should be >= 0); other values are SEEK_CUR or 1 (move relative to current position, positive or negative), and SEEK_END or 2 (move relative to end of file, usually negative, although many platforms allow seeking beyond the end of a file).
Note that not all file objects are seekable.fileno() -> int. Return the underlying file descriptor (an integer).write(b: bytes) -> int. Write bytes b to file, return number written.
Only makes one system call, so not all of the data may be written. The number of bytes actually written is returned. In non-blocking mode, returns None if the write would block.readall() -> bytes. read all data from the file, returned as bytes.
In non-blocking mode, returns as much as is immediately available, or None if no data is available. Return an empty bytes object at EOF.read(size: int) -> bytes. read at most size bytes, returned as bytes.
Only makes one system call, so less data may be returned than requested In non-blocking mode, returns None if no data is available. Return an empty bytes object at EOF.file(name: str[, mode: str][, opener: None]) -> file IO object
Open a file. The mode can be 'r' (default), 'w', 'x' or 'a' for reading, writing, exclusive creation or appending. The file will be created if it doesn't exist when opened for writing or appending; it will be truncated when opened for writing. A FileExistsError will be raised if it already exists when opened for creating. Opening a file for creating implies writing so this mode behaves in a similar way to 'w'.Add a '+' to the mode to allow simultaneous reading and writing. A custom opener can be used by passing a callable as *opener*. The underlying file descriptor for the file object is then obtained by calling opener with (*name*, *flags*). *opener* must return an open file descriptor (passing os.open as *opener* results in functionality similar to passing None).=�}O�O�H1O M�O��O�H��pP�O���O�Tм�1GwI��0GS0��+G]����/G�SP�`-G�I�,G��`,G=��� +G�I���*G�XP�@*GUX �*G�O�`/G���*GuO�<�p����O(��p�D�2G����`7G`6G�6G ��`�BytesIO([buffer]) -> object
Create a buffered I/O implementation using an in-memory bytes buffer, ready for reading and writing.close() -> None. Disable all I/O operations.writelines(lines) -> None. Write bytes objects to the file.
Note that newlines are not added. The argument can be any iterable object producing bytes objects. This is equivalent to calling write() for each bytes object.write(bytes) -> int. Write bytes to file.
Return the number of bytes written.seek(pos[, whence]) -> int. Change stream position.
Seek to byte offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos may be negative; 2 End of stream - pos usually negative. Returns the new absolute position.truncate([size]) -> int. Truncate the file to at most size bytes.
Size defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new size. readinto(bytearray) -> int. Read up to len(b) bytes into b.
Returns number of bytes read (0 for EOF), or None if the object is set not to block as has no data to read.readlines([size]) -> list of strings, each a line from the file.
Call readline() repeatedly and return a list of the lines so read. The optional size argument, if given, is an approximate bound on the total number of bytes in the lines returned. readline([size]) -> next line from the file, as a bytes object.
Retain newline. A non-negative size argument limits the maximum number of bytes to return (an incomplete line may be returned then). Return an empty bytes object at EOF. read1(size) -> read at most size bytes, returned as a bytes object.
If the size argument is negative or omitted, read until EOF is reached. Return an empty bytes object at EOF.read([size]) -> read at most size bytes, returned as a bytes object.
If the size argument is negative, read until EOF is reached. Return an empty bytes object at EOF.tell() -> current file position, an integer isatty() -> False.
Always returns False since BytesIO objects are not connected to a tty-like device.getvalue() -> bytes.
Retrieve the entire contents of the BytesIO object.getbuffer() -> bytes.
Get a read-write view over the contents of the BytesIO object.flush() -> None. Does nothing.seekable() -> bool. Returns True if the IO object can be seeked.writable() -> bool. Returns True if the IO object can be written.readable() -> bool. Returns True if the IO object can be read.]Q���GG@��p����X��FG�I��@EGUX���EG=� ��;G�OP� EG� ��CG�I���CG]���<G�L��<GuT@� BGS��`?G�� AG�L@� @G�T0��BG|Q���DG�Q@�`DG�S��@=G����>G<�p���(���O���QpQH��D ;G`���8��GG�JG0��0�A buffered interface to random access streams.
The constructor creates a reader and writer for a seekable stream, raw, given in the first argument. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE. A buffered reader and writer object together.
A buffered reader object and buffered writer object put together to form a sequential IO object that can read and write. This is typically used with a socket or two-way pipe.
reader and writer are RawIOBase objects that are readable and writeable respectively. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE. A buffer for a writeable sequential RawIO object.
The constructor creates a BufferedWriter for the given writeable raw stream. If the buffer_size is not given, it defaults to DEFAULT_BUFFER_SIZE. Create a new buffered reader using the given readable raw IO object.Write the given buffer to the IO stream.
Returns the number of bytes written, which is never less than len(b).
Raises BlockingIOError if the buffer is full and the underlying raw stream cannot accept more data at the moment. Read and return up to n bytes, with at most one read() call to the underlying raw stream. A short result does not imply that EOF is imminent.
Returns an empty bytes object on EOF. Read and return up to n bytes.
If the argument is omitted, None, or negative, reads and returns all data until EOF.
If the argument is positive, and the underlying raw stream is not 'interactive', multiple raw reads may be issued to satisfy the byte count (unless EOF is reached first). But for interactive raw streams (as well as sockets and pipes), at most one raw read will be issued, and a short result does not imply that EOF is imminent.
Returns an empty bytes object on EOF.
Returns None if the underlying raw stream was open in non-blocking mode and no data is available at the moment. Disconnect this buffer from its underlying raw stream and return it.
After the raw stream has been detached, the buffer is in an unusable state. Base class for buffered IO objects.
The main difference with RawIOBase is that the read() method supports omitting the size argument, and does not have a default implementation that defers to readinto().
In addition, read(), readinto() and write() may raise BlockingIOError if the underlying raw stream is in non-blocking mode and not ready; unlike their raw counterparts, they will never return None.
A typical implementation should not inherit from a RawIOBase implementation, but wrap one. �T�p���D�LG`����`@`G�_G _G����T0p�D�MG �@�(@cG�bG ���T�p���DOG`�����eG`eG�dG�@�U�p���D�OG`����`iG�hG�gG��UUG�kG�O������O��q� M(=��S���Ip��X@�UX��O�����uO��<�0��O0�S0�I@����TpuT SP�nT`]��(`��O@��T�nT��uT��S��]�`��O@��X �UX�=� ���<�0��O������O��q� M(=��S���Ip��X@�UX��O�����uO��<�0�]�����O0�S0�I@�(`��O������O��q� M(S���O��=���Ip��X@�UX��O�����uO��<�0��TpnT`uT SP��S0�I@���(`�S �`TG�T�RGuT�@QGS��]���@PG]�UXS�XuT�TnT���O��OuO=�Character and line based layer over a BufferedIOBase object, buffer.
encoding gives the name of the encoding that the stream will be decoded or encoded with. It defaults to locale.getpreferredencoding(False).
errors determines the strictness of encoding and decoding (see help(codecs.Codec) or the documentation for codecs.register) and defaults to "strict".
newline controls how line endings are handled. It can be None, '', '\n', '\r', and '\r\n'. It works as follows:
* On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated.
* On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '' or '\n', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string.
If line_buffering is True, a call to flush is implied when a call to write contains a newline character.Codec used when reading a file in universal newlines mode. It wraps another incremental decoder, translating \r\n and \r into \n. It also records the types of newlines encountered. When used with translate=False, it ensures that the newline sequence is returned in one piece. When used with decoder=None, it expects unicode strings as decode input and translates newlines without first invoking an external decoder. The error setting of the decoder or encoder.
Subclasses should override. Line endings translated so far.
Only line endings translated during reading are considered.
Subclasses should override. Encoding of the text stream.
Subclasses should override. Write string to stream. Returns the number of characters written (which is always equal to the length of the string). Read until newline or EOF.
Returns an empty string if EOF is hit immediately. Read at most n characters from stream.
Read from underlying buffer until we have n characters or we hit EOF. If n is negative or omitted, read until EOF. Separate the underlying buffer from the TextIOBase and return it.
After the underlying buffer has been detached, the TextIO is in an unusable state. Base class for text I/O.
This class provides a character and line based interface to stream I/O. There is no readinto method because Python's character strings are immutable. There is no public constructor. �W��^@:D�mGP<�'��z�GG~G��+�X(p%@sG�G��G�(�X@xG �G��G���B�O�EnI�D�k�?�X�D�C�(Ez �WX M`SP>]�@Y�T�kz�O�G=��E�O�B�I0B�X�AUXpA�A<�`(�SpQ�I I��7B��7��p7�P7��07��7���C���6���6��PCnI�)�-`g{n�*ln�?I`=�`%�uGnIp_`uG�k`_uGSP(�wG�T@(wG0(�vG]� ( vGUX�Iln�I�SI��XuT�Tq����O��X�O�O�-uO=�seekable() -> bool. Returns True if the IO object can be seeked.writable() -> bool. Returns True if the IO object can be written.readable() -> bool. Returns True if the IO object can be read.Close the IO object. Attempting any further operation after the object is closed will raise a ValueError.
This method has no effect if the file is already closed. Write string to file.
Returns the number of characters written, which is always equal to the length of the string. Change stream position.
Seek to character offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos must be 0; 2 End of stream - pos must be 0. Returns the new absolute position. Truncate size to pos.
The pos argument defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new absolute position. Read until newline or EOF.
Returns an empty string if EOF is hit immediately. Read at most n characters, returned as a string.
If the argument is negative or omitted, read until EOF is reached. Return an empty string at EOF. Tell the current file position.Retrieve the entire contents of the object.Text I/O implementation using an in-memory buffer.
The initial_value argument sets the value of object. The newline argument is like the one of TextIOWrapper's constructor.;^x�D��G0|P|p���G �Gh���|�Op�nI��W�=� �@�G�Q@���G�T���G��`�G�I�`�G����G�SP}��G]�0��G�I�@�G�X���GUXP���G<�����zipimport provides support for importing Python modules from Zip archives.
This module exports three objects: - zipimporter: a class; its constructor takes a path to a Zip archive. - ZipImportError: exception raised by zipimporter objects. It's a subclass of ImportError, so it can be caught as ImportError, too. - _zip_directory_cache: a dict, mapping archive paths to zip directory info dicts, as used in zipimporter._files.
It is usually not needed to use the zipimport module explicitly; it is used by the builtin import mechanism for sys.path items that are paths to Zip archives.zipimporter(archivepath) -> zipimporter object
Create a new zipimporter instance. 'archivepath' must be a path to a zipfile, or to a specific path inside a zipfile. For example, it can be '/tmp/myimport.zip', or '/tmp/myimport.zip/mydirectory', if mydirectory is a valid directory inside the archive.
'ZipImportError is raised if 'archivepath' doesn't point to a valid Zip archive.
The 'archive' attribute of zipimporter objects contains the name of the zipfile targeted.get_filename(fullname) -> filename string.
Return the filename for the specified module.get_source(fullname) -> source string.
Return the source code for the specified module. Raise ZipImportError if the module couldn't be found, return None if the archive does contain the module, but has no source for it.get_code(fullname) -> code object.
Return the code object for the specified module. Raise ZipImportError if the module couldn't be found.is_package(fullname) -> bool.
Return True if the module specified by fullname is a package. Raise ZipImportError if the module couldn't be found.get_data(pathname) -> string with file data.
Return the data associated with 'pathname'. Raise IOError if the file wasn't found.load_module(fullname) -> module.
Load the module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the imported module, or raises ZipImportError if it wasn't found.find_loader(fullname, path=None) -> self, str or None.
Search for a module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the zipimporter instance itself if the module was found, a string containing the full path name if it's possibly a portion of a namespace package, or None otherwise. The optional 'path' argument is ignored -- it's there for compatibility with the importer protocol.find_module(fullname, path=None) -> self or None.
Search for a module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the zipimporter instance itself if the module was found, or None if it wasn't. The optional 'path' argument is ignored -- it's there for compatibility with the importer protocol./__init__.pyc/__init__.pyo/__init__.py.pyc.pyo.py a����G��������Aa7�� `����GIa����G�_���G�^`�@�G�_��G0_� �G�_p���G_@���G+a(`���D�G`���G �G�faulthandler module.����}O�j}O�j-��?}Ow��j}O�jP@���G�Gp�qj���d3����d�j0�e|j`�He�j`��e�j0��fdj�gSj���gj��Hhk���hk���h!k@�i)k�0i1k�Xi9kp��iFk��iVk`ktk�k�k"j�O�OqjDebug module to trace memory blocks allocated by Python.get_traced_memory() -> (int, int)
Get the current size and peak size of memory blocks traced by the tracemalloc module as a tuple: (current: int, peak: int).get_tracemalloc_memory() -> int
Get the memory usage in bytes of the tracemalloc module used internally to trace memory allocations.get_traceback_limit() -> int
Get the maximum number of frames stored in the traceback of a trace.
By default, a trace of an allocated memory block only stores the most recent frame: the limit is 1.stop()
Stop tracing Python memory allocations and clear traces of memory blocks allocated by Python.start(nframe: int=1)
Start tracing Python memory allocations. Set also the maximum number of frames stored in the traceback of a trace to nframe._get_object_traceback(obj)
Get the traceback where the Python object obj was allocated. Return a tuple of (filename: str, lineno: int) tuples.
Return None if the tracemalloc module is disabled or did not trace the allocation of the object._get_traces() -> list
Get traces of all memory blocks allocated by Python. Return a list of (size: int, traceback: tuple) tuples. traceback is a tuple of (filename: str, lineno: int) tuples.
Return an empty list if the tracemalloc module is disabled.clear_traces()
Clear traces of memory blocks allocated by Python.is_tracing()->bool
True if the tracemalloc module is tracing Python memory allocations, False otherwise.!� �G�G�k0��G�k`���G�k0���G�k����G<p��G� ���Gl����G&lP��G=l��`�G.����������G�d��(nxxsubtype is an example module showing how to subtype builtin types from C. test_descr.py in the standard test suite requires it in order to complete. If you don't care about the examples, and don't intend to run the Python test suite, you can recompile Python without Modules/xxsubtype.c.8� �G���������G�n0��n0 �G��G ��n(o{nP��nln���n�n0��G �G��n�o{n��nlnP��n�n���n�n��#oc@sdZed�dS(uHello world!NT(uTrueuinitializeduprint(((uflag.pyu<module>s �A[stapsdt{�ۀҹGpythonfunction__entry8@192(%rsp) 8@200(%rsp) -4@208(%rsp) 8@%rbx\stapsdt�ۀйGpythonfunction__return8@192(%rsp) 8@200(%rsp) -4@208(%rsp) 8@%rbxGA$3a1�0�GA$3p1113���GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: annobinGA$running gcc 8.5.0 20210514GA*GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GOW*�GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignlibpython3.4m.so.1.0-3.4.10-11.el8.x86_64.debug�^�g�7zXZ�ִF!t/��d�~�]?�E�h=��ڊ�2N�_�I�_��I>��6�R>��BK�Q����L+\�� ߒ9DB~o:ށ��)� ������ ���A��A�Ã��Թ'ʺ��Ќ6B�n��G�/�:���[yHpgh�FX�ؒӁ�'@���,�\E��s�P���24�c�6#G2��"4��;�~SJ��uL?U��%zH_��ڜ�����z�D��~������/At����pz��O8$��k���l��E}�C��_G��7���B ����pw��� <��#�2t� BH��Z��P�H֔Ѣ��}"��l[ �^�4#��L���B��U.ڢ�.�寊 �?�y�) &�R��|� Wc��L���~s��[K�6�]d�+�Q��ak\�|�lu.��|���(|����t����\8&Kz�x$NB���� �륾�,��e�����$U=F7�]K�C5<8��L��T�1��'�,��5�����fy%PS���v�K�ڵ{e�;���0ɼ���h��Zh�$�a�`|�x�7L�.-�0��c�X���i�@��H�C���� �m��Ze5�X�!RJ��F�H��K[wʂ�#��U����#4�������E���|C0dn&?�؝ڈ���u�L��^���y{�F��1���݈���4�5t���;��ī�//���[�鈖�:'�_���s�9�e�Q���[_f���å������&��F�w�8�h7v4Q�*b��īy�Tñʱ S���+7��|��+A�d�2�;cS�$���`¢���V8`�ռ�d�eoYJ����[��k#l�jݓ0��\��6��*��ɲS�c� q�3�';�)�2�T2�Ӌ�K=�4xH��y��%��z���"e��0��mOf�h�4CŨ WF��<�PzӉ�E��+��^��sz �j�/h�y{���;��J�`l��E,�0ab��f���b�U�K���so�ґ�v6�E��߲�]��[�JRb�x�$����-�3���fU]�J;��q��G]u�;Q��V��y�zg�D��6Z�����`{����@qWނ�D���2�������\�G��r���p{��X���B��@�L413[;O��� � !`2|��^ܹ�Ը\�R~I�?8��o;�w˄t݄t�q`ϫ�%7w_�������pٳ1�� k����G�'K��X!�R;�/_8����6?ƀ�ߢ�dȢcv��a�k�H��{�@(�0�KΪX:v�� >��3Z�q�jQI'�Ԣ��%��=� [d���`�~Du2�GRo��3+|:nLa]{5�V<e�N�ce�Û�Y���)O`D/x1���ĵ����xѻ+�����uC8���Y��i�Z�R\�x�(�ߞ]8b��+�_ꗬ��s�'��a(����LY�X�X�S_|�(�Y}�k�\�B�##�X�8�N�'�'e:�Cb��cP���_$���@�6��"�����=m��o��G|�m��ݥ�-����^�f��Ӧ�٩�78\�8�}Fd��j�I���y��lU���hrm��-KoJ!t L�JLM�Ӫ�La����S�3n*�<���r����q��x5v0/Ճ\^Ԭ��4�jN]��� ��%�Ѧ��t�D!��_gf��B`Cn�d¹_c��fM@o������'U���w�Fy�2'�[@�U}��a����T%��b5t�N�eH�l5Q��L�q��"�����@��Kva`OTMF�s��A���hx���Ƴ��c�?<9��2�ᅴ�7�^���`ƀ��������ܦo�Z_EA+�:��D�n"J |�V@���hR��'�Ɛ�[m�@�/*C�[�L���� {6�� LE��ն�m���:��Kd]@O ��I\�������hY���&�&"�?���zG��^A��?/ξ����nW��T�&��d�ZYs%.ܻ����h��˨�*�X���ՄԇB_�5��?:��-xV5����I��A��̾�g�:��)���8��X�E��h��:��W?Sv���2�6�����;`g��|����(��D����B�T�_��(���7-�e<n���2�UEM�[A�i�2���@�څM{W@d[�o���@â K�oz�I����zŭ��k+p���"�{��%9R��PD��!���%�G�(�>T@���gE�>����ٶ�Q�2�txF��3��P�`ou����P�5/ ����٥�F���k�e��bA��bWk�r�T�W�r�nEqU�*'[:�3�8��U,�O:�U���=Y?0"�ir���w�I�a�4�~�H�C���{w&D�5��ѽ�*�!���;�<9�D��2�&�v� ".��[�Ȟ�٤jSGf������V/��xc�'.�Eݍ�.T�d�n?�,�]nX��m��-��L�K�"?F�S-�)hJ��W=��!B��� �+!���o��n���G�74 ���,�qM�V x&�k��DKU�Me��N�+j�t�m�D�+�W��'���Gi��:C��)��,�ŏ�E&k��#���2V��o��� Q�n�S#�4�皰�Br`5&�z�|��F�?�{,Q��laLl��1��,P5h��s��$�b'��;i�-n�2���<�GBf���!�h�r�z�u�Q�Af9 ��D�D�E�8�~���'7/�ë���iR�(�$x�xt��ZK��+���"e��půNѬ�W��r��O��d�d����9h�g���K?Ⱥ� ��2����Գ=+]Z� �}�3!m ���j��v0��d�Z�o%FQ��*,���Q��>��dx3x�1�}p�8�l�>��ZM�xf��콵t�|��шu��3�ŃhlQX-�ZM�lTc���,`8P��|\�]�;��6���Q�X�v��L'؋����ly��@k�}��x= ���T��k���^ߊ�h6�5���Oe��2��祓l��k��^Tx�ȈhZ�>�X�)&٭Խ0����E�y�|����s�x1*l k�$�e<��c@�-hA�j��Tg��RQ�*܌�7!�U+�--?d�Cf@���_��7Ȱ&���K6zX>�D���2���ms�%�o̧S�z#�PI�������[C�Z���F�+>��lv�̭]��k�N��o=�]h���I�O�G�G�W9��`�.]`�V�U�a&�0��J�Z�_!W���RZ��R��V���Vd��'b�[��68�*6VM�����Ll�{�pt�y�V����Xœw�8�Y��XZ��c[a���6<}��+�P��*)�J+�_r���T[�gc �>e�$�~4g3#揇`��H�t�(n��8������'��*p0��h����"zRu�&��F6j>c�fo�=Y�4��7���2�ȋ���}q�R���@���8Jm�%ް9ᚴo����Y2 b���2Т9�ղ���|%��[��M٧�S�{�)���<�:��m�q<O/y���wIS�e�_��,m�F���f!-iV}��y�-n��2:��wx�6 ^�s�<��a��ı$t'�E�"�7��.�vCG�:ҿ�1 J�� F/kT2�1��;y�k�:�B����l_N�3����q>��~D�p�:Z3���8P3� �������w�[�UԘ�����?��fj���ѶW����k<ޏ���.MLH�묮?� 8l.��Esw��Q[�u��]X��P�R�tC�Y?C���ǟ/�[#\r�U��i��5F}�3t�q6����_t&�w0�d:�>����&��}�Ay|��-x�q��90��|��f)<<�̷ԫn��s^Gea��~�Oe��6yZA>���2*sw��k�Z��9{��LMd�.���Z�R�r�r��g!�ٶG��quà�{�B]��A`s��K�$�7 I�b�7%u�a�un���dӶ���6\�ZK��p��24����c�zd@9�W-.��zQ��[gOd�s�C�>\f7W�DL�����@S��;�i�����u�#3gBjz��̐<0���]�����d��`���FH��!�K�6䪚s=�`R���k����4�Λ������;v� �R��¨J���TSC`�s��?T1Tܳۙ8�pԒ��r�ԋ��b����r7m����u��욤��X1������Ȝ���{�ac$pԤ-vY�\�w�hd\l�ڋ$����=|�..ZFꂡ�&8s�����d�U��8:VHY��Qzcp�6��u �����U��[&���dt�*�����&�ן&IQ��� �IYr �Țu�ZTo}ڎ�\�(-�#��wH�S;��L&�~�H�0y�h�v<�봆����CSӜ�#�3膭OKV�]h�8�x�3G�P���#�� F^ABȴ�a���w{O�{]��ꊮ"?J�I� �Ve�B�B&�Z�����8)��OJ�W7#'4c;Ӕ�,�sd�X�����c��ܳ�:w�Z��e�_"s/P�Oy7Q<Y���a�E=� ���si�Rl���a�-l&M�K�<����������U<�����T�\�B��6�d�z��`B)[��sj�j�� �;�u�{��eӡ��e���ӵ��h�h��\d(�|�ܫC�o��+n���W����>�N (ʱx,��3h�#p owy��.:��'��]\��e�[dlW�g��ݥ�����x��p�%��'����'�����l/��ƅ�����KK1�J�6ah�e�lQ�fI�|�&��d1(~m|�m؏����2������V,i�Z�-�D��YJY��8�>�TN�x�n�;AkK�Wu� �H�!B���n#�K�;�~�o�=�Z�g-[�N�ܳ�z�K,� �{�eS��H�9G��3)K�?�F�l�F�L*L�z��@������NROH5tm�YRYPv�*���7�'�������#MlL�H�Xl9:��r�O��&Y������Z�!AF�/�$yu��x��[�3��w'��}>�H.� �̛̾_O�LLT�p��o,8�`��a *��zh���·�i$4V�1<�������xG]�� EAP#���ҟ�d�%��QG^�t:1�j/.P�u�]�^��t��,��Z���$�Y�uwn��1 ��Z�?Ɲbn�:�o��G��#�`��l7�vh� 8�>�dpW�:?�a@��H���nWY%�<�&�=?�8r��M�w�v�V�w`X�����`���v�s~-��c;�n���u=-�pH�p�!e����5�v��w�G�@@9��ד�a�*���R7�e��"{�@���e�bR��a=�a��.�mJ�\@ers�E`��V9�)��Y�����Lp?���t��S��/4,�k�ל7ԙPRӳ�O��:� ���JOO=��C�RNW����h`�]��9����f��/E*�aHC�)��G��DNۨ�:K�2�L��U/���n4b�FT~���Ѳ��@E��t���s�'��Km�?~Z� ǪS|�x3@o0����o���N4-K�b�gyQ� �yAc~��'��͖����;�#ehq��/O4�e��`~/ ӓ[���P� �a+&t� i��M[|��:7يr��E��<1iaH�O�o��}Ȥ���%�-D���?p쌟d�� �{tE~�Px����R�T^��>��V�HB=C|��{��"ˠ8��y�j(�^mk�`�����+�V�����d��q?31�5���jٻ�#ŬZS�3���� j(@�����v ���x'�F� 0�����I\٩=r�7bhg�k��W1�툶�����y��������;�,9<�W�I4�����-`-0-�ܩ�ܖ'l�l�<� �^Hy"��2;��@LT���X_���>���NjuP3�(k��;�ˢ�2����� :r&b�Gg|H�'W�N��6K�z,�^1~l�7��FǁQp�xXW66�<�P2�� �}����iS��cX`���{�:��'����E��w8�ik���� 9F0�n\#�T��Q�,mu�+�.]�)���쫳[��J��͒yk+�52�֝�� �PQ!����x����`��%���Qvpؗ�[i;P��]0���X�XTؖ��0:FH����_� ܟ���=/�am8̀�C���"�R�W������ȅ���]�X �?4"����Th�(�����a�K���$Ϲ�H� ����|�7�M�JR>B���#�Il��G�M��� j�1�Yn�?A�6קKؕ�%����*s��H.�Ӿ9�{�p���51�vKm��F��S���r�kG�+3;���e��wې��A�v�{��B, ;[$c@����0b~�|K2&��*�#�J�?4&���rꗈ�8���ܑ����秞�o�o"}��3P� 7�� ��.�2)31]hP)�~y�0�-՚�dvx���j������2��O���:}^"t�=sk2je��<��}�@�X��K�\ڀ��-:�j�+U�#�N��g/����)i�ri�gћҕ�k�0 ��n�;���wy����MS� � �%�ܚ�ѹ���P�ZEo/��LyK�]bA�%X�/=+a���A�\Z��(�V�7̡�F�&��u��]�K���A�B1C/<<G&�(��4�HYʟ��Ǻ3��Sp!��i�P�3(�"��ޕ�j־�q�6�7��}at�bU/d��#�T_�8rF�R�tm�'+?�H�Y�Kܔj�3l9��èՃ$���m���id-�Uvf���-U���Cyh X�v�p�2���_�2v7��&_�A��N�0����6�٠�y���Ꚇ��ן���v�e��hq���6[�5���@?��#1� }�%g���g�Vx�tO�M�� p��V����HEќ��}���Ń�u�����9�s�K;�æA���u��!�yj��"�S���pY�B[o �WV���HH6D��U����>���Y�ٌy /��<fr�4[�n��\4�٩ /����C � �#R�:���Ԉj���T\�7�X�%?d�� Ș���3z��VN��es'�!R� T�_�ɯ8"'�B�_������wBm�s�����s�ץ�[K�Dl���(�oQ���\z��f`�rbf�g�"����z۱K�"�����V.���noK?����*�7쐽^֗u�8�X��(� �I����xOh���]\D�C�Ϸ''�B���|��ltY�1:�P;������k�M��gA��o[��WX�K�Y�K�E�֟6���I��$��{ĸ�`Q�'/����8��#3����5�!�xe)���م�xg�9,Z#-�QAgڤ�8���a�N3]H1��R�ݡ@W:�(�>`_���| ��y�1|oV7ڋ����m��DV�q�t�GP#B<��We@��xm�B�����"g�J�-2�y�L���1�9��6�]#�Q���y�EE��8��f�U��7�2E�3��2v�4�*�*(?P9�@�Q�Z[z��m5��e�;��ř*%*����=6��Y���H��! �K4$���d�� i��ʎ�l@o�� ���K"���N5�KU���(A�����}�w��skr������0�� xbϼ�ȧ��J�K����= ո�2�����d�g�� P�h��S��897���� 2Q�}�okc#��&�\̺e�F!W��_�~TL[��&��u������0�jw3�Mme��&��p�ÿ��(#N��S!5�a|@�;��&4��������0s�s�a�Z�<j��uq���9!��2��W��`f�s�z�\ �p�b�K!��ǡ�se�_ꇵ�<'`�"9N\C�׳��0O�o��)�=�p9���Q�̲X���Lok���$l�0z�����`�J�9��=�IR�<h���LP�;��'��;9z9]��4v3+d�Y�EP)��C�J��-y��@)�N��g�A�eC-��ຶ���I�!�����6��WM��L����ۏ�����:y�U��R�/)]86F�aT�C'�!��0�� ";x��c���S����I�*Q�|�!)� =P�� 2ר����h���1�*�Ij�!���8�ft��s����eF^���M��NHQ��+���X��ea�+ƻG��|Զ�-�.fo�`P����^[D�O�{�Z��x �������Y�ȺwzNI��7DH�~κ��: }5��2����B�(�ȯ�b������ܡs��9 b�-�%%���k�qN1���Uz'��C�{�fW̤k�Nm�q�� �I@�s<��-;�-}l�r7 K�qa��ѷ\�:�b|�n��p�˷���]4����F���1�[KD��Y�e�{���� V��&Q�q��T�34�{���t啂⧝�>}>�Q�њ�+7�p��]tuF�MydQ�)`s�f�Lċ "WG�i� �v^��iLZ�E^7�@���R�AJ'Z А�] �ݛ�o�Nᥡ��[�w����\K��{�X2!��m�Gm�N���:���C� 4��VO�s���wp�6Z�x ���l���K�mF�-�"����:Vp��㢬�߶ww� �=��Y_�7�H@��� ���wgbw9uz!Iw��e�qƛ˜)�=C��e���s�3��0��������ә�E��9:�a-�^1�_�%=S-b�So�A�ȗ�l�Y�j�#[+��0����5�CnX>��gn��h*��Ḳ�#�{��q$�F�;Y���Ȇ����.oG��ӖG�y���6y�2�sv}�R�[�AᚅH��z)5�X�R�1�&�f��ߩ�jvҶ�s���J���m��=���9��<����XL�0�W�4,�t �Ы�� �R;��:��X��t�[#�s)؎K�4J�%_�� �%�J��h���Ԯ��M�mI���;I�c�ɪ�͙����Ji.1�ʸMLI�$YyuA`,����xߕ7߹!��t��HyH�$#O���u���Ҋ�z�ڧy�Z��+�w��J%�G6�-Y7�g���x��Un�煱���@S;��$��Aen�bX�imh!u���>\������U\���9�n��.��y���er���$��2r���Q�*pI$1��d�އ�I"� ��W�����3�MAO 䞆��̏�q���c�L�zf�.�;�Q�w�E%��)��h&�1�qO��P�, �L��<C��PA��R��6hJoAł�\pta6���j��-{[�O��1�!�{f���&��bX^H��`\�B���SDFVg�`u!�i�=�$C��z�?o��e�yc� v͟Vo�(.K��o��0:}� T���9�2M���CӮ8Mb�H�ak��7�2��i���uVzT����i��Z�9�۠�>�$��P�L�=7���#��EaQ�aNq�R�'hv��U`� p��SH�z�,�'�7�QW�_�`�$w+���g�>�GҦ���G=b���q���W���$n�X�����p���v5������x,aZ�P֨A�3�Z=d��#���&G�;�&�S��P2v�07�����O��W�4����'�GT>)Z��*��a"�#耸�r^G��N��}�[��B�P)�^"�j�Ɇ�(����x�P�&�@(�����S�I�C��5��pσ���ՠ��\�Xc?��de <�<8�� �.H�;qr�~��ИBA��Ic2��/�fz��W "�q=A���� �(�0��0OIã���o���o�DN��*n�����Y@���.�Er��|�����%I��güc5��}�LN��T:������\h8�K���r���̊��R{�LXl���� �����l��-a��x[����Ȫ�&2�|p��6K�Q�'�)��8I�AfB��~ a�HNu�R�^��k.����9�鄛bFQ�vz�٨L0 0~T��Gx@>2R$kv7.��?��=w��q��o���"��I�#���N�Lvf#����a?��6l�{/�����м�%+�7������?w�V\�A���<�U����p�n=8.��\�)R�$�FTʍZ�g��4d�����u��m�_t�Clc>}U�0�L9��z�=m[�Q���9�v����"W�+��l�I�<OÊ\��ۺ� B�e�"3{���!le��@`�'F��?Sb��'��;B��.\0�([�\�d(D��7ւ0`�r�;�:f�ԕ؝{�<��`��꯷�N J���rƙ1c��K�!�Y�.-�}���.ϕ';dBq�D}�_�x�Q���f��$�&�/gF��c�bD���1��x�,�e��skد� ��jp�J'�+�&w��$���ڟ��?w�{t�Q+�є�u���̐R��備]��h���䒟Du+~%��>'R�?=���4s��Y .�B�]�K�r<�؏�A���`@����W��\���R� �yL�2YG.�TfeU_L�0���B̊}[� �֧-2��y)�~v�U��r������q�w�� 9���r7� n�zG3Ѐ�c��_��F��Dx��� �t�}����Bo�dy�sd�i�)�]����R�Ma�ER�1����r�8C� ��L��h�0��7�ԝ�x�_��'�&L.�q7y�C�!B!O|К';d�tw�(]s�a�C(�'��I���Nx����;�@�)���.�B�(������Ng̯VĚ �?�Gt����c%�@B@�r�`:h�،a�ƍ�Fk�����&��4����y�$�M��U0/vsŔ$=v�ko$3~���yU{��5�m[9���O���G�KM��ݔ�{�{N�r�-@X���ƻ��np���:Cp�tIr��4x�%��O� �T �h�����Q����]�� ��f��6Ps�gv�PDy�bMJ����#f��n��A�m��m���l���k��^9��ڴ����.nD�/]�e�L��OZ�-��^]PѶ�4x��S�K��\�40ڥKأU�XP=e�MWfd�?�-�t��t������5QXTlrbO����8i�䒻mcʨ�j���v�N�7&$A��0_��=t��Aq���%��-��8�_T!��v��>`D}=��'���tW_{�R۵��M�<� T�i�<0/�q:朵�e�TP�F?I��\6��_�Le��u{�2�c��A�p[�,^k�4i)�YB��ڳ=�s��k�8�:�NnTTN��9$GZI���?���W�3��n��H��*��]��fj��r���7`I"5ɣ��q�c�1+ݻ��eܗ������#,�7�j��S��!����H+�9Yք���V���<��m��"w��8A\�D�1ipx�L�{J�=�S(s�-Lg�d2r��7]�qr/�E�a��G����� [-.ؘ�)RA���V���J���c�ߘ��O�E��;������|w9&�����b� �0a���ܞ�,�x��*��3��=LG?|~Jp��/�T�Zi�Ln��d��a�P��蟤F؈z����N�@�T�OcM��j1D�։��Q�>��.�����$���