wstrlegacy UCS2legacy asciilegacy latin1legacy UCS4<legacy invalid kind><invalid compact kind>strictsurrogateescapeignorebackslashreplacesurrogatepassxmlcharrefreplaceCP_UTF8impossible<bad format char>PYTHONCOERCECLOCALExb+xbab+wbrb+rbpymallocpymalloc_debug646ansi_x3.4_1968ansi_x3.4_1986ansi_x3_4_1968cp367csasciiibm367iso646_usiso_646.irv_1991iso_ir_6us_asciiPOSIXutf-8RUNNING_ON_VALGRINDlinuxmust be %.50s, not %.50s%d %ss * %zd bytes each%48s free %d-sized PyTupleObjectfree PyCFunctionObjectfree PyDictObjectfree PyListObjectfree PyFrameObjectfree PyFloatObjectfree PyMethodObject%5u %6u %11zu %15zu %13zu # times object malloc called# arenas allocated total# arenas reclaimed# arenas highwater mark# arenas allocated current%zu arenas * %d bytes/arena# bytes in allocated blocks# bytes in available blocks%u unused pools * %d bytes# bytes lost to pool headers# bytes lost to quantizationTotalPYTHONMALLOCSTATSXXX too many states! XXX ambiguity! %s%s%s, %.20s, %.9s08:08:09Dec 5 20243.6.8%.80s (%.80s) %.80sLC_ALLLC_CTYPEPYTHONHOME<stdin>???-J is reserved for Jython Unknown option: -%c infnanInfinityNaN\x\u\Usem_initsem_destroysem_timedwaitsem_trywaitsem_waitsem_postFatal Python error: %s in new threadGC object already trackedCould not allocate TLS entryopcode = %d PyCompile_OpcodeStackEffect()PyCOND_INIT(gil_cond) failedtake_gil: NULL tstatePyCOND_WAIT(gil_cond) failedPyCOND_FINI(gil_cond) faileddrop_gil: GIL is not lockedNon-statement found: %d %ddeallocating <dummy key>deallocating NotImplementeddeallocating NoneXXX block stack overflowXXX block stack underflowout of memno mem for new grammarLabel %d/'%s' not found grammar.c:findlabel()no mem for bitsetNT%d%.32s(%.32s)invalid labelSubset DFA %s Subset %d (finish) { %d Arc to state %d, label %s Translating label %s ... Label %s is non-terminal %d. Label %s is terminal %d. Label %s is a keyword Can't alloc dest '%s' Unknown OP label %s Can't translate label '%s' Label @ %8p, %d: %s Calculate FIRST set for '%s' Left-recursion for '%s' Left-recursion below '%s' FIRST set for '%s': { } Adding FIRST sets ... no mem for new nfa grammarno mem for new nfaDump of NFA for '%s' ... %c%2d%c -> %2d %sMaking DFA for '%s' ... before minimizingRename state %d to %d. after minimizingwaswere%U() keywords must be stringsfrom %zd to %zdOs <unknown>filtersalways_showwarnmsgonce:%d: lost sys.stderr WarningMessage__warningregistry____name__<string>__file____main__Empty module namemodule name must be a stringlevel must be >= 0'__name__' not in globalsglobals must be a dictpackage must be a string__name__ must be a string%U.%U<frozen importlib._bootstrap>_call_with_frames_removedOOOOi__builtins__{OO}_signal_strptimeencodingsunexpected end of datainvalid start byteinvalid continuation byteEllipsisCan't initialize object typeCan't initialize type typeCan't initialize weakref typeCan't initialize int typeCan't initialize bool typeCan't initialize 'str'Can't initialize list typeCan't initialize None typeCan't initialize super typeCan't initialize range typeCan't initialize dict typeCan't initialize set typeCan't initialize str typeCan't initialize slice typeCan't initialize complex typeCan't initialize float typeCan't initialize tuple typeCan't initialize StdPrinterCan't initialize code typeCan't initialize frame typeCan't initialize method typeCan't initialize wrapper typeCan't initialize capsule typeCan't initialize cell typeunhashable type: '%.200s'TrueFalseException ignored in: <object repr() failed>uncollectablecollected{sisnsn}Unmatched paren in formatBad dict formatunmatched paren in formatO(On)O(O)(OOOO)(iii)tb_linenotb_lastitb_nexttb_frame[ssss]O(OO)O(OOO)(O(OOO))(d)O(O)nO(())(dd) sssO(n)O(OO)lO(())(Oi)O(O)O()(OO)O()(O)O()O(OO)(OOO)(y#)(O)OO(NiO)O(OO)OsOnnssurrogates not allowed... truncated in __subclasscheck__argument list must be a tuple(iO)<NULL>width too bigprecision too big%lu%llu%zu%u%li%lli%zi%i<zipimporter object "???"><zipimporter object "%U%c%U"><zipimporter object "%U">%s %s%3d %.2d:%.2d:%.2d %drepeat(%R)repeat(%R, %zd)<DirEntry %R>unlocked<%s %s object at %p><weakproxy at %p to %s at %p><weakref at %p; dead><super: <class '%s'>, NULL>slice(%R, %R, %R)<capsule object %s%s%s at %p><built-in function %s><released memory at %p><memory at %p><function %U at %p><coroutine object %S at %p><generator object %S at %p>%s%Rmappingproxy(%R)<member '%V' of '%s' objects><method '%V' of '%s' objects><cell at %p: empty>unclosed file %Runclosed scandir iterator %RO()O<bound method %V of %R><instancemethod %V at %p>%+.02dONOO(ONO)(%s%s%sj%sunable to start the threadI/O operation on closed filenew buffer size too largeraw stream has been detachedI/O operation on closed file.detachfilenoday of month out of rangehour out of rangeminute out of rangeseconds out of rangeday of week out of rangeday of year out of rangeclock()getrusage(RUSAGE_SELF)times()deque index out of rangepop from an empty dequenot a weakrefcannot copy this match objectdddklcan't allocate lockrelease unlocked locknot holding the import lock%.200s() argument %zd, item %d %.256sfield test is required for Iffield n is required for Numfield s is required for Strfield s is required for Bytesfield arg is required for argfield id is required for NameMissing ']' in format stringCan't initialize 'unicode'Can't create empty stringordinal not in range(128)truncated \uXXXX escapetruncated \UXXXXXXXX escape\Uxxxxxxxx out of rangerawunicodeescapeutf-16-leutf-16-betruncated dataillegal encodingillegal UTF-16 surrogateutf-32-leutf-32-be(O(Ns)N)(O(y#)N)(O()N)size must be positiveinvalid kindembedded null characterstring index out of rangecharacter out of rangetuple index out of rangepop from an empty setNoneType takes no arguments%S.%sThis object has no __dict__too many digits in integerno current thread identunknown actionOONO(()n)O(On)NO(On)(NN)bad memberdescr typelen() of unsized objectan integer is requiredinvalid argumentsmode out of rangeint too big to convertnon-tuple default argsnon-dict annotationsfrexp() result out of range__cause__ may not be deletedcharacters_written%S.%Scan't convert complex to intcan't mod complex numbers.absolute value too largeCell is emptyrepeated bytes are too longbyte string is too longbytearray(bbytearray index out of rangecan't delete attributecan't set attributeObject is not writable.input line too longcan't re-enter readlinebyte string is too large&#%d;int too large to format%ld{snsnsn}argument must be callable-0x0.0p+0-0x%sp%c%dfloat divmod()float modulofloat division by zeronegative shift countinvalid tokenexpected an indented blockunexpected indentunexpected unindentinvalid syntaxunexpected EOF while parsingexpression too longunknown decode errorunknown parsing errorerror=%d (OiiN)(sO)list index out of rangecoroutine already executinggenerator already executingsignal number out of rangecannot serialize '%s' objectreentrant call inside %RFile not open for %scallable expected, got %.50sunknown reasons[%s: %s] %s[%s] %sat least at most negative size value %zdis_notis_start_new_threadfirst arg must be callable2nd arg must be a tuplecan't start new threadissubclassOSErroritemgetter()staticmethodclassmethodself must not be Noneinstancemethodunknown operator foundunknown expr_context foundordinal not in range(256)padded string is too longinvalid widening attemptempty separatornon-ascii grouped digit__debug__identifier not readycould not ready string unexpected '{' in field nameunmatched '{' in format specattrgetter()replace string is too longrepeated string is too longexpected str, got %show_many cannot be negative(Nii)must be str, not %.100s end=" "print exec __delattr__can't set %s.%scan't delete %s.%s__qualname__bases must be types in comparison__class__op_geop_gtop_neop_eqop_leop_ltweak object has gone away<%s object at %p>cannot delete __dict__invalid integer value: %Runable to get sys.stderrsys.stderr is Nonecount(%zd)count(%R)count(%R, %R)sched_priority out of rangedoubleunknownIEEE, little-endianIEEE, big-endiancomplex modulocomplex exponentiationcomplex division by zero%.200s attribute not set(Nn)expected bytes, %.200s foundembedded null bytelineno must be an integerlineno out of rangeipow@op_matmulop_sub&op_and_divmod>>op_rshift%op_mod//op_floordivop_truediv<<op_lshift|op_or_^op_xorop_addBuffer is NULLread-only bytes-like objectcontiguous buffer
can't concat %.100s to %.100sno such groupprecision too largegid is less than minimumgid is greater than maximumuid is less than minimumuid is greater than maximumfd is greater than maximumfd is less than minimumslice step cannot be zerolength should not be negative(NNN)byte must be in range(0, 256)op_concat%U (%s: %S)filterfalse()starmap()takewhile()dropwhile()cycle()chain()O(Nn)nO(OnNn)nO()NNO(()n)NNfilterfilter()sum(unknown)DelAugLoadAugStoreParamCompare with no comparatorsnon-numeric type in Numnon-string type in Strnon-bytes type in Bytesunexpected expressionDeletetargetsempty %s on %sExtSlicedimsunknown slice nodeClassDefAsyncForWhileAsyncWithTryExceptHandlerImportNegative ImportFrom levelImportFromGlobalNonlocalAsyncFunctionDefunexpected statementimpossible module nodecount exceeds C integer sizeindex exceeds C integer sizeindexOfcountOfop_contains%R is not in rangeiso-8859-1utf-8-iso-latin-1iso-8859-1-iso-latin-1-encoding problem: %sencoding problem: %s with BOMno mem for sys.path insertionsys.path.insert(0) failedInvalid format specifier ... File in Current thread 0xThread 0x (most recent call first): Fatal Python error: (Cn)*=op_getitemcharacter maps to <undefined>charmapop_setitemop_delitemframe does not existspanrange(%R, %R)range(%R, %R, %R)ref()__doc____module__expected a message argumenthandler must be callable# clear[1] %s # clear[2] %s BaseExceptionTypeErrorStopAsyncIterationStopIterationGeneratorExitSystemExitKeyboardInterruptModuleNotFoundErrorEnvironmentErrorEOFErrorRuntimeErrorRecursionErrorNotImplementedErrorNameErrorUnboundLocalErrorAttributeErrorSyntaxErrorIndentationErrorTabErrorIndexErrorKeyErrorValueErrorUnicodeErrorUnicodeEncodeErrorUnicodeDecodeErrorUnicodeTranslateErrorAssertionErrorArithmeticErrorFloatingPointErrorOverflowErrorZeroDivisionErrorSystemErrorReferenceErrorBufferErrorMemoryErrorUserWarningPendingDeprecationWarningSyntaxWarningRuntimeWarningFutureWarningImportWarningUnicodeWarningBytesWarningResourceWarningConnectionErrorBlockingIOErrorerrmap insertion problem.BrokenPipeErrorChildProcessErrorConnectionAbortedErrorConnectionRefusedErrorConnectionResetErrorFileExistsErrorFileNotFoundErrorIsADirectoryErrorNotADirectoryErrorInterruptedErrorPermissionErrorProcessLookupErrorTimeoutErrorPYTHONFAULTHANDLERfaulthandler_bootstrap*op_mul+=op_iadd^=op_ixor&=op_iand>>=op_irshift@=op_imatmulop_itruediv%=op_imodop_imulop_iconcat<<=op_ilshift-=op_isub//=op_ifloordiv|=op_iorfrozenset()iter index too largerange()N(Os)N(OO)N(ON)can't create sys.pathcan't assign sys.path(O(OO))nameless modulemodule '%s' has no __dict__module filename missing<class '%U.%U'><class '%s'>fillvalueno mem for sys.argvcan't assign sys.argv%U%s%U%U%c%U%c%U%Uunknown symbol table entrypath_importer_cache_count_elementshasattrcan't allocate read lock<%U.%U object at %p>args may not be deletedreversedreversed()compiler_make_closure()islice()module has no attribute '%U'cannot delete memorysub-views are not implementedmemoryview: invalid slice keyzip()writeobject with NULL filetracebacklimit File "%U", line %d, in %U File "%U", line %d ^ : <exception str() failed>%S (%U, line %ld)%S (%U)%S (line %ld)[Errno %S] %S: %R -> %R[Errno %S] %S: %R[Errno %S] %SMax string recursion exceededreducedecoding%s with '%s' codec failedunknown encoding: %scodecs.encode()codecs.decode()CODESET is not set or empty(i)EOF when reading a linennOnsOOs(O){sOss}_astOOOOunreadable attribute(nO)__len__() should return >= 0getattrreadonly attributeTruncation of value to charTruncation of value to shortTruncation of value to intbad memberdescr type for %sPYTHONINTMAXSTRDIGITSformat requires a mappingincomplete format key* wants int%c arg not in range(0x110000)%c requires int or charincomplete formata numberprec too big%c arg not in range(256)utf-32utf-16iso_8859_1iso8859_1str or Nonestr, bytes or bytearrayis not retrievablea byte string of length 1a unicode charactersize does not fit in an int(unicode conversion error)(buffer is NULL)(AsCharBuffer failed)(encoding failed)(buffer_len is NULL)(unspecified)read-write bytes-like object(impossible<bad format char>)at mostexactlyat leastEmpty keyword parameter nameEmpty parameter name after $%s: '%s'invalid SRE codepatternd|iOi:dump_traceback_latertimeout value is too largeTimeout (%lu:%02lu:%02lu)! |Oi:dump_tracebackO:cmp_to_keyO:KOOpO:lru_cacheinvalid generation|OOi:set_int_max_str_digitsO|O:getsizeofO|O:round|$OO%s() arg is an empty sequence:__call__|O:tupleU|O:module.__init__@?@d@f@N@n@Q@q@L@l@I@i@H@h@B@b@c@PO|Omemoryview: internal errorO:memoryviewO|p:move_to_end|p:popitemdictionary is emptyO|O:popO|O:fromkeysO|O:setdefaultOU|O:from_byteslittlenU|O:to_bytes|OO:intint() missing string argument|Oi:sortlist modified during sortcompile.c compiler unitO!O!|OOO:functionarg 5 (closure) must be tuple|O:floatO|O:enumerateO:mappingproxy|OO:complex|O:boolOO:compressO|O:accumulateO|O:groupbyO|n:repeatr must be non-negativeOn:combinations|n:productrepeat argument too largeO|O:permutationsExpected int as r|OO:counta number is required|i:expandtabsnew string is too long|On:rsplit|On:split|$OO:ImportErrorresult too longexcess ')' in getargs formatmissing ')' in getargs format%.200s%s takes no argumentsbad format string: %.200sw*:readintoi:alarmi:getsignalU:is_builtinU:is_frozenU:is_frozen_packagei:chrs:_forget_codecs:lookup_errorU:charmap_builds:lookupi:WCOREDUMPO&:minorO&:majori:isattyy*:rpartitiony*:partitionU:fromhexvalue not found in bytearrayO&:appendi:setstate:getstateOU|iy|i:fatal_error|i:_sigsegvi:unregisterU:zipimporter.is_packagecan't find module %RU|O:zipimporter.find_moduleO[]O[O]n|i:seeknegative seek value %zdnew position too largeiiiiiiiiimktime argument out of rangeO!|nO|O&O&:index%R is not in deque|n:rotatenO:insertO|n:length_hintOO:compare_digestO!O:_remove_dead_weakref|n:stack_sizesize not valid: %zd bytes(kl):_acquire_restorecouldn't acquire locki|ii:set_thresholdi:set_debugi:setdlopenflagsOO!:call_tracingi:setrecursionlimiti:setcheckintervalU:interncan't intern %.400s|i:_getframecall stack is not deep enoughd:setswitchintervalO!U:_fix_co_filenameO|U:format|O!O:supersuper(): no current framesuper(): no code objectsuper(): no argumentssuper(): arg[0] deletedsuper(): bad __class__ cellsuper(): empty __class__ cellU:__format__%R is not in listss:__setformat__%s0%se%dNegative seek position %zdnot readableOO;illegal decoder stateOO|n:BufferedRWPairU:strxfrmUU:strcollstate is not a tupleArguments must be iterators.O!iIndex out of rangeOO!OInvalid argumentsO!O!sO:register_errors*|z:readbuffer_encodeNny*|zO:charmap_decodeU|zO:charmap_encodey*|z:ascii_decodeU|z:ascii_encodey*|z:latin_1_decodeU|z:latin_1_encodeU|z:raw_unicode_escape_encodeO|z:unicode_internal_encodeU|z:unicode_escape_encodey*|zii:utf_32_ex_decodeNniy*|zi:utf_32_be_decodey*|zi:utf_32_le_decodey*|zi:utf_32_decodeU|z:utf_32_be_encodeU|z:utf_32_le_encodeU|zi:utf_32_encodey*|zii:utf_16_ex_decodey*|zi:utf_16_be_decodey*|zi:utf_16_le_decodey*|zi:utf_16_decodeU|z:utf_7_encodey*|zi:utf_8_decodeU|z:utf_8_encodeO!|z:escape_encodestring is too large to encodeii:getlowerii:makedev|i:stat_float_timesii:closerangeO|UU:maketransn:zfilln|O&:rjustn|O&:ljustn|O&:centerUU|n:replace|O:strip%s arg must be None or strO!O!nnO!O!OnnO!y*y*|n:replacereplace bytes are too longreplace bytes is too longn|c:centern|c:rjustn|c:ljusty*y*:maketrans|i:__reduce_ex__|n:poppop from empty bytearraypop index out of rangenO&:insertsubstring not foundrindex|O:lstripsubsection not foundrfind|O:rstripstartswithendswith|Oss:bytesnegative countTrailing \ in stringinvalid escape sequence '\%c's*|z:escape_decode|Oss:bytearrayU|z:utf_16_be_encodeU|z:utf_16_le_encodeU|zi:utf_16_encodesy#nnOszzsizsi|z:setlocaleunsupported locale settinglocale query failedi:nl_langinfounsupported langinfo constanti:strerrorfailed to get LC_CTYPE localeint_curr_symbolcurrency_symbolmon_decimal_pointmon_thousands_sepmon_groupingpositive_signnegative_signint_frac_digitsp_cs_precedesp_sep_by_spacen_cs_precedesn_sep_by_spacep_sign_posnn_sign_posn(iOOiO)(iOO)|Oi:enablei|Oii:registerO|i:seekwritingi:clock_gettimeiO:clock_settimeii:siginterrupti:getitimerid|d:setitimeriO:pthread_sigmaskli:pthread_killiO:signaliiOn:sendfileO&O&:initgroupstoo many groupsgroups must be integersO&:sysconfiiO&:preadO&O&O&:setresgidO&O&O&:setresuidiO&:fpathconfO&:unsetenviO&O&i:posix_fadviseiO&O&:posix_fallocateiO&:ftruncatei:pipe2(ii)iy*O&:pwriteiO:writeviO:readviO&i:lseekiiO&:lockfii:tcsetpgrpi:tcgetpgrpii:setpgidi:getsidii:waitpidNiO&O&:setregidO&:setegidO&:setgidO&O&:setreuidO&:seteuidO&:setuidii:killpgin:killi:sched_getaffinityiO:sched_setaffinitynegative CPU numberCPU number too largeiiO&:sched_setscheduleriO&:sched_setparami:sched_rr_get_intervali:sched_getscheduleri:umaski:niceO&O&:putenv%s=%ssO&:getgrouplisti:get_inheritableii:set_inheritablePYTHONPATH/usrlib64/python3.6i:dupunknown dlopen() error./%-.255s%.20s_%.200s|O&:readin:readi:set_wakeup_fdi:get_blockingii:set_blockingtimeout|iO:acquiregc: %s <%s %p> gc: done, %.4fs elapsed garbage collectionclock_gettime(CLOCK_REALTIME)|O:ctimeasctimeU|O:strftimeinvalid GMT offsettimezonealtzonedaylight(zz)tzname<nil><refcnt %ld at %p><NULL object> <freed object> object : NULL object excepthookiy*:writei:clock_getresEOF read where not expected|O&:scandirfollow_symlinkssrcsOnnOstring, bytes or os.PathLikeO&O:execvavailablebad local file headerbad local file header sizeOHnnlHHInegative data sizezipimport: can't read datazlib# zipimport: zlib %s can't read Zip file: %R%s: %RU:zipimporter.get_dataU:zipimporter.get_source%U%c__init__.py%U.py(OiiO)(zO)su#nnssy#nnsisn_bootlocalethread.local.%pwhence value %d unsupportedseek of closed fileflush of closed filewrite to closed file|n:peekpeek of closed filew*:readinto1n:read1read length must be positiveread of closed filedecoding str is not supported|Oss:stri:ttynamenegative argument not allowed/dev/urandomPYTHONHASHSEEDn:urandomisisOOOO&|$O&:readlinkO&:confstrcp437not a Zip filebad central directory sizebad central directory offsetbad local header offsetcan't open Zip file: %R%U%c%UNHIIkHHIzipimporter()O&:zipimporterarchive path is empty!=<>__setattr__o.values() are not iterableo.keys() are not iterabledict mutated during updates:get_clock_infomonotonicperf_counterprocess_timeunknown clockimplementationadjustableresolution(OnN)invalid partial stateCan't backup builtins dicto.items() are not iterablecan only join an iterable0x%xre.compile(%.200R, %S)re.compile(%.200R)object() takes no parameterscan only assign an iterablepop from empty listlist.remove(x): x not in listpositionalkeyword-only%U and %U, %U, and %U, (OOnN)Negative size value %zdillegal newline value: %R<_io.TextIOWrapper name=%R mode=%R%U encoding=%R><%s><%s name=%R><_io.FileIO [closed]>defaultdict(%U, %U)%s(...)%s(%R)%U=%R%s(%R, %U)%U, %R%U, %S=%R%s(%R%U),)namespace%s(%S){...}[...]compiler_exit_scope()join() result is too longreadall() should return bytesread() should return bytesreadline of closed file|O&:readline|n:readlinedeque(%R, maxlen=%zd)deque(%R)maxlendeque()|OO:dequemaxlen must be non-negativeduplicate base class %Uduplicate base class__bases__%s()%s({%U}){%U}argument must be iterable|O:listinvalid slot offsettype() takes 1 or 3 argumentsUO!O!:type.__new____slots__ must be identifiers__weakref__threading(Ni)# destroy %S |OOOO:printinput(): lost sys.stdininput(): lost sys.stdoutinput(): lost sys.stderrO|Oi:sortednon-string found in code slotcode: varnames is too smalliiiiiSO!O!O!UUiS|O!O!:code<lambda><genexpr><listcomp><setcomp><dictcomp>'yield' outside function'await' outside functioninvalid subscript kind %dunexpected slice kind in __instancecheck__isinstance_bootstrap_externalsN__loader__can't create __main__ module__annotations__BuiltinImporter_RAW_MAGIC_NUMBERincrementaldecoderincrementalencoderunicodedata.ucnhash_CAPItruncated \xXX escape\ at end of stringillegal Unicode charactermalformed \N character escapes*|z:unicode_escape_decodestructStructunpack_fromassign tolost builtins moduleisiOOOiOsssOlambdagenexprlistcompsetcompdictcomp.%d_[%d]__future__nested_scopesgeneratorsdivisionabsolute_importwith_statementprint_functionunicode_literalsbarry_as_FLUFLgenerator_stopbracesnot a chance_attributesModuleInteractiveExpressionSuiteReturnAugAssignAnnAssignRaiseAssertExprPassBreakContinueBoolOpBinOpUnaryOpLambdaIfExpSetListCompSetCompDictCompGeneratorExpAwaitYieldYieldFromCompareCallFormattedValueJoinedStrNameConstantAttributeSubscriptStarredListTupleexpr_contextIndexboolopMatMultModPowLShiftRShiftBitOrBitXorBitAndFloorDivunaryopInvertUAddUSubcmpopNotEqLtLtEGtGtEIsIsNotNotInexcepthandleraliaswithitemexpected %s node, got %.400sunknown boolop foundunknown unaryop foundunknown cmpop found|OOOO:propertyencodings.utf_8encodings.latin_1OpenWrapperPYTHONIOENCODING__stdin__<stdout>__stdout__<stderr>__stderr__PyInitPyInitUspec.name must be a stringpunycodeccorigincreate_dynamicDEF_GLOBALDEF_LOCALDEF_PARAMDEF_FREEDEF_FREE_CLASSDEF_IMPORTDEF_BOUNDDEF_ANNOTTYPE_FUNCTIONTYPE_CLASSTYPE_MODULEGLOBAL_EXPLICITGLOBAL_IMPLICITCELLSCOPE_OFFSCOPE_MASKzipimport.ZipImportError_zip_directory_cacheDEFAULT_BUFFER_SIZEUnsupportedOperations(OO){}flushnewlinesreadallresetseekabletellLC_TIMELC_COLLATELC_MONETARYLC_MESSAGESLC_NUMERIClocale.ErrorCLOCK_REALTIMECLOCK_MONOTONICCLOCK_MONOTONIC_RAWCLOCK_PROCESS_CPUTIME_IDCLOCK_THREAD_CPUTIME_ID_STRUCT_TM_ITEMSS_IFDIRS_IFCHRS_IFBLKS_IFREGS_IFIFOS_IFLNKS_IFSOCKS_IFDOORS_IFPORTS_IFWHTS_ISUIDS_ISGIDS_ISVTXS_ENFMTS_IREADS_IWRITES_IEXECS_IRWXUS_IRUSRS_IWUSRS_IXUSRS_IRWXGS_IRGRPS_IWGRPS_IXGRPS_IRWXOS_IROTHS_IWOTHS_IXOTHUF_NODUMPUF_IMMUTABLEUF_APPENDUF_OPAQUEUF_NOUNLINKUF_COMPRESSEDUF_HIDDENSF_ARCHIVEDSF_IMMUTABLESF_APPENDSF_NOUNLINKSF_SNAPSHOTST_MODEST_INOST_DEVST_NLINKST_UIDST_GIDST_SIZEST_ATIMEST_MTIMEST_CTIMESIG_DFLSIG_IGNNSIGSIG_BLOCKSIG_UNBLOCKSIG_SETMASKdefault_int_handlerSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGIOTSIGABRTSIGFPESIGKILLSIGBUSSIGSEGVSIGSYSSIGPIPESIGALRMSIGTERMSIGUSR1SIGUSR2SIGCLDSIGCHLDSIGPWRSIGIOSIGURGSIGWINCHSIGSTOPSIGTSTPSIGCONTSIGTTINSIGTTOUSIGVTALRMSIGPROFSIGXCPUSIGXFSZSIGRTMINSIGRTMAXITIMER_REALITIMER_VIRTUALITIMER_PROFsignal.ItimerError_deque_reverse_iteratorReferenceTypeCallableProxyTypeMAGICCODESIZEMAXREPEATMAXGROUPScopyrighterrorcodeENODEVENOCSIEHOSTUNREACHENOMSGEUCLEANEL2NSYNCEL2HLTENODATAENOTBLKENOSYSEPIPEEINVALEOVERFLOWEADVEINTREUSERSENOTEMPTYENOBUFSEPROTOEREMOTEENAVAILECHILDELOOPEXDEVE2BIGESRCHEMSGSIZEEAFNOSUPPORTEBADREHOSTDOWNEPFNOSUPPORTENOPROTOOPTEBUSYEWOULDBLOCKEBADFDEDOTDOTEISCONNENOANOESHUTDOWNECHRNGELIBBADENONETEBADEEBADFEMULTIHOPEUNATCHEPROTOTYPEENOSPCENOEXECEALREADYENETDOWNENOTNAMEACCESELNRNGEILSEQENOTDIRENOTUNIQEPERMEDOMEXFULLECONNREFUSEDEISDIREPROTONOSUPPORTEROFSEADDRNOTAVAILEIDRMECOMMESRMNTEREMOTEIOEL3RSTEBADMSGENFILEELIBMAXESPIPEENOLINKENETRESETETIMEDOUTENOENTEEXISTEDQUOTENOSTREBADSLTEBADRQCELIBACCEFAULTEFBIGEDEADLKENOTCONNEDESTADDRREQELIBSCNENOLCKEISNAMECONNABORTEDENETUNREACHESTALEENOSRENOMEMENOTSOCKESTRPIPEEMLINKERANGEELIBEXECEL3HLTECONNRESETEADDRINUSEEOPNOTSUPPEREMCHGEAGAINENAMETOOLONGENOTTYERESTARTESOCKTNOSUPPORTETIMEEBFONTEDEADLOCKETOOMANYREFSEMFILEETXTBSYEINPROGRESSENXIOENOPKGENOMEDIUMEMEDIUMTYPEECANCELEDENOKEYEKEYEXPIREDEKEYREVOKEDEKEYREJECTEDEOWNERDEADENOTRECOVERABLEERFKILLENOTSUPHAVE_FACCESSATF_OKR_OKW_OKTMP_MAXWCONTINUEDWNOHANGWUNTRACEDO_RDONLYO_WRONLYO_RDWRO_NDELAYO_NONBLOCKO_APPENDO_DSYNCO_RSYNCO_SYNCO_NOCTTYO_CREATO_EXCLO_LARGEFILEO_PATHO_TMPFILEPRIO_PROCESSPRIO_PGRPPRIO_USERO_CLOEXECO_ACCMODESEEK_HOLESEEK_DATAO_ASYNCO_DIRECTO_DIRECTORYO_NOFOLLOWO_NOATIMEEX_OKEX_USAGEEX_DATAERREX_NOINPUTEX_NOUSEREX_NOHOSTEX_UNAVAILABLEEX_SOFTWAREEX_OSERREX_OSFILEEX_CANTCREATEX_IOERREX_TEMPFAILEX_PROTOCOLEX_NOPERMEX_CONFIGST_RDONLYST_NOSUIDST_NODEVST_NOEXECST_SYNCHRONOUSST_MANDLOCKST_WRITEST_APPENDST_NOATIMEST_NODIRATIMEST_RELATIMEPOSIX_FADV_NORMALPOSIX_FADV_SEQUENTIALPOSIX_FADV_RANDOMPOSIX_FADV_NOREUSEPOSIX_FADV_WILLNEEDPOSIX_FADV_DONTNEEDP_PIDP_PGIDP_ALLWEXITEDWNOWAITWSTOPPEDCLD_EXITEDCLD_DUMPEDCLD_TRAPPEDCLD_CONTINUEDF_LOCKF_TLOCKF_ULOCKF_TESTSCHED_OTHERSCHED_FIFOSCHED_RRSCHED_BATCHSCHED_IDLESCHED_RESET_ON_FORKXATTR_CREATEXATTR_REPLACEXATTR_SIZE_MAXRTLD_LAZYRTLD_NOWRTLD_GLOBALRTLD_LOCALRTLD_NODELETERTLD_NOLOADRTLD_DEEPBINDGRND_RANDOMGRND_NONBLOCKconfstr_namessysconf_namesposix.times_resultposix.waitid_resultos.stat_resultos.statvfs_resultposix.sched_paramposix.uname_result_have_functionspathconf_namesenvironTIMEOUT_MAXLockTypegarbageDEBUG_STATSDEBUG_COLLECTABLEDEBUG_UNCOLLECTABLEDEBUG_SAVEALLDEBUG_LEAKfrozensetzipPyCF_ONLY_AST_onceregistry_defaultactionsetattrdelattreither 0 or state is not a dictionarynegative file descriptorinvalid mode: %.200sexpected integer from openeropener returned %dunicodedatanormalizeO|O:structseq|O:gmtimetimeout must be non-negativesigtimedwaitgetpwuid(): uid not foundgetpwuid(): uid not found: %SU:getpwnamresourceNiNi:fstatvfsi:sched_getparamiii:waitid|$p:DirEntry.is_file|$p:DirEntry.is_dir|$p:DirEntry.statpthreadsemaphore__displayhook____excepthook__hexversionCPython(szz)_gitdont_write_bytecodeapi_versionplatformexecutablebase_prefixbase_exec_prefixmaxsizemaxunicodebuiltin_module_namesbyteorderabiflags_xoptionsfinalcache_tagx86_64-linux-gnu_multiarchfloat_repr_stylewarnoptions|O:localtimeunexpected special characterutf7unterminated shift sequencey*|zi:utf_7_decode_reduce_excan't pickle %.200s objects|i:__reduce__N(O)nN(N)N(())N(N)ON(N)i_subx_expandU|OOOi:__import__truncated inputunicode_internalO|z:unicode_internal_decoderange_iterator()str() on a bytes instancestr() on a bytearray instanceO|OnO:warn__classcell__'return' outside function'break' outside loopno symtable<module>suite should not be possibleinvalid escape sequence \%c\U%08xassignment to keywordfunction callgenerator expressionyield expressionawait expressionlist comprehensionset comprehensiondict comprehensionliteralconditional expressiondeletecan't %s %sunexpected import name: %dgc %s # clear builtins._ # clear sys.%s # restore sys.%s # cleanup[2] removing %U # cleanup[3] wiping %U # cleanup[3] wiping sys # cleanup[3] wiping builtins ((OK))illegal newline value: %scodecs.open()((yi))y#yinegative seek position %RiyU:writenot writable|O&:readlines|n:readinvalid file: %Rinvalid mode: '%s'OsiO'U' mode is deprecatedinvalid buffering sizeunknown mode: '%s'OsssiO|nn must be >= 0O(N)(Oi)O(O)(Oi)marshal data too shortrecursion limit exceededy*:loadsU:get_frozen_object__path__U:init_frozenisisssi_module_reprceval: tstate mix-upceval: orphan tstate__annotations__ not foundlost sys.displayhookbad RAISE_VARARGS oparg'finally' pops bad exception__build_class__ not foundno locals when deleting %Rname '%.200s' is not definedno locals when loading %R__import__ not foundcannot import name %RXXX lineno: %d, opcode: %d unknown opcodePyEval_EvalFrameExinvalid augassign: %sillegal target for annotationunexpected flow_stmt: %dfinallymalformed 'try' statementinvalid async stament: %ssO&s:symtableexecevalsingle# trying %U%c%U bad pyc data# %R has bad magic # %R has bad mtime U:zipimporter.get_codeU:zipimporter.get_filenameU:zipimporter.load_module[N]compile(): unrecognised flagsstring, bytes or ASTstring, bytes or codelocals must be a mapping<fstring>f-string: unterminated stringf-string: expecting '}'unicode errorvalue errorinvalid comp_op: %sinvalid comp_op: %s %sunhandled factor: %dstring to parse is too long(%s) %sunhandled atom %dunhandled expr: %d(%s) unknown errorunexpected nodemore than 255 argumentskeyword argument repeated|i:splitlinesOOUi|OOOO:warn_explicitmethod name must be a string<metaclass>cannot allocate lock|n:startPYTHONTRACEMALLOCtoo many objects File "", line didn't expect a NULL pointerbad leading pad bytebad trailing pad byte API '%c' at p-%d: 0x%02x *** OUCH at tail+%d: 0x%02x Data at p: %02x ...FORBIDDENBYTE, as expected. Error in sys.excepthook:
Original exception was: sys.excepthook is missing runpy_run_module_as_mainsys__interactivehook__meta_pathunable to get sys.path_hooks# installing zipimport hook zipimport# can't import zipimport # installed zipimport hook initializing zipimport failed_frozen_importlibimport _imp # builtin import sys # builtin _imp_installPYTHONDEBUGPYTHONVERBOSEPYTHONOPTIMIZEPYTHONDONTWRITEBYTECODEmodules__cached__.pycSourcelessFileLoaderBad magic number in .pyc fileBad code object in .pyc fileSourceFileLoader>>> ... <encoding error>PYTHONMALLOC<prefix>/lib/pythonX.XPython %s PYTHONINSPECTPYTHONUNBUFFEREDPYTHONNOUSERSITEPYTHONWARNINGS,Python %s on %s PYTHONSTARTUPCould not open PYTHONSTARTUP unable to get sys.path<unprintable file name>out of memory Python %s %s __main__ not frozenunmarshallable objectO|i:dumpsOO|i:dump_frozen_importlib_external__hello____phello____phello__.spamgetstate() -> statesetstate(state)classmethclassmeth(*args, **kw)staticmethstaticmeth(*args, **kw)benchxxsubtypexxsubtype.spamlistxxsubtype.spamdict_symtableis_tracingclear_traces_get_traces_get_object_tracebackget_traceback_limitget_tracemalloc_memoryget_traced_memory_tracemallocdisableis_enabledcancel_dump_traceback_later_read_null_fatal_error_c_thread_sigabrt_sigfpe_fatal_error_stack_overflowall_threadssignumBus errorIllegal instructionFloating point exceptionAbortedSegmentation faultarchivefind_loaderzipimport.zipimporterdecompressline_bufferinggetvalue__getstate____setstate__initial_valuenewline|OO:StringIO_io.StringIO_io._TextIOBase_CHUNK_SIZEwrite_throughO|i:decode_dealloc_warnO|zzzii:TextIOWrapperrawiso8859-1_io.IncrementalNewlineDecodergetpreferredencoding_io._BufferedIOBase__sizeof__buffer_size_io.BufferedRWPairO|n:BufferedWriter_io.BufferedWriterO|n:BufferedRandom_io.BufferedRandomO|n:BufferedReader_io.BufferedReaderTrue if the file is closed.writelinesgetbuffer_io.BytesIOinitial_bytes|O:BytesIO_io._BytesIOBuffer_io.FileIOTrue if the file is closedclosefdString giving the file modeO|siO:FileIO_checkClosed_checkSeekable_checkReadable_checkWritable__enter____exit___io._IOBase_io._RawIOBaseextend__IOBase_closedO|sizzziO:openlocaleconvdgettextdcgettextbindtextdomainbind_textdomain_codeset_localeABDAY_1ABDAY_2ABDAY_3ABDAY_4ABDAY_5ABDAY_6ABDAY_7ABMON_1ABMON_2ABMON_3ABMON_4ABMON_5ABMON_6ABMON_7ABMON_8ABMON_9ABMON_10ABMON_11ABMON_12RADIXCHARTHOUSEPCRNCYSTRAM_STRPM_STRCODESETT_FMT_AMPMERAERA_D_FMTERA_D_T_FMTERA_T_FMTALT_DIGITSYESEXPRNOEXPR_DATE_FMTtm_yearyear, for example, 1993tm_monmonth of year, range [1, 12]tm_mdayday of month, range [1, 31]tm_hourhours, range [0, 23]tm_minminutes, range [0, 59]tm_secseconds, range [0, 61])tm_wdaytm_ydayday of year, range [1, 366]tm_isdsttm_zoneabbreviation of timezone nametm_gmtoffoffset from UTC in secondssleepmktimetzsettime.struct_time_strptime_timeS_ISDIRS_ISCHRS_ISBLKS_ISREGS_ISFIFOS_ISLNKS_ISSOCKS_ISDOORS_ISPORTS_ISWHTS_IMODES_IFMTfilemode_statsi_signosignal numbersi_codesignal codesi_errnosi_pidsending process IDsi_uidsi_statusexit value or signalsi_bandband event for SIGPOLLpausesigpendingsigwaitsigwaitinfosignal.struct_siginfo_run_exitfuncs_ncallbacksatexit__copy__from_iterable__length_hint__itertoolsitertools.repeatitertools.productitertools.permutationsitertools.zip_longestitertools.countitertools.compressitertools.combinationsitertools.accumulateitertools.chainitertools.cycleitertools.dropwhileitertools.takewhileitertools.isliceitertools.starmapitertools.filterfalsestepfuncselectorsitertools.groupbyitertools._grouperitertools._teeitertools._tee_dataobjectappendleftcopyextendleftpopleft__reversed__reverse__missing__default_factorycollections.defaultdict_collections__setitem__collections.deque_collections._deque_iteratortruthis_(a, b) -- Same as a is b.add(a, b) -- Same as a + b.sub(a, b) -- Same as a - b.mul(a, b) -- Same as a * b.mod(a, b) -- Same as a % b.negneg(a) -- Same as -a.pos(a) -- Same as +a.abs(a) -- Same as abs(a).invinv(a) -- Same as ~a.invertinvert(a) -- Same as ~a.not_not_(a) -- Same as not a.and_(a, b) -- Same as a & b.xor(a, b) -- Same as a ^ b.or_(a, b) -- Same as a | b.pow(a, b) -- Same as a ** b.lt(a, b) -- Same as a<b.le(a, b) -- Same as a<=b.eq(a, b) -- Same as a==b.ne(a, b) -- Same as a!=b.gt(a, b) -- Same as a>b.ge(a, b) -- Same as a>=b._compare_digest_operatoroperator.attrgetteroperator.itemgetteroperator.methodcallerkeywordsobjcache_infocache_clear_functoolsfunctools._lru_cache_wrapperfunctools._lru_list_elemfunctools.partialuser_functiontypedcache_info_typefunctools.KeyWrappermycmpgetweakrefcountgetweakrefsraw_unicode_escape_decode_codecsO|ss:encodeO|ss:decodegroupindexlastindexlastgroupregsendposgetcodesizeindexgroupmemotemplatemaxsplitrepl_sre|O:groupdict|Onn$O:match|Onn$O:fullmatch|Onn$O:search|Onn$O:findall|On$O:splitOO|n:subOO|n:subnO|nn:finditerO|nn:scanner_sre.SRE_Scanner|O:groups_sre.SRE_MatchOiO!nOO:compile_sre.SRE_Patternre.TEMPLATEre.IGNORECASEre.LOCALEre.MULTILINEre.DOTALLre.UNICODEre.VERBOSEre.DEBUGre.ASCIIO:expandO:__deepcopy__pw_nameuser namepw_passwdpasswordpw_uiduser idpw_gidgroup idpw_gecosreal namepw_dirhome directorypw_shellshell programgetpwuidgetpwallpwd.struct_passwdpwdst_modeprotection bitsst_inoinodest_devdevicest_nlinknumber of hard linksst_uiduser ID of ownerst_gidgroup ID of ownerst_sizetotal size, in bytesinteger time of last accessinteger time of last changest_atimest_mtimetime of last modificationst_ctimest_atime_nsst_mtime_nsst_ctime_nsst_blksizeblocksize for filesystem I/Ost_blocksnumber of blocks allocatedst_rdevdevice type (if inode device)f_bsizef_frsizef_blocksf_bfreef_bavailf_filesf_ffreef_favailf_flagf_namemaxsysnameoperating system namenodenameoperating system releaseoperating system versionmachinehardware identifiersched_prioritythe scheduling priorityuser timesystem timechildren_useruser time of childrenchildren_systemsystem time of childrenelapsedcolumnsis_symlink__fspath__ctermidgetcwdgetcwdbunamesched_yieldopenptyforkptygetegidgeteuidgetgidgetgroupsgetpidgetppidgetuidgetloginsetgroupssetsidpipeabortgetloadavggetresuidgetresgidget_terminal_sizecpu_countfd2policycommandtarget_is_directorysrc_dir_fddst_dir_fdwhichwhoeffective_idsHAVE_FCHDIRHAVE_FCHMODHAVE_FCHMODATHAVE_FCHOWNHAVE_FCHOWNATHAVE_FEXECVEHAVE_FDOPENDIRHAVE_FPATHCONFHAVE_FSTATATHAVE_FSTATVFSHAVE_FTRUNCATEHAVE_FUTIMENSHAVE_FUTIMESHAVE_FUTIMESATHAVE_LINKATHAVE_LCHOWNHAVE_LSTATHAVE_LUTIMESHAVE_MKDIRATHAVE_MKFIFOATHAVE_MKNODATHAVE_OPENATHAVE_READLINKATHAVE_RENAMEATHAVE_SYMLINKATHAVE_UNLINKATHAVE_UTIMENSATos.terminal_sizeposixO:fspathi:fstatO&|$O&p:statO&|$O&:lstatO&|$O&:unlinkO&|$O&:removeO&i|$O&pp:accessO&:chdirO&i|$O&p:chmodii:fchmodO&O&O&|$O&p:chowniO&O&:fchownO&O&O&:lchownO&:chrootO&O&|$O&O&p:link|O&:listdirO&|i$O&:mkdirii:getpriorityiii:setpriorityO&|$O&:rmdirO&O&|p$O&:symlinkO&:systemO&|O$OO&p:utimeO&OO:execvei:sched_get_priority_maxi:sched_get_priority_mini:getpgidi:wait3ii:wait4ii|p:dup2O&i|i$O&:openi:closeO&|i$O&:mkfifoO&O&:truncateO&:statvfsO&O&:pathconfO&O&|$p:getxattrO&O&y*|i$p:setxattrO&O&|$p:removexattr|O&$p:listxattrn|i:getrandomO&|iO&$O&:mknodO&O&|$O&O&:renameO&O&|$O&O&:replacei:_exitstruct_rusagei:device_encodingPC_ASYNC_IOPC_CHOWN_RESTRICTEDPC_FILESIZEBITSPC_LINK_MAXPC_MAX_CANONPC_MAX_INPUTPC_NAME_MAXPC_NO_TRUNCPC_PATH_MAXPC_PIPE_BUFPC_PRIO_IOPC_SOCK_MAXBUFPC_SYNC_IOPC_VDISABLEPC_ALLOC_SIZE_MINPC_REC_INCR_XFER_SIZEPC_REC_MAX_XFER_SIZEPC_REC_MIN_XFER_SIZEPC_REC_XFER_ALIGNPC_SYMLINK_MAXCS_GNU_LIBC_VERSIONCS_GNU_LIBPTHREAD_VERSIONCS_LFS64_CFLAGSCS_LFS64_LDFLAGSCS_LFS64_LIBSCS_LFS64_LINTFLAGSCS_LFS_CFLAGSCS_LFS_LDFLAGSCS_LFS_LIBSCS_LFS_LINTFLAGSCS_PATHCS_XBS5_ILP32_OFF32_CFLAGSCS_XBS5_ILP32_OFF32_LDFLAGSCS_XBS5_ILP32_OFF32_LIBSCS_XBS5_ILP32_OFF32_LINTFLAGSCS_XBS5_ILP32_OFFBIG_CFLAGSCS_XBS5_ILP32_OFFBIG_LDFLAGSCS_XBS5_ILP32_OFFBIG_LIBSCS_XBS5_LP64_OFF64_CFLAGSCS_XBS5_LP64_OFF64_LDFLAGSCS_XBS5_LP64_OFF64_LIBSCS_XBS5_LP64_OFF64_LINTFLAGSCS_XBS5_LPBIG_OFFBIG_CFLAGSCS_XBS5_LPBIG_OFFBIG_LDFLAGSCS_XBS5_LPBIG_OFFBIG_LIBSSC_2_CHAR_TERMSC_2_C_BINDSC_2_C_DEVSC_2_C_VERSIONSC_2_FORT_DEVSC_2_FORT_RUNSC_2_LOCALEDEFSC_2_SW_DEVSC_2_UPESC_2_VERSIONSC_AIO_LISTIO_MAXSC_AIO_MAXSC_AIO_PRIO_DELTA_MAXSC_ARG_MAXSC_ASYNCHRONOUS_IOSC_ATEXIT_MAXSC_AVPHYS_PAGESSC_BC_BASE_MAXSC_BC_DIM_MAXSC_BC_SCALE_MAXSC_BC_STRING_MAXSC_CHARCLASS_NAME_MAXSC_CHAR_BITSC_CHAR_MAXSC_CHAR_MINSC_CHILD_MAXSC_CLK_TCKSC_COLL_WEIGHTS_MAXSC_DELAYTIMER_MAXSC_EQUIV_CLASS_MAXSC_EXPR_NEST_MAXSC_FSYNCSC_GETGR_R_SIZE_MAXSC_GETPW_R_SIZE_MAXSC_INT_MAXSC_INT_MINSC_IOV_MAXSC_JOB_CONTROLSC_LINE_MAXSC_LOGIN_NAME_MAXSC_LONG_BITSC_MAPPED_FILESSC_MB_LEN_MAXSC_MEMLOCKSC_MEMLOCK_RANGESC_MEMORY_PROTECTIONSC_MESSAGE_PASSINGSC_MQ_OPEN_MAXSC_MQ_PRIO_MAXSC_NGROUPS_MAXSC_NL_ARGMAXSC_NL_LANGMAXSC_NL_MSGMAXSC_NL_NMAXSC_NL_SETMAXSC_NL_TEXTMAXSC_NPROCESSORS_CONFSC_NPROCESSORS_ONLNSC_NZEROSC_OPEN_MAXSC_PAGESIZESC_PAGE_SIZESC_PASS_MAXSC_PHYS_PAGESSC_PIISC_PII_INTERNETSC_PII_INTERNET_DGRAMSC_PII_INTERNET_STREAMSC_PII_OSISC_PII_OSI_CLTSSC_PII_OSI_COTSSC_PII_OSI_MSC_PII_SOCKETSC_PII_XTISC_POLLSC_PRIORITIZED_IOSC_PRIORITY_SCHEDULINGSC_REALTIME_SIGNALSSC_RE_DUP_MAXSC_RTSIG_MAXSC_SAVED_IDSSC_SCHAR_MAXSC_SCHAR_MINSC_SELECTSC_SEMAPHORESSC_SEM_NSEMS_MAXSC_SEM_VALUE_MAXSC_SHARED_MEMORY_OBJECTSSC_SHRT_MAXSC_SHRT_MINSC_SIGQUEUE_MAXSC_SSIZE_MAXSC_STREAM_MAXSC_SYNCHRONIZED_IOSC_THREADSSC_THREAD_ATTR_STACKADDRSC_THREAD_ATTR_STACKSIZESC_THREAD_KEYS_MAXSC_THREAD_PRIORITY_SCHEDULINGSC_THREAD_PRIO_INHERITSC_THREAD_PRIO_PROTECTSC_THREAD_PROCESS_SHAREDSC_THREAD_SAFE_FUNCTIONSSC_THREAD_STACK_MINSC_THREAD_THREADS_MAXSC_TIMERSSC_TIMER_MAXSC_TTY_NAME_MAXSC_TZNAME_MAXSC_T_IOV_MAXSC_UCHAR_MAXSC_UINT_MAXSC_UIO_MAXIOVSC_ULONG_MAXSC_USHRT_MAXSC_VERSIONSC_WORD_BITSC_XBS5_ILP32_OFF32SC_XBS5_ILP32_OFFBIGSC_XBS5_LP64_OFF64SC_XBS5_LPBIG_OFFBIGSC_XOPEN_CRYPTSC_XOPEN_ENH_I18NSC_XOPEN_LEGACYSC_XOPEN_REALTIMESC_XOPEN_REALTIME_THREADSSC_XOPEN_SHMSC_XOPEN_UNIXSC_XOPEN_VERSIONSC_XOPEN_XCU_VERSIONSC_XOPEN_XPG2SC_XOPEN_XPG3SC_XOPEN_XPG4posix.ScandirIteratorO&:fchdirO&:fsyncO&:fdatasynci:WIFCONTINUEDi:WIFSTOPPEDi:WIFSIGNALEDi:WIFEXITEDi:WEXITSTATUSi:WTERMSIGi:WSTOPSIGO:sched_paramposix.DirEntryacquire_lockrelease_locklocked_lock_is_owned_release_savestart_newallocate_lockexit_threadinterrupt_mainget_ident_set_sentinel_thread.RLock_thread.lock_thread._localThread-local data_localdummy_destroyed_thread._localdummyThread-local dummyisenabledget_debugget_countget_thresholdcollectget_objectsget_statsis_trackedget_referrersget_referents_iomarshal_warnings_stringsys.thread_info.abi3.soINFNAN__dir__firstiterfinalizerwidthmodulusimaghash_bitsseed_bitsseed size of hash algorithmcutoff-dinspect-iinteractiveoptimize-O or -OO-Bno_user_site-sno_site-Signore_environment-Everbose-vbytes_warning-bquiet-qhash_randomization-Risolated-I-X int_max_str_digitsMajor release numberMinor release numbermicroPatch release numberreleaselevelserialSerial release numbercallstats_clear_type_cache_current_framesexc_infogetdefaultencodinggetdlopenflagsgetallocatedblocksgetfilesystemencodinggetfilesystemencodeerrorsgetrefcountgetrecursionlimitis_finalizinggetcheckintervalgetswitchintervalsetprofilegetprofilesettracegettrace_debugmallocstatsset_coroutine_wrapperget_coroutine_wrapperset_asyncgen_hooksget_asyncgen_hooksget_int_max_str_digitssys.flagssys.version_infosys.hash_infomaxdigitscpython-36cpythonc_callc_exceptionc_returnsymbolsnestedsymtable entryps2ps1last_tracebacklast_valuelast_type_shutdownC.UTF-8C.utf8siphash24extension_suffixeslock_heldcreate_builtinexec_dynamicexec_builtinreload_handle_fromlist_find_and_load_lock_unlock_module_initializing__spec___get_sourcefile_fix_up_moduleparent__package__breakcontinueraiseglobalnonlocalassertelifexceptsingle_inputfile_inputeval_inputdecoratordecoratorsdecoratedasync_funcdeftypedargslisttfpdefvarargslistvfpdefsimple_stmtsmall_stmtexpr_stmtannassigntestlist_star_expraugassigndel_stmtpass_stmtflow_stmtbreak_stmtcontinue_stmtreturn_stmtyield_stmtraise_stmtimport_stmtimport_nameimport_fromimport_as_namedotted_as_nameimport_as_namesdotted_as_namesdotted_nameglobal_stmtnonlocal_stmtassert_stmtcompound_stmtasync_stmtif_stmtwhile_stmtfor_stmttry_stmtwith_stmtwith_itemexcept_clausesuitetest_nocondlambdeflambdef_nocondor_testand_testnot_testcomp_opxor_exprand_exprshift_exprarith_exprtermfactorpoweratom_expratomtestlist_comptrailersubscriptlistsubscriptsliceopexprlisttestlistdictorsetmakerclassdefarglistcomp_itercomp_forcomp_ifencoding_declyield_expryield_arg0123456789abcdef_is_text_encodingstrict_errorsignore_errorsxmlcharrefreplace_errorsbackslashreplace_errorsnamereplacenamereplace_errors.<locals>__aenter____aexit____build_class___after_fork__all__anybinhashoctdont_inheritOO&s|iii:compile__prepare__metaclass__round__ndigitsNFKCfinalbodyhandlersexcsimplebasesreturnsdecorator_listis_asyncifstargetoptional_varscontext_exprctxformat_specconversionopselteltsorelseoperandkwargkw_defaultskwonlyargsvarargcol_offsetasname_ast.AST_filters_mutatedcategorystacklevelmodule_globals__callback____bytes__weakcallableproxyweakproxyjoincapitalizecasefoldswapcaseislowerisupperistitleisspaceisdecimalisdigitisnumericisalphaisalnumisidentifierisprintableformat_map__getnewargs__formatter_field_name_splitformatter_parserstring helper modulefieldnameiteratorkeependstabsizeformatteriteratorstr_iteratorEncodingMap__abstractmethods____text_signature____basicsize____itemsize____flags____weakrefoffset____base____dictoffset____mro__mro__subclasses__the object's classhelper for pickle__subclasshook____init_subclass__default object formatter__thisclass__the class invoking super()__self____self_class____repr____lt____le____eq____ne____gt____ge____str____iter____await____aiter____anext____pow____getitem____delitem____neg____pos____abs____index____invert____int____float____iadd____isub____imul____imatmul____imod____ipow____ilshift____irshift____iand____ixor____ior____ifloordiv____itruediv____getattribute____getattr____next____set____delete____add____radd____sub____rsub____mul____rmul____matmul____rmatmul____mod____rmod____divmod____rdivmod____rpow____lshift____rlshift____rshift____rrshift____and____rand____xor____rxor____or____ror____floordiv____rfloordiv____truediv____rtruediv____newobj_ex____newobj____getnewargs_ex____contains____len____bool____del____slots____set_name____get____hash___slotnames__slotnames__copyreg__neg__($self, /) --
This module is NOT meant to be directly imported! It has been designed such that it can be bootstrapped into Python as the implementation of import. As such it requires the injection of specific modules and attributes in order to work. One should use importlib as the public-facing version of this module.
�win�cygwin�darwincs<tjjt�r0tjjt�rd�nd��fdd�}ndd�}|S)NZPYTHONCASEOKsPYTHONCASEOKcs �tjkS)z5True if filenames must be checked case-insensitively.)�_osZenviron�)�keyr�&<frozen importlib._bootstrap_external>�_relax_case%sz%_make_relax_case.<locals>._relax_casecSsdS)z5True if filenames must be checked case-insensitively.Frrrrrr)s)�sys�platform� startswith�_CASE_INSENSITIVE_PLATFORMS�#_CASE_INSENSITIVE_PLATFORMS_STR_KEY)rr)rr�_make_relax_casesr cCst|�d@jdd�S)z*Convert a 32-bit integer to little-endian.l����little)�int�to_bytes)�xrrr�_w_long/srcCstj|d�S)z/Convert 4 bytes in little-endian to an integer.r)r� from_bytes)Z int_bytesrrr�_r_long4srcGstjdd�|D��S)zReplacement for os.path.join().cSsg|]}|r|jt��qSr)�rstrip�path_separators)�.0�partrrr� <listcomp>;sz_path_join.<locals>.<listcomp>)�path_sep�join)� path_partsrrr� _path_join9s rcCs`tt�dkr$|jt�\}}}||fSx2t|�D]&}|tkr.|j|dd�\}}||fSq.Wd|fS)z Replacement for os.path.split().�)Zmaxsplit�)�lenr� rpartitionr�reversed�rsplit)�pathZfront�_�tailrrrr�_path_split?sr(cCs tj|�S)z~Stat the path.
Made a separate function to make it easier to override in experiments (e.g. cache stat results).
)rZstat)r%rrr� _path_statKsr)cCs0yt|�}Wntk r dSX|jd@|kS)z1Test whether the path is the specified mode type.Fi�)r)�OSError�st_mode)r%�modeZ stat_inforrr�_path_is_mode_typeUs r-cCs t|d�S)zReplacement for os.path.isfile.i�)r-)r%rrr�_path_isfile^sr.cCs|stj�}t|d�S)zReplacement for os.path.isdir.i@)r�getcwdr-)r%rrr�_path_isdircsr0�cCs�dj|t|��}tj|tjtjBtjB|d@�}y2tj|d��}|j |�WdQRXtj ||�Wn:tk r�ytj|�Wntk r�YnX�YnXdS)z�Best-effort function to write data to a path atomically. Be prepared to handle a FileExistsError if concurrent writing of the temporary file is attempted.z{}.{}i�ZwbN) �format�idrZopenZO_EXCLZO_CREATZO_WRONLY�_io�FileIO�write�replacer*Zunlink)r%�datar,Zpath_tmpZfd�filerrr� _write_atomicjsr:i3 �rs Z__pycache__zopt-z.pyz.pycN)�optimizationcCs�|dk r4tjdt�|dk r(d}t|��|r0dnd}tj|�}t|�\}}|jd�\}}}tj j } | dkrrtd��dj|r~|n||| g�} |dkr�tj jdkr�d}ntj j}t|�}|dkr�|j�s�td j|���d j| t|�} t|t| td�S)a�Given the path to a .py file, return the path to its .pyc file.
The .py file does not need to exist; this simply returns the path to the .pyc file calculated as if the .py file were imported.
The 'optimization' parameter controls the presumed optimization level of the bytecode file. If 'optimization' is not None, the string representation of the argument is taken and verified to be alphanumeric (else ValueError is raised).
The debug_override parameter is deprecated. If debug_override is not None, a True value is the same as setting 'optimization' to the empty string while a False value is equivalent to setting 'optimization' to '1'.
If sys.implementation.cache_tag is None then NotImplementedError is raised.
NzFthe debug_override parameter is deprecated; use 'optimization' insteadz2debug_override or optimization must be set to Noner r�.z$sys.implementation.cache_tag is None�z{!r} is not alphanumericz{}.{}{})� _warnings�warn�DeprecationWarning� TypeErrorr�fspathr(r"r�implementation� cache_tag�NotImplementedErrorr�flags�optimize�str�isalnum� ValueErrorr2�_OPTr�_PYCACHE�BYTECODE_SUFFIXES)r%Zdebug_overrider<�message�headr'Zbase�sep�restZtagZalmost_filenamerrr�cache_from_sources0 rScCs�tjjdkrtd��tj|�}t|�\}}t|�\}}|tkrNtdj t|���|j d�}|dkrptdj |���nV|dkr�|jdd�d}|jt �s�tdj t ���|tt �d�}|j�s�td j |���|jd�d }t||td �S) anGiven the path to a .pyc. file, return the path to its .py file.
The .pyc file does not need to exist; this simply returns the path to the .py file calculated to correspond to the .pyc file. If path does not conform to PEP 3147/488 format, ValueError will be raised. If sys.implementation.cache_tag is None then NotImplementedError is raised.
Nz$sys.implementation.cache_tag is Nonez%{} not bottom-level directory in {!r}r=r;�z!expected only 2 or 3 dots in {!r}z9optimization portion of filename does not start with {!r}z4optimization level {!r} is not an alphanumeric valuer>>r;rT���)rrDrErFrrCr(rMrKr2�countr$r rLr!rJ� partitionr�SOURCE_SUFFIXES)r%rPZpycache_filenameZpycacheZ dot_countr<Z opt_levelZ base_filenamerrr�source_from_cache4s.
rYcCs�t|�dkrdS|jd�\}}}|s:|j�dd�dkr>|Syt|�}Wn$ttfk rn|dd �}YnXt|�r||S|S) z�Convert a bytecode file path to a source path (if possible).
This function exists purely for backwards-compatibility for PyImport_ExecCodeModuleWithFilenames() in the C API.
r>Nr=rTrZpy������r[)r!r"�lowerrYrFrKr.)� bytecode_pathrRr&Z extension�source_pathrrr�_get_sourcefileVsr_cCsH|jtt��r.yt|�Stk r*YqDXn|jtt��r@|SdSdS)N)�endswith�tuplerXrSrFrN)�filenamerrr�_get_cachedisrccCs4yt|�j}Wntk r&d}YnX|dO}|S)z3Calculate the mode permissions for a bytecode file.i��)r)r+r*)r%r,rrr� _calc_modeus recsDd�fdd� }y tj}Wntk r4dd�}YnX||��|S)z�Decorator to verify that the module being requested matches the one the loader can handle.
The first argument (self) must define _name which the second argument is compared against. If the comparison fails then ImportError is raised.
NcsB|dkr|j}n |j|kr0td|j|f|d���||f|�|�S)Nzloader for %s cannot handle %s)�name)rf�ImportError)�selfrf�argsZkwargs)�methodrr�_check_name_wrapper�s z(_check_name.<locals>._check_name_wrappercSs<x(dD] }t||�rt||t||��qW|jj|j�dS)N� __module__�__name__�__qualname__�__doc__)rlrmrnro)�hasattr�setattr�getattr�__dict__�update)ZnewZoldr7rrr�_wrap�s
rcCs�i}|dk r||d<nd}|dk r*||d<|dd�}|dd�}|dd�}|tkr|dj||�}tjd |�t|f|��nVt|�dkr�d j|�}tjd |�t|��n*t|�dkr�dj|�}tjd |�t|��|dk �r|yt|d�} Wntk �rYn2Xt |�| k�r4d j|�}tjd |�t|f|��y|dd@} Wntk �rZYn"Xt |�| k�r|td j|�f|��|dd�S)azValidate the header of the passed-in bytecode against source_stats (if given) and returning the bytecode that can be compiled by compile().
All other arguments are used to enhance error reporting.
ImportError is raised when the magic number is incorrect or the bytecode is found to be stale. EOFError is raised when the data is found to be truncated.
Nrfz <bytecode>r%r��zbad magic number in {!r}: {!r}z{}z+reached EOF while reading timestamp in {!r}z0reached EOF while reading size of source in {!r}�mtimezbytecode is stale for {!r}�sizel��) �MAGIC_NUMBERr2rv�_verbose_messagergr!�EOFErrorr�KeyErrorr)r8�source_statsrfr%Zexc_detailsZmagicZ raw_timestampZraw_sizerO�source_mtime�source_sizerrr�_validate_bytecode_header�sL
r�cCsPtj|�}t|t�r8tjd|�|dk r4tj||�|Stdj |�||d��dS)z<Compile bytecode as returned by _validate_bytecode_header().zcode object from {!r}NzNon-code object in {!r})rfr%) �marshalZloads� isinstance� _code_typervr��_impZ_fix_co_filenamergr2)r8rfr]r^�coderrr�_compile_bytecode�s
r�r>cCs8tt�}|jt|��|jt|��|jtj|��|S)zPCompile a code object into bytecode for writing out to a byte-compiled file.)� bytearrayr��extendrr�Zdumps)r�r�r�r8rrr�_code_to_bytecode�s r�cCs>ddl}tj|�j}|j|�}tjdd�}|j|j|d��S)zyDecode bytes representing source code and return the string.
Universal newline support is used in the decoding. r>NT)�tokenizer4ZBytesIOZreadlineZdetect_encodingZIncrementalNewlineDecoder�decode)�source_bytesr�Zsource_bytes_readline�encodingZnewline_decoderrrr� decode_source�s
r�)r|�submodule_search_locationsc Cs|dkr<d}t|d�rFy|j|�}WqFtk r8YqFXn tj|�}tj|||d�}d|_|dkr�x6t�D](\}}|j t |��rl|||�}||_PqlWdS|tkr�t|d�r�y|j |�}Wntk r�Yq�X|r�g|_n||_|jgk�r|�rt|�d}|jj|�|S)a=Return a module spec based on a file location.
To indicate that the module is a package, set submodule_search_locations to a list of directory paths. An empty list is sufficient, though its not otherwise useful to the import system.
The loader must take a spec as its only __init__() arg.
r�c@sPeZdZdZdZdZdZedd��Zedd��Z edd d��Z eddd ��Zd S)�WindowsRegistryFinderz>Meta path finder for modules declared in the Windows registry.z;Software\Python\PythonCore\{sys_version}\Modules\{fullname}zASoftware\Python\PythonCore\{sys_version}\Modules\{fullname}\DebugFcCs2ytjtj|�Stk r,tjtj|�SXdS)N)�_winregZOpenKeyZHKEY_CURRENT_USERr*ZHKEY_LOCAL_MACHINE)�clsrrrr�_open_registry\sz$WindowsRegistryFinder._open_registrycCsp|jr|j}n|j}|j|dtjdd�d�}y&|j|��}tj|d�}WdQRXWnt k rjdSX|S)Nz%d.%dr;)r{Zsys_versionr ) �DEBUG_BUILD�REGISTRY_KEY_DEBUG�REGISTRY_KEYr2r�version_infor�r�Z QueryValuer*)r�r{Zregistry_keyrZhkey�filepathrrr�_search_registrycsz&WindowsRegistryFinder._search_registryNcCsx|j|�}|dkrdSyt|�Wntk r6dSXx:t�D]0\}}|jt|��r@tj||||�|d�}|Sq@WdS)N)r�)r�r)r*r�r`rarv�spec_from_loader)r�r{r%�targetr�r|r�r�rrr� find_specrs zWindowsRegistryFinder.find_speccCs"|j||�}|dk r|jSdSdS)zlFind module named in the registry.
This method is deprecated. Use exec_module() instead.
N)r�r|)r�r{r%r�rrr�find_module�sz!WindowsRegistryFinder.find_module)NN)N)rmrlrnror�r�r��classmethodr�r�r�r�rrrrr�Psr�c@s0eZdZdZdd�Zdd�Zdd�Zdd �Zd S)� _LoaderBasicszSBase class of common code needed by both SourceLoader and SourcelessFileLoader.cCs@t|j|��d}|jdd�d}|jd�d}|dko>|dkS)z�Concrete implementation of InspectLoader.is_package by checking if the path returned by get_filename has a filename of '__init__.py'.rr=r>r;�__init__)r(r�r$r")rhr{rbZ filename_baseZ tail_namerrrr��sz_LoaderBasics.is_packagecCsdS)z*Use default semantics for module creation.Nr)rhr�rrr� create_module�sz_LoaderBasics.create_modulecCs8|j|j�}|dkr$tdj|j���tjt||j�dS)zExecute the module.Nz4cannot load module {!r} when get_code() returns None)�get_codermrgr2rv�_call_with_frames_removed�execrs)rh�moduler�rrr�exec_module�s
z_LoaderBasics.exec_modulecCstj||�S)zThis module is deprecated.)rv�_load_module_shim)rhr{rrr�load_module�sz_LoaderBasics.load_moduleN)rmrlrnror�r�r�r�rrrrr��s r�c@sJeZdZdd�Zdd�Zdd�Zdd�Zd d �Zdd�d d�Zdd�Z dS)�SourceLoadercCst�dS)z�Optional method that returns the modification time (an int) for the specified path, where path is a str.
Raises IOError when the path cannot be handled. N)�IOError)rhr%rrr� path_mtime�szSourceLoader.path_mtimecCsd|j|�iS)a�Optional method returning a metadata dict for the specified path to by the path (str). Possible keys: - 'mtime' (mandatory) is the numeric timestamp of last source code modification; - 'size' (optional) is the size in bytes of the source code.
Implementing this method allows the loader to read bytecode files. Raises IOError when the path cannot be handled. r�)r�)rhr%rrr� path_stats�szSourceLoader.path_statscCs|j||�S)z�Optional method which writes data (bytes) to a file path (a str).
Implementing this method allows for the writing of bytecode files.
The source path is needed in order to correctly transfer permissions )�set_data)rhr^Z cache_pathr8rrr�_cache_bytecode�szSourceLoader._cache_bytecodecCsdS)z�Optional method which writes data (bytes) to a file path (a str).
Implementing this method allows for the writing of bytecode files. Nr)rhr%r8rrrr��szSourceLoader.set_datacCsR|j|�}y|j|�}Wn0tk rH}ztd|d�|�WYdd}~XnXt|�S)z4Concrete implementation of InspectLoader.get_source.z'source not available through get_data())rfN)r��get_datar*rgr�)rhr{r%r��excrrr� get_source�s zSourceLoader.get_sourcer)� _optimizecCstjt||dd|d�S)z�Return the code object compiled from source.
The 'data' argument can be any object type that compile() supports. r�T)�dont_inheritrH)rvr��compile)rhr8r%r�rrr�source_to_code�szSourceLoader.source_to_codec +Cs^|j|�}d}yt|�}Wntk r2d}Yn�Xy|j|�}Wntk rVYn~Xt|d�}y|j|�}Wntk r�YnNXyt||||d�}Wnt t fk r�Yn Xtjd||�t ||||d�S|j|�}|j||�} tjd|�tj�rZ|dk �rZ|dk �rZt| |t|��}y|j|||�tjd|�Wntk �rXYnX| S)z�Concrete implementation of InspectLoader.get_code.
Reading of bytecode requires path_stats to be implemented. To write bytecode, set_data must also be implemented.
Nr�)r�rfr%z {} matches {})rfr]r^zcode object from {}z wrote {!r})r�rSrFr�r�rr�r*r�rgr�rvr�r�r�r�dont_write_bytecoder�r!r�) rhr{r^r�r]�str8� bytes_datar�Zcode_objectrrrr��sN
r�csPeZdZdZdd�Zdd�Zdd�Ze�fdd ��Zed d��Z dd �Z �ZS)� FileLoaderzgBase file loader class which implements the loader protocol methods that require file system usage.cCs||_||_dS)zKCache the module name and the path to the file found by the finder.N)rfr%)rhr{r%rrrr� szFileLoader.__init__cCs|j|jko|j|jkS)N)� __class__rs)rh�otherrrr�__eq__&szFileLoader.__eq__cCst|j�t|j�AS)N)�hashrfr%)rhrrr�__hash__*szFileLoader.__hash__cstt|�j|�S)zdLoad a module from a file.
This method is deprecated. Use exec_module() instead.
)�superr�r�)rhr{)r�rrr�-s zFileLoader.load_modulecCs|jS)z:Return the path to the source file as found by the finder.)r%)rhr{rrrr�9szFileLoader.get_filenamec Cs tj|d�� }|j�SQRXdS)z'Return the data from path as raw bytes.�rN)r4r5Zread)rhr%r9rrrr�>szFileLoader.get_data)rmrlrnror�r�r�rxr�r�r�Z __classcell__rr)r�rr�sr�c@s.eZdZdZdd�Zdd�Zdd�dd �Zd S)�SourceFileLoaderz>Concrete implementation of SourceLoader using the file system.cCst|�}|j|jd�S)z!Return the metadata for the path.)r�r�)r)�st_mtimeZst_size)rhr%r�rrrr�HszSourceFileLoader.path_statscCst|�}|j|||d�S)N)�_mode)rer�)rhr^r]r8r,rrrr�Msz SourceFileLoader._cache_bytecodei�)r�c Cs�t|�\}}g}x(|r8t|�r8t|�\}}|j|�qWxlt|�D]`}t||�}ytj|�WqDtk rvwDYqDtk r�}zt j d||�dSd}~XqDXqDWyt|||�t j d|�Wn0tk r�}zt j d||�WYdd}~XnXdS)zWrite bytes data to a file.zcould not create {!r}: {!r}Nzcreated {!r})r(r0r�r#rrZmkdir�FileExistsErrorr*rvr�r:) rhr%r8r��parentrbrrr�rrrr�Rs* zSourceFileLoader.set_dataN)rmrlrnror�r�r�rrrrr�Dsr�c@s eZdZdZdd�Zdd�ZdS)�SourcelessFileLoaderz-Loader which handles sourceless file imports.cCs0|j|�}|j|�}t|||d�}t|||d�S)N)rfr%)rfr])r�r�r�r�)rhr{r%r8r�rrrr�us
zSourcelessFileLoader.get_codecCsdS)z'Return None as there is no source code.Nr)rhr{rrrr�{szSourcelessFileLoader.get_sourceN)rmrlrnror�r�rrrrr�qsr�c@s\eZdZdZdd�Zdd�Zdd�Zdd �Zd d�Zdd �Z dd�Z dd�Zedd��Z dS)�ExtensionFileLoaderz]Loader for extension modules.
The constructor is designed to work with FileFinder.
cCs||_||_dS)N)rfr%)rhrfr%rrrr��szExtensionFileLoader.__init__cCs|j|jko|j|jkS)N)r�rs)rhr�rrrr��szExtensionFileLoader.__eq__cCst|j�t|j�AS)N)r�rfr%)rhrrrr��szExtensionFileLoader.__hash__cCs$tjtj|�}tjd|j|j�|S)z&Create an unitialized extension modulez&extension module {!r} loaded from {!r})rvr�r�Zcreate_dynamicr�rfr%)rhr�r�rrrr��s
z!ExtensionFileLoader.create_modulecCs$tjtj|�tjd|j|j�dS)zInitialize an extension modulez(extension module {!r} executed from {!r}N)rvr�r�Zexec_dynamicr�rfr%)rhr�rrrr��szExtensionFileLoader.exec_modulecs$t|j�d�t�fdd�tD��S)z1Return True if the extension module is a package.rc3s|]}�d|kVqdS)r�Nr)r�suffix)� file_namerr� <genexpr>�sz1ExtensionFileLoader.is_package.<locals>.<genexpr>)r(r%�any�EXTENSION_SUFFIXES)rhr{r)r�rr��szExtensionFileLoader.is_packagecCsdS)z?Return None as an extension module cannot create a code object.Nr)rhr{rrrr��szExtensionFileLoader.get_codecCsdS)z5Return None as extension modules have no source code.Nr)rhr{rrrr��szExtensionFileLoader.get_sourcecCs|jS)z:Return the path to the source file as found by the finder.)r%)rhr{rrrr��sz ExtensionFileLoader.get_filenameN)rmrlrnror�r�r�r�r�r�r�r�rxr�rrrrr��sr�c@s`eZdZdZdd�Zdd�Zdd�Zdd �Zd d�Zdd �Z dd�Z dd�Zdd�Zdd�Z dS)�_NamespacePatha&Represents a namespace package's path. It uses the module name to find its parent module, and from there it looks up the parent's __path__. When this changes, the module's own path is recomputed, using path_finder. For top-level modules, the parent module's path is sys.path.cCs$||_||_t|j��|_||_dS)N)�_name�_pathra�_get_parent_path�_last_parent_path�_path_finder)rhrfr%�path_finderrrrr��sz_NamespacePath.__init__cCs&|jjd�\}}}|dkrdS|dfS)z>Returns a tuple of (parent-module-name, parent-path-attr-name)r=r rr%Z__path__)rr%)r�r")rhr��dotZmerrr�_find_parent_path_names�sz&_NamespacePath._find_parent_path_namescCs|j�\}}ttj||�S)N)r�rrr�modules)rhZparent_module_nameZpath_attr_namerrrr��sz_NamespacePath._get_parent_pathcCsPt|j��}||jkrJ|j|j|�}|dk rD|jdkrD|jrD|j|_||_|jS)N)rar�r�r�r�r|r�r�)rhZparent_pathr�rrr�_recalculate�s z_NamespacePath._recalculatecCst|j��S)N)�iterr�)rhrrr�__iter__�sz_NamespacePath.__iter__cCs||j|<dS)N)r�)rh�indexr%rrr�__setitem__�sz_NamespacePath.__setitem__cCst|j��S)N)r!r�)rhrrr�__len__�sz_NamespacePath.__len__cCsdj|j�S)Nz_NamespacePath({!r}))r2r�)rhrrr�__repr__�sz_NamespacePath.__repr__cCs||j�kS)N)r�)rh�itemrrr�__contains__�sz_NamespacePath.__contains__cCs|jj|�dS)N)r�r�)rhr�rrrr��sz_NamespacePath.appendN)rmrlrnror�r�r�r�r�r�r�r�r�r�rrrrr��s
r�c@sPeZdZdd�Zedd��Zdd�Zdd�Zd d �Zdd�Z d d�Z dd�ZdS)�_NamespaceLoadercCst|||�|_dS)N)r�r�)rhrfr%r�rrrr��sz_NamespaceLoader.__init__cCsdj|j�S)zsReturn repr for the module.
The method is deprecated. The import machinery does the job itself.
z<module {!r} (namespace)>)r2rm)r�r�rrr�module_repr�sz_NamespaceLoader.module_reprcCsdS)NTr)rhr{rrrr�sz_NamespaceLoader.is_packagecCsdS)Nr r)rhr{rrrr�sz_NamespaceLoader.get_sourcecCstddddd�S)Nr z<string>r�T)r�)r�)rhr{rrrr�sz_NamespaceLoader.get_codecCsdS)z*Use default semantics for module creation.Nr)rhr�rrrr�sz_NamespaceLoader.create_modulecCsdS)Nr)rhr�rrrr�sz_NamespaceLoader.exec_modulecCstjd|j�tj||�S)zbLoad a namespace module.
This method is deprecated. Use exec_module() instead.
z&namespace module loaded with path {!r})rvr�r�r�)rhr{rrrr�sz_NamespaceLoader.load_moduleN)rmrlrnr�r�r�r�r�r�r�r�r�rrrrr��s r�c@sjeZdZdZedd��Zedd��Zedd��Zedd ��Zeddd��Z edd d��Z eddd��Zd S)� PathFinderz>Meta path finder for sys.path and package __path__ attributes.cCs*x$tjj�D]}t|d�r|j�qWdS)z}Call the invalidate_caches() method on all path entry finders stored in sys.path_importer_caches (where implemented).�invalidate_cachesN)r�path_importer_cache�valuesrpr�)r��finderrrrr�#s zPathFinder.invalidate_cachescCsVtjdk rtjrtjdt�x2tjD]$}y||�Stk rHw&Yq&Xq&WdSdS)z.Search sys.path_hooks for a finder for 'path'.Nzsys.path_hooks is empty)r� path_hooksr?r@rzrg)r�r%Zhookrrr�_path_hooks+szPathFinder._path_hookscCsf|dkr*ytj�}Wntk r(dSXytj|}Wn(tk r`|j|�}|tj|<YnX|S)z�Get the finder for the path entry from sys.path_importer_cache.
If the path entry is not in the cache, find the appropriate finder and cache it. If no finder is available, store None.
r N)rr/�FileNotFoundErrorrr�r�r�)r�r%r�rrr�_path_importer_cache8s zPathFinder._path_importer_cachecCsRt|d�r|j|�\}}n|j|�}g}|dk r<tj||�Stj|d�}||_|S)Nry)rpryr�rvr�r�r�)r�r{r�r|r}r�rrr�_legacy_get_specNs
zPathFinder._legacy_get_specNc Cs�g}x�|D]�}t|ttf�sq |j|�}|dk r t|d�rH|j||�}n|j||�}|dkr^q |jdk rl|S|j}|dkr�t d��|j |�q Wtj|d�}||_|SdS)z?Find the loader or namespace_path for this module/package name.Nr�zspec missing loader) r�rI�bytesrrpr�rr|r�rgr�rvr�) r�r{r%r��namespace_pathZentryr�r�r}rrr� _get_spec]s(
zPathFinder._get_speccCsd|dkrtj}|j|||�}|dkr(dS|jdkr\|j}|rVd|_t|||j�|_|SdSn|SdS)z�Try to find a spec for 'fullname' on sys.path or 'path'.
The search is based on sys.path_hooks and sys.path_importer_cache. NZ namespace)rr%rr|r�r�r�)r�r{r%r�r�rrrrr�}s zPathFinder.find_speccCs|j||�}|dkrdS|jS)z�find the module on sys.path or 'path' based on sys.path_hooks and sys.path_importer_cache.
This method is deprecated. Use find_spec() instead.
N)r�r|)r�r{r%r�rrrr��szPathFinder.find_module)N)NN)N)rmrlrnror�r�r�rrrr�r�rrrrr�s r�c@sZeZdZdZdd�Zdd�ZeZdd�Zdd �Z ddd�Z d d�Zedd��Z dd�Zd S)� FileFinderz�File-based finder.
Interactions with the file system are cached for performance, being refreshed when the directory the finder is handling has been modified.
csXg}x(|D] \�}|j�fdd�|D��q W||_|p:d|_d|_t�|_t�|_dS)z�Initialize with the path to search on and a variable number of 2-tuples containing the loader and the file suffixes the loader recognizes.c3s|]}|�fVqdS)Nr)rr�)r|rrr��sz&FileFinder.__init__.<locals>.<genexpr>r=rNr[)r��_loadersr%�_path_mtime�set�_path_cache�_relaxed_path_cache)rhr%�loader_detailsZloadersr�r)r|rr��s zFileFinder.__init__cCs d|_dS)zInvalidate the directory mtime.rNr[)r)rhrrrr��szFileFinder.invalidate_cachescCs*|j|�}|dkrdgfS|j|jp&gfS)z�Try to find a loader for the specified module, or the namespace package portions. Returns (loader, list-of-portions).
This method is deprecated. Use find_spec() instead.
N)r�r|r�)rhr{r�rrrry�s zFileFinder.find_loadercCs|||�}t||||d�S)N)r|r�)r�)rhr�r{r%Zsmslr�r|rrrr�s zFileFinder._get_specNcCsbd}|jd�d}yt|jp"tj��j}Wntk rBd }YnX||jkr\|j�||_t �rr|j }|j�}n |j}|}||kr�t |j|�}xH|jD]6\} } d| }t ||�}t|�r�|j| |||g|�Sq�Wt|�}xX|jD]N\} } t |j|| �}tjd|dd�|| |kr�t|�r�|j| ||d|�Sq�W|�r^tjd |�tj|d�} |g| _| SdS)zoTry to find a spec for the specified module.
Returns the matching spec, or None if not found. Fr=r;rr�z trying {})Z verbosityNzpossible namespace for {}r[)r"r)r%rr/r�r*r�_fill_cacherr r\r rrr.rr0rvr�r�r�)rhr{r�Zis_namespaceZtail_moduler�ZcacheZcache_moduleZ base_pathr�r�Z init_filenameZ full_pathr�rrrr��sF
zFileFinder.find_specc Cs�|j}ytj|ptj��}Wntttfk r:g}YnXtjj d�sTt |�|_nNt �}x@|D]8}|jd�\}}}|r�dj ||j��}n|}|j|�q`W||_tjj t�r�dd�|D�|_dS)zDFill the cache of potential modules and packages for this directory.rr=z{}.{}cSsh|]}|j��qSr)r\)rZfnrrr� <setcomp>sz)FileFinder._fill_cache.<locals>.<setcomp>N)r%rZlistdirr/r��PermissionError�NotADirectoryErrorrr r rr rWr2r\�addrr ) rhr%ZcontentsZlower_suffix_contentsr�rfr�r�Znew_namerrrrs"
zFileFinder._fill_cachecs��fdd�}|S)aA class method which returns a closure to use on sys.path_hook which will return an instance using the specified loaders and the path called on the closure.
If the path called on the closure is not a directory, ImportError is raised.
cs"t|�std|d���|f���S)z-Path hook for importlib.machinery.FileFinder.zonly directories are supported)r%)r0rg)r%)r�rrr�path_hook_for_FileFinder*sz6FileFinder.path_hook.<locals>.path_hook_for_FileFinderr)r�rrr)r�rr� path_hook s zFileFinder.path_hookcCsdj|j�S)NzFileFinder({!r}))r2r%)rhrrrr�2szFileFinder.__repr__)N)rmrlrnror�r�rr�ryrr�rr�rr�rrrrr�s 0rcCs�|jd�}|jd�}|sB|r$|j}n||kr8t||�}n t||�}|sTt|||d�}y$||d<||d<||d<||d<Wntk r�YnXdS)N� __loader__�__spec__)r|Z__file__Z __cached__)�getr|r�r�r�� Exception)ZnsrfZpathnameZ cpathnamer|r�rrr�_fix_up_module8s"
rcCs*tttj��f}ttf}ttf}|||gS)z_Returns a list of file-based module loaders.
Each item is a tuple (loader, suffixes). )r��_alternative_architecturesr��extension_suffixesr�rXr�rN)Z extensionsZsourceZbytecoderrrr�Osr�cCs�|atjatjatjt}x8dD]0}|tjkr:tj|�}n tj|}t|||�q Wddgfdddgff}xv|D]f\}}td d �|D��s�t�|d}|tjkr�tj|}Pqpytj|�}PWqpt k r�wpYqpXqpWt d��t|d |�t|d|�t|ddj |��ytjd�} Wnt k �r4d} YnXt|d| �tjd�} t|d| �|dk�rxtjd�}t|d|�t|dt��tj ttj���|dk�r�tjd�dtk�r�dt_dS)z�Setup the path-based importers for importlib by importing needed built-in modules and injecting them into the global namespace.
Other components are extracted from the core bootstrap module.
r cCs2t|�t�}tjjtj|�g�tjjt �dS)z)Install the path-based import components.N) r r�rr�r�rr� meta_pathr�r�)rZsupported_loadersrrr�_install�sr"z-arm-linux-gnueabihf.z-armeb-linux-gnueabihf.z-mips64-linux-gnuabi64.z-mips64el-linux-gnuabi64.z-powerpc-linux-gnu.z-powerpc-linux-gnuspe.z-powerpc64-linux-gnu.z-powerpc64le-linux-gnu.z-arm-linux-gnueabi.z-armeb-linux-gnueabi.z-mips64-linux-gnu.z-mips64el-linux-gnu.z-ppc-linux-gnu.z-ppc-linux-gnuspe.z-ppc64-linux-gnu.z-ppc64le-linux-gnu.)z-arm-linux-gnueabi.z-armeb-linux-gnueabi.z-mips64-linux-gnu.z-mips64el-linux-gnu.z-ppc-linux-gnu.z-ppc-linux-gnuspe.z-ppc64-linux-gnu.z-ppc64le-linux-gnu.z-arm-linux-gnueabihf.z-armeb-linux-gnueabihf.z-mips64-linux-gnuabi64.z-mips64el-linux-gnuabi64.z-powerpc-linux-gnu.z-powerpc-linux-gnuspe.z-powerpc64-linux-gnu.z-powerpc64le-linux-gnu.cCsFx@|D]8}x2tj�D]&\}}||kr|j|j||��|SqWqW|S)z�Add a suffix with an alternative architecture name to the list of suffixes so an extension built with the default (upstream) setting is loadable with our Pythons )� _ARCH_MAP�itemsr�r7)r�r�ZoriginalZalternativerrrr�s r)r)rr)r1)N)NNN)NNN)r>r>)N)N)<rorZ%_CASE_INSENSITIVE_PLATFORMS_BYTES_KEYrr rrrr(r)r-r.r0r:�type�__code__r�rr�rrZ_RAW_MAGIC_NUMBERrMrLrXrNZDEBUG_BYTECODE_SUFFIXESZOPTIMIZED_BYTECODE_SUFFIXESrSrYr_rcrerxrr�r�r�r��objectr�r�r�r�r�r�r�r�r�r�r�r�r�rrr�r r"r#rrrrr�<module>s�
{-" 7
C@n)-5<* D c@s�dZdadd�Zdd�ZiZiZGdd�de�ZGdd �d �ZGd d�d�Z Gdd �d �Z dd�Zdd�Zdd�Z dd�dd�Zdd�Zdd�Zdd�Zdd�ZGd d!�d!�ZGd"d#�d#�Zddd$�d%d&�Zd]d'd(�Zd)d*�d+d,�Zd-d.�Zd/d0�Zd1d2�Zd3d4�Zd5d6�Zd7d8�ZGd9d:�d:�ZGd;d<�d<�ZGd=d>�d>�Z d?d@�Z!dAdB�Z"d^dCdD�Z#dEdF�Z$dGZ%e%dHZ&dIdJ�Z'e(�Z)dKdL�Z*d_dNdO�Z+d)dP�dQdR�Z,dSdT�Z-ddfdMfdUdV�Z.dWdX�Z/dYdZ�Z0d[d\�Z1dS)`aSCore implementation of import.
This module is NOT meant to be directly imported! It has been designed such that it can be bootstrapped into Python as the implementation of import. As such it requires the injection of specific modules and attributes in order to work. One should use importlib as the public-facing version of this module.
NcCs<x(dD] }t||�rt||t||��qW|jj|j�dS)z/Simple substitute for functools.update_wrapper.� __module__�__name__�__qualname__�__doc__N)rrrr)�hasattr�setattr�getattr�__dict__�update)ZnewZold�replace�r �<frozen importlib._bootstrap>�_wraps
rcCstt�|�S)N)�type�sys)�namer r r�_new_module#src@seZdZdS)�_DeadlockErrorN)rrrr r r rr0src@s8eZdZdZdd�Zdd�Zdd�Zdd �Zd d�ZdS) �_ModuleLockz�A recursive lock implementation which is able to detect deadlocks (e.g. thread 1 trying to take locks A then B, and thread 2 trying to take locks B then A). cCs0tj�|_tj�|_||_d|_d|_d|_dS)N�)�_threadZ allocate_lock�lock�wakeupr�owner�count�waiters)�selfrr r r�__init__:s
z_ModuleLock.__init__cCs@tj�}|j}x,tj|�}|dkr&dS|j}||krdSqWdS)NFT)r� get_identr�_blocking_on�get)rZme�tidrr r r�has_deadlockBs z_ModuleLock.has_deadlockcCs�tj�}|t|<z�x�|j�`|jdks0|j|krH||_|jd7_dS|j�r\td|��|jj d�rv|j d7_ WdQRX|jj �|jj�qWWdt|=XdS)z� Acquire the module lock. If a potential deadlock is detected, a _DeadlockError is raised. Otherwise, the lock is always acquired and True is returned. r�Tzdeadlock detected by %rFN)rrrrrrr rr�acquirer�release)rrr r rr"Ns z_ModuleLock.acquirec Csztj�}|j�b|j|kr"td��|jdks0t�|jd8_|jdkrld|_|jrl|jd8_|jj �WdQRXdS)Nzcannot release un-acquired lockrr!) rrrr�RuntimeErrorr�AssertionErrorrrr#)rrr r rr#gs
z_ModuleLock.releasecCsdj|jt|��S)Nz_ModuleLock({!r}) at {})�formatr�id)rr r r�__repr__tsz_ModuleLock.__repr__N) rrrrrr r"r#r(r r r rr4s rc@s0eZdZdZdd�Zdd�Zdd�Zdd �Zd S)�_DummyModuleLockzVA simple _ModuleLock equivalent for Python builds without multi-threading support.cCs||_d|_dS)Nr)rr)rrr r rr|sz_DummyModuleLock.__init__cCs|jd7_dS)Nr!T)r)rr r rr"�sz_DummyModuleLock.acquirecCs$|jdkrtd��|jd8_dS)Nrzcannot release un-acquired lockr!)rr$)rr r rr#�s z_DummyModuleLock.releasecCsdj|jt|��S)Nz_DummyModuleLock({!r}) at {})r&rr')rr r rr(�sz_DummyModuleLock.__repr__N)rrrrrr"r#r(r r r rr)xs r)c@s$eZdZdd�Zdd�Zdd�ZdS)�_ModuleLockManagercCs||_d|_dS)N)�_name�_lock)rrr r rr�sz_ModuleLockManager.__init__cCst|j�|_|jj�dS)N)�_get_module_lockr+r,r")rr r r� __enter__�sz_ModuleLockManager.__enter__cOs|jj�dS)N)r,r#)r�argsZkwargsr r r�__exit__�sz_ModuleLockManager.__exit__N)rrrrr.r0r r r rr*�sr*cCs�tj�zjyt|�}Wntk r0d}YnX|dkrptdkrLt|�}nt|�}|fdd�}tj||�t|<Wdtj �X|S)z�Get or create the module lock for a given module name.
Acquire/release internally the global import lock to protect _module_locks.Nc Ss0tj�ztj|�|krt|=Wdtj�XdS)N)�_imp�acquire_lock� _module_locksr�release_lock)�refrr r r�cb�s
z_get_module_lock.<locals>.cb) r1r2r3�KeyErrorrr)r�_weakrefr5r4)rrr6r r rr-�s
r-cCs6t|�}y|j�Wntk r(Yn X|j�dS)z�Acquires then releases the module lock for a given module name.
This is used to ensure a module is completely initialized, in the event it is being imported by another thread. N)r-r"rr#)rrr r r�_lock_unlock_module�sr9cOs |||�S)a.remove_importlib_frames in import.c will always remove sequences of importlib frames that end with a call to this function
Use it instead of a normal call in places where including the importlib frames introduces unwanted noise into the traceback (e.g. when executing module code) r )�fr/Zkwdsr r r�_call_with_frames_removed�sr;r!)� verbositycGs6tjj|kr2|jd�sd|}t|j|�tjd�dS)z=Print the message to stderr if -v/PYTHONVERBOSE is turned on.�#�import z# )ZfileN)r=r>)r�flags�verbose� startswith�printr&�stderr)�messager<r/r r r�_verbose_message�s rEcs�fdd�}t|��|S)z1Decorator to verify the named module is built-in.cs&|tjkrtdj|�|d���||�S)Nz{!r} is not a built-in module)r)r�builtin_module_names�ImportErrorr&)r�fullname)�fxnr r�_requires_builtin_wrapper�s
z4_requires_builtin.<locals>._requires_builtin_wrapper)r)rIrJr )rIr�_requires_builtin�s rKcs�fdd�}t|��|S)z/Decorator to verify the named module is frozen.cs&tj|�stdj|�|d���||�S)Nz{!r} is not a frozen module)r)r1� is_frozenrGr&)rrH)rIr r�_requires_frozen_wrapper�s
z2_requires_frozen.<locals>._requires_frozen_wrapper)r)rIrMr )rIr�_requires_frozen�s rNcCs>t||�}|tjkr2tj|}t||�tj|St|�SdS)z�Load the specified module into sys.modules and return it.
This method is deprecated. Use loader.exec_module instead.
N)�spec_from_loaderr�modules�_exec�_load)rrH�spec�moduler r r�_load_module_shim�s
rUc#Cs�t|dd�}t|d�r6y |j|�Stk r4YnXy |j}Wntk rTYnX|dk rft|�Sy |j}Wntk r�d}YnXy |j}Wn2tk r�|dkr�dj |�Sdj ||�SYnXdj ||�SdS)N� __loader__�module_repr�?z <module {!r}>z<module {!r} ({!r})>z<module {!r} from {!r}>) rrrW� Exception�__spec__�AttributeError�_module_repr_from_specr�__file__r&)rT�loaderrSr�filenamer r r�_module_repr s.
r`c@s$eZdZdd�Zdd�Zdd�ZdS)�_installed_safelycCs||_|j|_dS)N)�_modulerZ�_spec)rrTr r rr3sz_installed_safely.__init__cCsd|j_|jtj|jj<dS)NT)rc� _initializingrbrrPr)rr r rr.7sz_installed_safely.__enter__cGsbzR|j}tdd�|D��r@ytj|j=WqPtk r<YqPXntd|j|j�Wdd|j_XdS)Ncss|]}|dk VqdS)Nr )Z.0Zargr r r� <genexpr>Asz-_installed_safely.__exit__.<locals>.<genexpr>zimport {!r} # {!r}F) rc�anyrrPrr7rEr^rd)rr/rSr r rr0>sz_installed_safely.__exit__N)rrrrr.r0r r r rra1srac@sreZdZdZdddd�dd�Zdd�Zdd �Zed d��Zej dd��Zed d��Z edd��Zej dd��ZdS)� ModuleSpeca�The specification for a module, used for loading.
A module's spec is the source for information about the module. For data associated with the module, including source, use the spec's loader.
`name` is the absolute name of the module. `loader` is the loader to use when loading the module. `parent` is the name of the package the module is in. The parent is derived from the name.
`is_package` determines if the module is considered a package or not. On modules this is reflected by the `__path__` attribute.
`origin` is the specific location used by the loader from which to load the module, if that information is available. When filename is set, origin will match.
`has_location` indicates that a spec's "origin" reflects a location. When this is True, `__file__` attribute of the module is set.
`cached` is the location of the cached bytecode file, if any. It corresponds to the `__cached__` attribute.
`submodule_search_locations` is the sequence of path entries to search when importing submodules. If set, is_package should be True--and False otherwise.
Packages are simply modules that (may) have submodules. If a spec has a non-None value in `submodule_search_locations`, the import system will consider modules loaded from the spec as packages.
Only finders (see importlib.abc.MetaPathFinder and importlib.abc.PathEntryFinder) should modify ModuleSpec instances.
N)�origin�loader_state� is_packagecCs6||_||_||_||_|r gnd|_d|_d|_dS)NF)rr^rhri�submodule_search_locations� _set_fileattr�_cached)rrr^rhrirjr r rrqszModuleSpec.__init__cCsfdj|j�dj|j�g}|jdk r4|jdj|j��|jdk rP|jdj|j��dj|jjdj|��S)Nz name={!r}zloader={!r}zorigin={!r}zsubmodule_search_locations={}z{}({})z, ) r&rr^rh�appendrk� __class__r�join)rr/r r rr(}s
zModuleSpec.__repr__cCsf|j}yF|j|jkoL|j|jkoL|j|jkoL||jkoL|j|jkoL|j|jkStk r`dSXdS)NF)rkrr^rh�cached�has_locationr[)rZotherZsmslr r r�__eq__�s zModuleSpec.__eq__cCs:|jdkr4|jdk r4|jr4tdkr&t�tj|j�|_|jS)N)rmrhrl�_bootstrap_external�NotImplementedErrorZ_get_cached)rr r rrq�s zModuleSpec.cachedcCs ||_dS)N)rm)rrqr r rrq�scCs$|jdkr|jjd�dS|jSdS)z The name of the module's parent.N�.r)rkr� rpartition)rr r r�parent�s zModuleSpec.parentcCs|jS)N)rl)rr r rrr�szModuleSpec.has_locationcCst|�|_dS)N)�boolrl)r�valuer r rrr�s)rrrrrr(rs�propertyrq�setterrxrrr r r rrgLs# rg)rhrjcCs�t|d�rJtdkrt�tj}|dkr0|||d�S|r8gnd}||||d�S|dkr�t|d�r�y|j|�}Wq�tk r�d}Yq�Xnd}t||||d�S)z5Return a module spec based on various loader methods.Zget_filenameN)r^)r^rkrjF)rhrj)rrtru�spec_from_file_locationrjrGrg)rr^rhrjr}Zsearchr r rrO�s"
r�F)�overridec;Cs�|st|dd�dkr6y|j|_Wntk r4YnX|sJt|dd�dkr�|j}|dkr�|jdk r�tdkrnt�tj}|j |�}|j|_ y ||_Wntk r�YnX|s�t|dd�dkr�y|j|_ Wntk r�YnXy ||_Wntk r�YnX|�st|dd�dk�rD|jdk �rDy|j|_Wntk �rBYnX|j�r�|�sdt|dd�dk�r�y|j|_Wntk �r�YnX|�s�t|dd�dk�r�|jdk �r�y|j|_Wntk �r�YnX|S)NrrV�__package__r�r]r~)rrrr[r^rkrtru�_NamespaceLoader�__new__Z_pathrVrxr�rZr�rrrhr]rqr~)rSrTr�r^r�r r r�_init_module_attrs�s\
r�cCsRd}t|jd�r|jj|�}nt|jd�r2td��|dkrDt|j�}t||�|S)z+Create a module based on the provided spec.N� create_module�exec_modulezBloaders that define exec_module() must also define create_module())rr^r�rGrrr�)rSrTr r r�module_from_spec4s
r�cCsj|jdkrdn|j}|jdkrB|jdkr2dj|�Sdj||j�Sn$|jrVdj||j�Sdj|j|j�SdS)z&Return the repr to use for the module.NrXz <module {!r}>z<module {!r} ({!r})>z<module {!r} from {!r}>z<module {!r} ({})>)rrhr^r&rr)rSrr r rr\Es
r\cCs�|j}t|���tjj|�|k r6dj|�}t||d��|jdkrj|jdkrXtd|jd��t ||dd�|St ||dd�t |jd�s�|jj|�n|jj|�WdQRXtj|S)zFExecute the spec's specified module in an existing module's namespace.zmodule {!r} not in sys.modules)rNzmissing loaderT)r�r�) rr*rrPrr&rGr^rkr�r�load_moduler�)rSrTr�msgr r rrQVs
rQcCs�|jj|j�tj|j}t|dd�dkrLy|j|_Wntk rJYnXt|dd�dkr�y(|j|_ t |d�s�|jjd�d|_ Wntk r�YnXt|dd�dkr�y ||_Wntk r�YnX|S)NrVr�r�rvrrZ) r^r�rrrPrrVr[rr�rrwrZ)rSrTr r r�_load_backward_compatiblens(
r�cCsv|jdk rt|jd�st|�St|�}t|��6|jdkrT|jdkr`td|jd��n|jj|�WdQRXt j |jS)Nr�zmissing loader)r)r^rr�r�rarkrGrr�rrP)rSrTr r r�_load_unlocked�s
r�c Cst|j�� t|�SQRXdS)z�Return a new module object, loaded by the spec's loader.
The module is not added to its parent.
If a module is already in sys.modules, that existing module gets clobbered.
N)r*rr�)rSr r rrR�s rRc@s�eZdZdZedd��Zeddd��Zeddd��Zed d ��Z edd��Z eed d���Zeedd���Z eedd���Zee�ZdS)�BuiltinImporterz�Meta path import for built-in modules.
All methods are either class or static methods to avoid the need to instantiate the class.
cCsdj|j�S)zsReturn repr for the module.
The method is deprecated. The import machinery does the job itself.
z<module {!r} (built-in)>)r&r)rTr r rrW�szBuiltinImporter.module_reprNcCs,|dk rdStj|�r$t||dd�SdSdS)Nzbuilt-in)rh)r1Z is_builtinrO)�clsrH�path�targetr r r� find_spec�s
zBuiltinImporter.find_speccCs|j||�}|dk r|jSdS)z�Find the built-in module.
If 'path' is ever specified then the search is considered a failure.
This method is deprecated. Use find_spec() instead.
N)r�r^)r�rHr�rSr r r�find_module�s zBuiltinImporter.find_modulecCs.|jtjkr"tdj|j�|jd��ttj|�S)zCreate a built-in modulez{!r} is not a built-in module)r)rrrFrGr&r;r1Zcreate_builtin)rrSr r rr��s zBuiltinImporter.create_modulecCsttj|�dS)zExec a built-in moduleN)r;r1Zexec_builtin)rrTr r rr��szBuiltinImporter.exec_modulecCsdS)z9Return None as built-in modules do not have code objects.Nr )r�rHr r r�get_code�szBuiltinImporter.get_codecCsdS)z8Return None as built-in modules do not have source code.Nr )r�rHr r r� get_source�szBuiltinImporter.get_sourcecCsdS)z4Return False as built-in modules are never packages.Fr )r�rHr r rrj�szBuiltinImporter.is_package)NN)N)rrrr�staticmethodrW�classmethodr�r�r�r�rKr�r�rjrUr�r r r rr��s r�c@s�eZdZdZedd��Zeddd��Zeddd��Zed d ��Z edd��Z ed d��Zeedd���Z eedd���Zeedd���ZdS)�FrozenImporterz�Meta path import for frozen modules.
All methods are either class or static methods to avoid the need to instantiate the class.
cCsdj|j�S)zsReturn repr for the module.
The method is deprecated. The import machinery does the job itself.
z<module {!r} (frozen)>)r&r)�mr r rrWszFrozenImporter.module_reprNcCs tj|�rt||dd�SdSdS)NZfrozen)rh)r1rLrO)r�rHr�r�r r rr�s zFrozenImporter.find_speccCstj|�r|SdS)z]Find a frozen module.
This method is deprecated. Use find_spec() instead.
N)r1rL)r�rHr�r r rr�szFrozenImporter.find_modulecCsdS)z*Use default semantics for module creation.Nr )r�rSr r rr�szFrozenImporter.create_modulecCs@|jj}tj|�s$tdj|�|d��ttj|�}t||j �dS)Nz{!r} is not a frozen module)r) rZrr1rLrGr&r;�get_frozen_object�execr)rTr�coder r rr� s
zFrozenImporter.exec_modulecCs t||�S)z_Load a frozen module.
This method is deprecated. Use exec_module() instead.
)rU)r�rHr r rr�)szFrozenImporter.load_modulecCs tj|�S)z-Return the code object for the frozen module.)r1r�)r�rHr r rr�2szFrozenImporter.get_codecCsdS)z6Return None as frozen modules do not have source code.Nr )r�rHr r rr�8szFrozenImporter.get_sourcecCs tj|�S)z.Return True if the frozen module is a package.)r1Zis_frozen_package)r�rHr r rrj>szFrozenImporter.is_package)NN)N)rrrrr�rWr�r�r�r�r�r�rNr�r�rjr r r rr��s r�c@s eZdZdZdd�Zdd�ZdS)�_ImportLockContextz$Context manager for the import lock.cCstj�dS)zAcquire the import lock.N)r1r2)rr r rr.Ksz_ImportLockContext.__enter__cCstj�dS)z<Release the import lock regardless of any raised exceptions.N)r1r4)rZexc_typeZ exc_valueZ exc_tracebackr r rr0Osz_ImportLockContext.__exit__N)rrrrr.r0r r r rr�Gsr�cCs@|jd|d�}t|�|kr$td��|d}|r<dj||�S|S)z2Resolve a relative module name to an absolute one.rvr!z2attempted relative import beyond top-level packagerz{}.{})�rsplit�len� ValueErrorr&)r�package�levelZbitsZbaser r r� _resolve_nameTs r�cCs"|j||�}|dkrdSt||�S)N)r�rO)�finderrr�r^r r r�_find_spec_legacy]sr�c Cs�tj}|dkrtd��|s&tjdt�|tjk}x�|D]�}t��Hy |j}Wn*t k rvt |||�}|dkrrw6YnX||||�}WdQRX|dk r6|r�|tjkr�tj|}y |j} Wnt k r�|SX| dkr�|S| Sq6|Sq6WdSdS)zFind a module's spec.Nz5sys.meta_path is None, Python is likely shutting downzsys.meta_path is empty)r� meta_pathrG� _warnings�warn� ImportWarningrPr�r�r[r�rZ) rr�r�r�Z is_reloadr�r�rSrTrZr r r� _find_specfs6
r�cCsnt|t�stdjt|����|dkr,td��|dkrTt|t�sHtd��n|sTtd��|rj|dkrjtd��dS)zVerify arguments are "sane".zmodule name must be str, not {}rzlevel must be >= 0z__package__ not set to a stringz6attempted relative import with no known parent packagezEmpty module nameN)� isinstance�str� TypeErrorr&r r�rG)rr�r�r r r� _sanity_check�s
r�zNo module named z{!r}cCs�d}|jd�d}|r�|tjkr*t||�|tjkr>tj|Stj|}y |j}Wn2tk r�tdj||�}t||d�d�YnXt ||�}|dkr�ttj|�|d��nt |�}|r�tj|}t||jd�d|�|S)Nrvrz; {!r} is not a package)r�)rwrrPr;r�r[�_ERR_MSGr&�ModuleNotFoundErrorr�r�r)r�import_r�rxZ parent_moduler�rSrTr r r�_find_and_load_unlocked�s*
r�cCs^t|��&tjj|t�}|tkr*t||�SWdQRX|dkrRdj|�}t||d��t|�|S)zFind and load the module.Nz(import of {} halted; None in sys.modules)r) r*rrPr�_NEEDS_LOADINGr�r&r�r9)rr�rTrDr r r�_find_and_load�s r�rcCs*t|||�|dkr t|||�}t|t�S)a2Import and return the module based on its name, the package the call is being made from, and the level adjustment.
This function represents the greatest common denominator of functionality between import_module and __import__. This includes setting __package__ if the loader did not.
r)r�r�r��_gcd_import)rr�r�r r rr��s r�)� recursivecCs�t|d�r�x�|D]�}t|t�sN|r.|jd}nd}td|�dt|�j����q|dkrz|r�t|d�r�t||j|dd �qt||�sd j|j|�}yt ||�Wqt k r�}z&|j|kr�tj j|t�dk r�w�WYdd}~XqXqW|S)z�Figure out what __import__ should return.
The import_ parameter is a callable which takes the name of module to import. It is required to decouple the function from assuming importlib's import implementation is desired.
r�z.__all__z ``from list''zItem in z must be str, not �*�__all__T)r�z{}.{}N)rr�r�rr�r �_handle_fromlistr�r&r;r�rrrPrr�)rT�fromlistr�r��xZwhereZ from_nameZexcr r rr��s*
r�cCs�|jd�}|jd�}|dk rR|dk rN||jkrNtjd|�d|j�d�tdd�|S|dk r`|jStjd tdd�|d }d|kr�|jd�d }|S)z�Calculate what __package__ should be.
__package__ is not guaranteed to be defined or could be set to None to represent that its proper value is unknown.
r�rZNz __package__ != __spec__.parent (z != �)�)Z stacklevelzYcan't resolve package from __spec__ or __package__, falling back on __name__ and __path__rr�rvr)rrxr�r�r�rw)�globalsr�rSr r r�_calc___package__s
r�c Cs�|dkrt|�}n$|dk r|ni}t|�}t|||�}|s�|dkrTt|jd�d�S|s\|St|�t|jd�d�}tj|jdt|j�|�Snt||t�SdS)a�Import a module.
The 'globals' argument is used to infer where the import is occurring from to handle relative imports. The 'locals' argument is ignored. The 'fromlist' argument specifies what should exist as attributes on the module being imported (e.g. ``from module import <fromlist>``). The 'level' argument represents the package location to import from in a relative import (e.g. ``from ..pkg import mod`` would have a 'level' of 2).
rNrv)r�r�� partitionr�rrPrr�) rr��localsr�r�rTZglobals_r�Zcut_offr r r� __import__&s r�cCs&tj|�}|dkrtd|��t|�S)Nzno built-in module named )r�r�rGr�)rrSr r r�_builtin_from_nameIs r�cCs�|a|att�}xVtjj�D]H\}}t||�r|tjkr>t}ntj|�rt }nqt ||�}t||�qWtjt}x6dD].}|tjkr�t |�} n tj|} t||| �qxWyt d�} Wntk r�d} YnXt|d| �t d�}t|d|�dS)z�Setup importlib by importing needed built-in modules and injecting them into the global namespace.
As sys is needed for sys.modules access and _imp is needed to load built-in modules, those two modules must be explicitly passed in.
r�rNr8)r�)r1rr rP�itemsr�rFr�rLr�r�r�rr�rrG)� sys_module�_imp_moduleZmodule_typerrTr^rSZself_moduleZbuiltin_nameZbuiltin_moduleZ thread_moduleZweakref_moduler r r�_setupPs2
r�cCsBt||�tjjt�tjjt�ddl}|a|jtj t �dS)z2Install importlib as the implementation of import.rN)r�rr�rnr�r��_frozen_importlib_externalrt�_installrPr)r�r�r�r r rr�s r�)NN)N)Nr)2rrtrrr3rr$rrr)r*r-r9r;rErKrNrUr`rargrOr�r�r�r\rQr�r�rRr�r�r�r�r�r�r�Z_ERR_MSG_PREFIXr�r��objectr�r�r�r�r�r�r�r�r�r r r r�<module>s^D%$e -<IM
/ &#/SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec SRE 2.2.2 Copyright (c) 1997-2002 by Secret Labs AB �PYTHONHASHSEED: if this variable is set to 'random', a random value is used to seed the hashes of str, bytes and datetime objects. It can also be set to an integer in the range [0,4294967295] to get hash values with a predictable seed. PYTHONINTMAXSTRDIGITS: limits the maximum digit characters in an int value when converting from a string and when converting an int back to a str. A value of 0 disables the limit. Conversions to or from bases 2, 4, 8, 16, and 32 are never limited. PYTHONMALLOC: set the Python memory allocators and/or install debug hooks on Python memory allocators. Use PYTHONMALLOC=debug to install debug hooks. PYTHONCOERCECLOCALE: if this variable is set to 0, it disables the locale coercion behavior. Use PYTHONCOERCECLOCALE=warn to request display of locale coercion and locale compatibility warnings on stderr. PYTHONHOME : alternate <prefix> directory (or <prefix>%lc<exec_prefix>). The default module search path uses %s. PYTHONCASEOK : ignore case in 'import' statements (Windows). PYTHONIOENCODING: Encoding[:errors] used for stdin/stdout/stderr. PYTHONFAULTHANDLER: dump the Python traceback on fatal errors. file : program read from script file - : program read from stdin (default; interactive mode if a tty) arg ...: arguments passed to program in sys.argv[1:]
Other environment variables: PYTHONSTARTUP: file executed on interactive startup (no default) PYTHONPATH : '%lc'-separated list of directories prefixed to the default module search path. The result is sys.path. -u : force the binary I/O layers of stdout and stderr to be unbuffered; stdin is always buffered; text I/O layer will be line-buffered; also PYTHONUNBUFFERED=x -v : verbose (trace import statements); also PYTHONVERBOSE=x can be supplied multiple times to increase verbosity -V : print the Python version number and exit (also --version) when given twice, print more information about the build -W arg : warning control; arg is action:message:category:module:lineno also PYTHONWARNINGS=arg -x : skip first line of source, allowing use of non-Unix forms of #!cmd -X opt : set implementation-specific option -X int_max_str_digits=number: limit the size of int<->str conversions. This helps avoid denial of service attacks when parsing untrusted data. The default is sys.int_info.default_max_str_digits. 0 disables. -i : inspect interactively after running script; forces a prompt even if stdin does not appear to be a terminal; also PYTHONINSPECT=x -I : isolate Python from the user's environment (implies -E and -s) -m mod : run library module as a script (terminates option list) -O : remove assert and __debug__-dependent statements; add .opt-1 before .pyc extension; also PYTHONOPTIMIZE=x -OO : do -O changes and also discard docstrings; add .opt-2 before .pyc extension -q : don't print version and copyright messages on interactive startup -s : don't add user site directory to sys.path; also PYTHONNOUSERSITE -S : don't imply 'import site' on initialization Options and arguments (and corresponding environment variables): -b : issue warnings about str(bytes_instance), str(bytearray_instance) and comparing bytes/bytearray with str. (-bb: issue errors) -B : don't write .pyc files on import; also PYTHONDONTWRITEBYTECODE=x -c cmd : program passed in as string (terminates option list) -d : debug output from parser; also PYTHONDEBUG=x -E : ignore PYTHON* environment variables (such as PYTHONPATH) -h : print this help message and exit (also --help) usage: %ls [option] ... [-c cmd | -m mod | file | -] [arg] ... /:
��7y�ACn����F��?�O8M20�Hw�Z<�s�Ou�?$@Y@@�@��@j�@��.A�cA�חAe��A _�B�vH7B��mB@�0�B�ļ�B4&�kC��7y�AC�W4vC�Ngm��C=�`�X�C@��x�DP����KD��M��D} During handling of the above exception, another exception occurred:
The above exception was the direct cause of the following exception:
Copyright (c) 2000 BeOpen.com. All Rights Reserved.
Copyright (c) 1995-2001 Corporation for National Research Initiatives. All Rights Reserved.
Copyright (c) 1991-1995 Stichting Mathematisch Centrum, Amsterdam. All Rights Reserved. ghi789;CKLONM >?BA@|}~'continue' not supported inside 'finally' clause'continue' not properly in loop
Return True if all characters in B are whitespace and there is at least one character in B, False otherwise.B.isalpha() -> bool
Return True if all characters in B are alphabetic and there is at least one character in B, False otherwise.B.isalnum() -> bool
Return True if all characters in B are alphanumeric and there is at least one character in B, False otherwise.B.isdigit() -> bool
Return True if all characters in B are digits and there is at least one character in B, False otherwise.B.islower() -> bool
Return True if all cased characters in B are lowercase and there is at least one cased character in B, False otherwise.B.isupper() -> bool
Return True if all cased characters in B are uppercase and there is at least one cased character in B, False otherwise.B.istitle() -> bool
Return True if B is a titlecased string and there is at least one character in B, i.e. uppercase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.B.lower() -> copy of B
Return a copy of B with all ASCII characters converted to lowercase.B.upper() -> copy of B
Return a copy of B with all ASCII characters converted to uppercase.B.title() -> copy of B
Return a titlecased version of B, i.e. ASCII words start with uppercase characters, all remaining cased characters have lowercase.B.capitalize() -> copy of B
Return a copy of B with only its first character capitalized (ASCII) and the rest lower-cased.B.swapcase() -> copy of B
Return a copy of B with uppercase ASCII characters converted to lowercase ASCII and vice versa.B.maketrans(frm, to) -> translation table
Return a translation table (a bytes object of length 256) suitable for use in the bytes or bytearray translate method where each byte in frm is mapped to the byte at the same position in to. The bytes objects frm and to must be of the same length.B.find(sub[, start[, end]]) -> int
Return the lowest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation.
Return -1 on failure.B.index(sub[, start[, end]]) -> int
Return the lowest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation.
Raises ValueError when the subsection is not found.B.rfind(sub[, start[, end]]) -> int
Return the highest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation.
Return -1 on failure.B.rindex(sub[, start[, end]]) -> int
Return the highest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation.
Raise ValueError when the subsection is not found.B.count(sub[, start[, end]]) -> int
Return the number of non-overlapping occurrences of subsection sub in bytes B[start:end]. Optional arguments start and end are interpreted as in slice notation.B.startswith(prefix[, start[, end]]) -> bool
Return True if B starts with the specified prefix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. prefix can also be a tuple of bytes to try.B.endswith(suffix[, start[, end]]) -> bool
Return True if B ends with the specified suffix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. suffix can also be a tuple of bytes to try.B.expandtabs(tabsize=8) -> copy of B
Return a copy of B where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.B.ljust(width[, fillchar]) -> copy of B
Return B left justified in a string of length width. Padding is done using the specified fill character (default is a space).B.rjust(width[, fillchar]) -> copy of B
Return B right justified in a string of length width. Padding is done using the specified fill character (default is a space)B.center(width[, fillchar]) -> copy of B
Return B centered in a string of length width. Padding is done using the specified fill character (default is a space).B.zfill(width) -> copy of B
Pad a numeric string B with zeros on the left, to fill a field of the specified width. B is never truncated.!55555555555 5155555555555555555555555555 5 55555555555555555555555555558 Unmatched right paren in format stringUnmatched left paren in format string [GCC 8.5.0 20210514 (Red Hat 8.5.0-22)]Small block threshold = %d, in %u size classes. class size num pools blocks in use avail blocks ----- ---- --------- ------------- ------------ # bytes lost to arena alignmentno mem to build parser accelerators XXX too high nonterminal number! no mem to add parser accelerators s_push: parser stack overflow Error setting LC_CTYPE, skipping C locale coercion Python detected LC_CTYPE=C: LC_CTYPE coerced to %.20s (set another locale or PYTHONCOERCECLOCALE=0 to disable this locale coercion behavior). PyThreadState_Clear: warning: thread still has a frame Argument expected for the -%c option buffer overflow in getpath.c's joinpath()PyThreadState_Delete: NULL tstatePyThreadState_Delete: NULL interpCouldn't create autoTLSkey mappingCan't initialize threads for interpreterPyThreadState_Delete: tstate is still currentPyInterpreterState_Delete: invalid interpPyInterpreterState_Delete: remaining threadsPyInterpreterState_Delete: invalid extraPyThreadState_Get: no current thread__PyCodeExtraState_Get: no code state for interpreterPyImport_ReInitLock failed to create a new lockPyImport_GetModuleDict: no module dictionary!PyMUTEX_INIT(gil_mutex) failedPyMUTEX_INIT(switch_mutex) failedPyCOND_INIT(switch_cond) failedPyMUTEX_LOCK(gil_mutex) failedPyMUTEX_LOCK(switch_mutex) failedPyCOND_SIGNAL(switch_cond) failedPyMUTEX_UNLOCK(switch_mutex) failedPyMUTEX_UNLOCK(gil_mutex) failedPyMUTEX_FINI(gil_mutex) failedPyCOND_FINI(switch_cond) failedPyMUTEX_FINI(switch_mutex) failedPyCOND_SIGNAL(gil_cond) failedPyCOND_WAIT(switch_cond) failedPyThreadState_DeleteCurrent: no current tstatePyEval_AcquireLock: current thread state is NULLPyEval_AcquireThread: NULL new thread statePyEval_AcquireThread: non-NULL old thread statePyEval_ReleaseThread: NULL thread statePyEval_ReleaseThread: wrong thread statePyEval_SaveThread: NULL tstateauto-releasing thread-state, but no thread-state for this threadThis thread state must be current when releasingPyEval_RestoreThread: NULL tstateCouldn't create thread-state for new threadtype_traverse() called for non-heap type '%.100s'Python memory allocator called without holding the GILPyObject_CallFinalizerFromDealloc called on object with a non-zero refcounttok_backup: beginning of bufferno mem to resize dfa in adddfano mem to resize state in addstateno mem to resize arc list in addarcCan't translate NAME label '%s' Can't translate STRING label %s no mem to resize labellist in addlabelRe-calculating FIRST set for '%s' ??? no mem for new sym in calcfirstsetno mem to resize sym in calcfirstsetCompiling (meta-) parse tree into NFA grammar NFA '%s' has %d states; start %d, finish %d no mem for xx_state in makedfaError: nonterminal '%s' may produce empty. PyEval_EvalCodeEx: NULL globals/builddir/build/BUILD/Python-3.6.8/Modules/gcmodule.c%U() got an unexpected keyword argument '%S'%U() got multiple values for argument '%S' positional argument%s (and %zd keyword-only argument%s)%U() takes %U positional argument%s but %zd%U %s givencoroutine wrapper %.200R attempted to recursively wrap %.200R/builddir/build/BUILD/Python-3.6.8/Objects/dictobject.c while calling a Python object'%.200s' object is not callable/builddir/build/BUILD/Python-3.6.8/Objects/tupleobject.ccannot create '%.100s' instances%R returned NULL without setting an error%R returned a result with an error setattribute of type '%.200s' is not callable'registry' must be a dict or None_warnings.filters must be a list_warnings.filters item %zd isn't a 5-tupleaction must be a string, not '%.200s'_warnings.defaultaction must be a string, not '%.200s'warnings.onceregistry must be a dictUnrecognized action (%R) in warnings.filters: %Rwarnings._showwarnmsg() must be set to a callableunable to get warnings.WarningMessage__package__ != __spec__.parent__spec__.parent must be a stringcan't resolve package from __spec__ or __package__, falling back on __name__ and __path__attempted relative import with no known parent packageattempted relative import beyond top-level package%R not in sys.modules as expected<frozen importlib._bootstrap_external>can't initialize codec error registrycan't initialize codec registryunknown error handler name '%.400s'O!n;decoding error handler must return (str, int) tupleexception attribute object must be bytesposition %zd from error handler out of boundsType does not define the tp_name field.method cannot be both class and statictype '%.100s' is not dynamically allocated but its base type '%.100s' is dynamically allocatedtype '%.100s' participates in gc and is a base type but has inappropriate tp_free slotCan't initialize callable weakref proxy typeCan't initialize weakref proxy typeCan't initialize bytearray typeCan't initialize NotImplemented typeCan't initialize traceback typeCan't initialize dict keys typeCan't initialize dict values typeCan't initialize dict items typeCan't initialize OrderedDict typeCan't initialize odict_keys typeCan't initialize odict_items typeCan't initialize odict_values typeCan't initialize odict_keyiterator typeCan't initialize static method typeCan't initialize frozenset typeCan't initialize property typeCan't initialize managed buffer typeCan't initialize memoryview typeCan't initialize enumerate typeCan't initialize reversed typeCan't initialize builtin function typeCan't initialize function typeCan't initialize dict proxy typeCan't initialize generator typeCan't initialize get-set descriptor typeCan't initialize method wrapper typeCan't initialize ellipsis typeCan't initialize member descriptor typeCan't initialize namespace typeCan't initialize long range iterator typeCan't initialize instance method typeCan't initialize class method descr typeCan't initialize method descr typeCan't initialize call iter typeCan't initialize sequence iterator typeCan't initialize coroutine typeCan't initialize coroutine wrapper typeOut of memory interning slotdef namesNULL object passed to Py_BuildValuebad format char passed to Py_BuildValueOn;encoding error handler must return (str/bytes, int) tupleattribute name must be string, not '%.200s''%.50s' object has no attribute '%U'issubclass() arg 1 must be a classissubclass() arg 2 must be a class or tuple of classesmaximum recursion depth exceeded while normalizing an exceptionCannot recover from MemoryErrors while normalizing exceptions.Cannot recover from the recursive normalization of an exception.keyword list must be a dictionary while getting the str of an object__str__ returned non-string (type %.200s)character argument not in range(0x110000)PyUnicode_FromFormatV() expects an ASCII-encoded format string, got a non-ASCII byte: 0x%02x<%s %s object owner=%ld count=%lu at %p><weakref at %p; to '%s' at %p><weakref at %p; to '%s' at %p (%U)><super: <class '%s'>, <%s object>><built-in method %s of %s object at %p><stdprinter(fd=%d) object at 0x%x><async_generator object %S at %p><method-wrapper '%s' of %s object at %p><slot wrapper '%V' of '%s' objects><attribute '%V' of '%s' objects><code object %U at %p, file "%U", line %d><code object %U at %p, file ???, line %d><cell at %p: %.80s object at %p>%U: inconsistent use of tabs and spaces in indentation Python C API version mismatch for module %.100s: This Python has API version %d, module %.100s has version %d.bad argument to internal function%s:%d: bad argument to internal function/builddir/build/BUILD/Python-3.6.8/Objects/weakrefobject.c/builddir/build/BUILD/Python-3.6.8/Objects/typeobject.c/builddir/build/BUILD/Python-3.6.8/Objects/setobject.c/builddir/build/BUILD/Python-3.6.8/Objects/moduleobject.c/builddir/build/BUILD/Python-3.6.8/Objects/methodobject.c/builddir/build/BUILD/Python-3.6.8/Objects/longobject.c/builddir/build/BUILD/Python-3.6.8/Objects/listobject.c/builddir/build/BUILD/Python-3.6.8/Objects/iterobject.c/builddir/build/BUILD/Python-3.6.8/Objects/funcobject.c/builddir/build/BUILD/Python-3.6.8/Objects/codeobject.c/builddir/build/BUILD/Python-3.6.8/Objects/classobject.c/builddir/build/BUILD/Python-3.6.8/Objects/cellobject.c/builddir/build/BUILD/Python-3.6.8/Objects/bytesobject.c/builddir/build/BUILD/Python-3.6.8/Objects/bytearrayobject.cexception %R not a BaseException subclassOut of memory and PyExc_MemoryError is not initialized yet/builddir/build/BUILD/Python-3.6.8/Python/pystrtod.cbad argument type for built-in operationImpossible unicode object state, wstr and str should share memory already./builddir/build/BUILD/Python-3.6.8/Objects/unicodeobject.cunable to get the current thread stateI/O operation on uninitialized objectunderlying buffer has been detachedExisting exports of data: object cannot be re-sizedcould not find io module state (interpreter shutdown?)the processor time used is not available or its value cannot be representedclock_gettime(CLOCK_PROCESS_CPUTIME_ID)deque mutated during iterationcannot copy this pattern objectmaximum recursion limit exceededinternal error in regular expression engineLoad averages are unobtainablecannot release un-acquired lockfilesystem encoding is not initializedtimestamp out of range for platform time_tinteger argument expected, got float/builddir/build/BUILD/Python-3.6.8/Python/getargs.ckeyword arguments must be stringsfield body is required for Expressionfield name is required for ClassDeffield value is required for Assignfield test is required for Whilefield test is required for Assertfield value is required for Exprfield op is required for BoolOpfield elt is required for ListCompfield elt is required for SetCompfield elt is required for GeneratorExpfield value is required for Awaitfield value is required for YieldFromfield left is required for Comparefield func is required for Callfield value is required for FormattedValuefield value is required for NameConstantfield ctx is required for Listfield ctx is required for Tuplefield value is required for Indexfield value is required for keywordfield name is required for aliasfield context_expr is required for withitemfield name is required for FunctionDeffield args is required for FunctionDeffield name is required for AsyncFunctionDeffield args is required for AsyncFunctionDeffield target is required for AugAssignfield op is required for AugAssignfield value is required for AugAssignfield target is required for AnnAssignfield annotation is required for AnnAssignfield target is required for Forfield iter is required for Forfield target is required for AsyncForfield iter is required for AsyncForfield left is required for BinOpfield op is required for BinOpfield right is required for BinOpfield op is required for UnaryOpfield operand is required for UnaryOpfield args is required for Lambdafield body is required for Lambdafield test is required for IfExpfield body is required for IfExpfield orelse is required for IfExpfield key is required for DictCompfield value is required for DictCompfield value is required for Constantfield value is required for Attributefield attr is required for Attributefield ctx is required for Attributefield value is required for Subscriptfield slice is required for Subscriptfield ctx is required for Subscriptfield value is required for Starredfield ctx is required for Starredfield ctx is required for Namefield target is required for comprehensionfield iter is required for comprehensionweakly-referenced object no longer existsCannot modify a string currently usedNegative size passed to _PyUnicode_NewNegative size passed to PyUnicode_FromStringAndSizeinvalid maximum character passed to PyUnicode_NewNegative size passed to PyUnicode_NewCan't initialize encoding map typeCan't initialize field name iterator typeCan't initialize formatter iter typechr() arg not in range(0x110000)code point in surrogate code point range(0xd800, 0xe000)code point not in range(0x110000)This object has no __weakref__object.__init__() takes no parametersmetaclass conflict: the metaclass of a derived class must be a (non-strict) subclass of the metaclasses of all its basestuple assignment index out of rangeEllipsisType takes no argumentsSet changed size during iterationPyCapsule_New called with null pointerPyCapsule_GetPointer called with invalid PyCapsule objectPyCapsule_GetPointer called with incorrect namePyCapsule_GetName called with invalid PyCapsule objectPyCapsule_GetDestructor called with invalid PyCapsule objectPyCapsule_GetContext called with invalid PyCapsule objectPyCapsule_SetPointer called with null pointerPyCapsule_SetPointer called with invalid PyCapsule objectPyCapsule_SetName called with invalid PyCapsule objectPyCapsule_SetDestructor called with invalid PyCapsule objectPyCapsule_SetContext called with invalid PyCapsule objectNotImplementedType takes no arguments<method>.__class__.__qualname__ is not a unicode objectoperation forbidden on released memoryview objectmemoryview: number of dimensions must not exceed 64memoryview assignment: lvalue and rvalue have different structuresPyBuffer_ToContiguous: len != view->lendictionary changed size during iterationpopitem(): dictionary is emptysys.getcheckinterval() and sys.setcheckinterval() are deprecated. Use sys.getswitchinterval() instead.int has too many bits to express in a platform size_tcannot convert float infinity to integercannot convert float NaN to integerPython int too large to convert to C ssize_tcan't convert negative value to unsigned intPython int too large to convert to C unsigned longcan't convert negative value to size_tPython int too large to convert to C size_tbyte array too long to convert to intcan't convert negative int to unsignedhuge integer: number of bits overflows a Py_ssize_tint too large to convert to floatcannot add more objects to listlist assignment index out of rangePyState_RemoveModule called on module with slotsPyState_RemoveModule: Module index invalid.PyState_RemoveModule: Interpreters module-list not acessible.PyState_RemoveModule: Module index out of bounds.__kwdefaults__ must be set to a dict object__defaults__ must be set to a tuple objectuninitialized staticmethod object__annotations__ must be set to a dict object__qualname__ must be set to a string object__name__ must be set to a string objectnon-dict keyword only default argscan't unpack IEEE 754 special value on non-IEEE platformfloat too large to pack with e formatfloat too large to pack with f formatfloat too large to pack with d formatcannot create 'stderrprinter' instancesexception cause must be None or derive from BaseException__context__ may not be deletedexception context must be None or derive from BaseException__traceback__ may not be deleted__traceback__ must be a traceback or None<descriptor>.__name__ is not a unicode object<descriptor>.__objclass__.__qualname__ is not a unicode objectcan't convert complex to floatcan't take floor of complex number.can't take floor or mod of complex number.not enough arguments for format stringbytes object is too large to make reprbytearray object is too large to make reprNegative size passed to PyByteArray_FromStringAndSizenull argument to internal routinesuper(type, obj): obj must be an instance or subtype of typePyBuffer_FillInfo: view==NULL argument is obsoleteexpected a writable bytes-like objectNegative size passed to PyBytes_FromStringAndSizeencoded result is too long for a Python stringPyBytes_FromFormatV(): %c format expects an integer in range [0; 255]bytesiobuf_getbuffer: view==NULL argument is obsoletePyState_AddModule called on module with slotsPyState_AddModule: Module Definition is NULLPyState_AddModule: Module already added!AST identifier must be of type strbytearray_getbuffer: view==NULL argument is obsoletecannot convert Infinity to integer ratiocannot convert NaN to integer ratiowith Barry as BDFL, use '<>' instead of '!='EOF while scanning triple-quoted string literalEOL while scanning string literalinconsistent use of tabs and spaces in indentationunindent does not match any outer indentation leveltoo many levels of indentationunexpected character after line continuation characterinvalid character in identifiermultiple statements found while compiling a single statementcodec must pass exception instanceasync generator already executingcan't send non-None value to a just-started coroutinecan't send non-None value to a just-started generatorcan't send non-None value to a just-started async generatorcoroutine raised StopIterationgenerator raised StopIterationasync generator raised StopIterationcannot reuse already awaited coroutinegenerator '%.50S' raised StopIterationasync generator raised StopAsyncIterationunable to raise a stack overflow (allocated %zu bytes on the stack, %zu recursive calls)signal %i cannot be registered, use enable() insteadcould not acquire lock for %A at interpreter shutdown, possibly due to daemon threadsinteger argument expected, got '%s'Argument given by name ('%s') and position (1)The '%s' keyword parameter name is deprecated. Use 'string' instead.Required argument 'string' (pos 1) not foundUnknown format code '%c' for object of type '%.200s'Unknown format code '\x%x' for object of type '%.200s'could not convert string to %s: %Rcould not convert string to float: %.200svalue too large to convert to float: %.200scomplex() arg is a malformed stringPyArg_UnpackTuple() argument list is not a tuple%s expected %s%zd arguments, got %zdunpacked tuple should have %s%zd elements, but has %zdoptional 3rd arg must be a dictionary__get__(None, None) is invalid%s does not take keyword argumentsfirst argument must be callable%s does not take positional argumentslocal variable '%.200s' referenced before assignmentfree variable '%.200s' referenced before assignment in enclosing scopeCannot recover from stack overflow.maximum recursion depth exceeded%s%.200s%.200s argument after ** must be a mapping, not %.200s%.200s%.200s argument after * must be an iterable, not %.200s'%.200s' object is not an iteratorcannot create weak reference to '%s' objectcharacter U+%x is not in range [U+0000; U+10ffff]string is too long to generate reprABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/fill character is bigger than the string maximum characterstrings are too large to concatreleasing %zd interned strings Inconsistent interned string state.total size of all interned strings: %zd/%zd mortal/immortal decoder should return a string result, not '%.200s'ord() expected string of length 1, but %.200s foundord() expected a character, but string of length %zd foundSingle '}' encountered in format stringSingle '{' encountered in format stringend of string while looking for conversion specifierexpected ':' after conversion specifierexpected '}' before end of stringattribute name must be a stringToo many decimal digits in format stringOnly '.' or '[' may follow ']' in format field specifierEmpty attribute in format stringThe fill character must be a unicode character, not %.100sThe fill character must be exactly one character longstring is longer than the bufferCannot write %zi characters at %zi in a string of %zi charactersCannot copy %s characters into a string of %s charactersprivate identifier too large to be mangledMissing parentheses in call to 'print'. Did you mean print(%U%s)?Missing parentheses in call to 'exec'Can't convert '%.100s' object to str implicitlyseparator: expected str instance, %.80s foundsequence item %zd: expected str instance, %.80s foundjoin() result is too long for a Python stringCan't compare %.100s and %.100sexpected %d arguments, got %zdcan't apply this %s to %s objectcan only assign string to %s.__qualname__, not '%s'type '%.100s' is not an acceptable base typemultiple bases have instance lay-out conflictcan only concatenate tuple (not "%.200s") to tuple/builddir/build/BUILD/Python-3.6.8/Objects/object.c'%s' not supported between instances of '%.100s' and '%.100s'deque mutated during remove().deque.remove(x): x not in deque%s assignment: '%s' deallocator differs from '%s'%s assignment: '%s' object layout differs from '%s'can't delete __class__ attribute__class__ must be set to a class, not '%s' object__class__ assignment only supported for heap types or ModuleType subclassesmemoryview: internal error in richcompareother argument must be K instancecannot hash writable memoryview objectmemoryview: hashing is restricted to formats 'B', 'b' or 'c'deletion of interned string failedImmortal interned string died. while getting the repr of an object__repr__ returned non-string (type %.200s)In structseq_repr(), member %d name is NULL for type %.500s'%.200s' object is not iterable__dict__ must be set to a dictionary, not a '%.200s'memoryview: underlying buffer is not writablememoryview: underlying buffer is not C-contiguousmemoryview: underlying buffer is not Fortran contiguousmemoryview: underlying buffer is not contiguousmemoryview: underlying buffer requires suboffsetsmemoryview: cannot cast to unsigned bytes if the format flag is presentmemoryview has %zd exported buffer%s_memory_release(): negative export countmemoryview: unsupported format %sindex out of bounds on dimension %dmemoryview: format %s not supportedinvalid indexing of 0-dim memorymulti-dimensional sub-views are not implemented%s() requires a dict argument, not '%s'an integer is required (got type %.200s)__int__ returned non-int (type %.200s)__int__ returned non-int (type %.200s). The ability to return an instance of a strict subclass of int is deprecated, and may be removed in a future version of Python.Python int too large to convert to C intconfiguration names must be strings or integersunrecognized configuration namePython int too large to convert to C longfile is not a valid file descripterfile.fileno() is not a valid file descriptormust have a sched_param object<symtable entry %U(%ld), line %d>range too large to represent as a range_iteratorExceeds the limit (%d) for integer string conversion; use sys.set_int_max_str_digits() to increase the limitint() arg 2 must be >= 2 and <= 36int string too large to convertExceeds the limit (%d) for integer string conversion: value has %zd digits; use sys.set_int_max_str_digits() to increase the limitinvalid literal for int() with base %d: %.200Rcan only concatenate list (not "%.200s") to list__code__ must be set to a code object%U() requires a code object with %zd free vars, not %zdexpected tuple for closure, got '%.100s'__getformat__() argument must be string, not %.500s__getformat__() argument 1 must be 'double' or 'float'insane float_format or double_formatcould not convert string to float: %Rmust be real number, not %.50s%.50s.__float__ returned non-float (type %.50s)%.50s.__float__ returned non-float (type %.50s). The ability to return an instance of a strict subclass of float is deprecated, and may be removed in a future version of Python.Invalid value NaN (not a number)timestamp too large to convert to C _PyTime_t0.0 to a negative or complex power__await__() returned a coroutine__await__() returned non-iterator of type '%.100s'object %.100s can't be used in 'await' expression%.200s attribute must be unicodedon't know how to handle %.200s in error callbackdescriptor '%V' for type '%s' needs either an object or a typedescriptor '%V' for type '%s' needs a type, not a '%s' as arg 2descriptor '%V' for type '%s' doesn't apply to type '%s'descriptor '%V' of '%.100s' object needs an argumentdescriptor '%V' requires a type but received a '%.100s'descriptor '%V' requires a subtype of '%.100s' but received '%.100sdescriptor '%V' for '%s' objects doesn't apply to '%s' objectattribute '%V' of '%.100s' objects is not readablemappingproxy() argument must be a mapping, not %sdescriptor '%V' for '%.100s' objects doesn't apply to '%.100s' objectattribute '%V' of '%.100s' objects is not writablename tuples must contain only strings, not '%.500s'can't jump from the 'call' trace event of a new framef_lineno can only be set by a trace functioncan only jump from a 'line' trace eventline %d comes before the current code blockline %d comes after the current code blockcan't jump from a yield statementcan't jump to 'except' line as there's no exceptioncan't jump into or out of a 'finally' blockcan't jump into the middle of a blockfloat argument required, not %.200snon-hexadecimal number found in fromhex() arg at position %zdmaketrans arguments must have same lengthunsupported operand type(s) for ** or pow(): '%.100s' and '%.100s'unsupported operand type(s) for pow(): '%.100s', '%.100s', '%.100s'unsupported operand type(s) for %.100s: '%.100s' and '%.100s'unsupported operand type(s) for %.100s: '%.100s' and '%.100s'. Did you mean "print(<message>, file=<output_stream>)"?a bytes-like object is required, not '%.100s'both destination and source must be bytes-like objectsdestination is too small to receive data from sourceexpected string or bytes-like objectmemoryview: a bytes-like object is required, not '%.200s'underlying buffer is not writablewritable contiguous buffer requested for a non-contiguous object.translation table must be 256 characters longcan't set bytearray slice from %.100scannot use a string pattern on a bytes-like objectcannot use a bytes pattern on a string-like object<%s object; span=(%d, %d), match=%.50R>bad operand type for unary -: '%.200s'bad operand type for unary +: '%.200s'bad operand type for unary ~: '%.200s'bad operand type for abs(): '%.200s''%.200s' object cannot be interpreted as an integer__index__ returned non-int (type %.200s)__index__ returned non-int (type %.200s). The ability to return an instance of a strict subclass of int is deprecated, and may be removed in a future version of Python.PyNumber_ToBase: index not intstring too large in _PyUnicode_FormatLongcannot fit '%.200s' into an offset-sized integergid should be integer, not %.200suid should be integer, not %.200sargument should be integer or None, not %.200sslice indices must be integers or None or have an __index__ methodmemoryview: invalid type for format '%s'memoryview: invalid value for format '%s'object of type '%.200s' has no len()'%.200s' object can't be concatenated'%.200s' object can't be repeated'%.200s' object does not support indexing'%.200s' object is unsliceablefirst argument must be callable or None'%.200s' object does not support item assignment'%.200s' object doesn't support item deletion'%.200s' object doesn't support slice assignment'%.200s' object doesn't support slice deletion%s returned NULL without setting an error%s returned a result with an error setiter() returned non-iterator of type '%.100s'signal number %ld out of rangesum() can't sum strings [use ''.join(seq) instead]sum() can't sum bytes [use b''.join(seq) instead]sum() can't sum bytearray [use b''.join(seq) instead]iter(v, w): v must be callableexpression which can't be assigned to in %s contextexpression must have %s context but has %s insteadBoolOp with less than 2 valuesDict doesn't have the same number of keys as valuesCompare has a different number of comparators and operandsgot an invalid type in Constant: %sNone disallowed in expression listcomprehension with no generatorsmore positional defaults than args on argumentslength of kwonlyargs is not the same as kw_defaults on argumentsAnnAssign with simple non-Name targetRaise with cause but no exceptionTry has neither except handlers nor finalbodyTry has orelse but no except handlersNone disallowed in statement listSuite is not valid in the CPython compilerargument of type '%.200s' is not iterablesequence.index(x): x not in sequenceinvalid decimal Unicode string%.200s() takes no keyword arguments%.200s() takes no arguments (%zd given)%.200s() takes exactly one argument (%zd given)Bad call flags in PyCFunction_Call. METH_OLDARGS is no longer supported!Cannot specify both ',' and '_'.Format specifier missing precisionCannot specify '%c' with '%c'.Cannot specify '%c' with '\x%x'.Sign not allowed in string format specifierAlternate form (#) not allowed in string format specifier'=' alignment not allowed in string format specifierStack (most recent call first): unable to get the interpreter stateunable to get the thread head state/builddir/build/BUILD/Python-3.6.8/Python/traceback.c%.200s attribute must be bytescannot fit '%.200s' into an index-sized integercan't multiply sequence by non-int of type '%.200s'sequence index must be integer, not '%.200s''%.200s' object is not subscriptablecharacter mapping must be in range(0x%x)character mapping must return integer, None or strcharacter mapping must be in range(256)character mapping must return integer, bytes or None, not %.400scharacter mapping must be in range(0x%lx)need more than 0 values to unpackneed more than 1 value to unpacktoo many values to unpack (expected 2)'%.200s' object does not support item deletion/builddir/build/BUILD/Python-3.6.8/Objects/frameobject.cco_varnames must be a tuple, not %svars() argument must have __dict__ attributea strictly positive integer is requiredinteger argument expected, got '%.200s'slice indices must be integers or have an __index__ methodcannot index %zd-dimension view with %zd-element tuplebytes must be in range(0, 256)expected a subclass of ImportErrorCannot create a consistent method resolution order (MRO) for basesexceptions bootstrapping error.Module dictionary insertion problem.Cannot allocate map from errnos to OSError subclassesCould not preallocate MemoryError objectcould not allocate locks for faulthandlermap() must have at least two arguments.'in <string>' requires string as left operand, not %.100srange object index out of rangerange indices must be integers or slices, not %.200sunexpected binary operation %d on a constantunexpected unary operation %d on a constantrange() arg 3 must not be zero%.200s.__dict__ is not a dictionaryexecution of module %s failed without setting an exceptionexecution of module %s raised unreported exceptionmodule %s initialized with unknown slot %iPyModule_AddObject() needs module as first argPyModule_AddObject() needs non-NULL valuezip_longest() got an unexpected keyword argumentzip_longest argument #%zd must support iterationunknown scope for %.100s in %.100s(%s) symbols: %s locals: %s globals: %simport: deleting existing key in sys.modules failedLoaded module %R not found in sys.modulesthis __dict__ descriptor does not support '%.200s' objects'%.200s' object is not a containerOrderedDict mutated during iterationOrderedDict changed size during iterationthe BufferedRWPair object is being garbage-collectedhasattr(): attribute name must be stringIncrementalNewlineDecoder.__init__ not calledRaw stream returned invalid position %zdbuffer size must be strictly positiveFile or stream is not writable.File or stream is not readable.File or stream is not seekable.required field "name" missing from aliastype object '%.50s' has no attribute '%U'__bool__ should return bool, returned %sexpected str, bytes or os.PathLike object, not %.200sexpected %.200s.__fspath__() to return str or bytes, not %.200sType %.100s doesn't define __sizeof____sizeof__() should return >= 0__complex__ should return a complex object__length_hint__ must be an integer, not %.100s__length_hint__() should return >= 00123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ_abcdefghijklmnopqrstuvwxyzcannot convert '%.200s' object to bytes__bytes__ returned non-bytes (type %.200s)'%.200s' object is not reversibleparam invalid for deref variableparam invalid for local variableparam invalid for global variableparam invalid for name variablelookup %s in %s %d %d freevars of %s: %s Stop argument for islice() must be None or an integer: 0 <= x <= sys.maxsize.Indices for islice() must be None or an integer: 0 <= x <= sys.maxsize.Step for islice() must be a positive integer or None.module '%U' has no attribute '%U'string indices must be integerstuple indices must be integers or slices, not %.200slist indices must be integers or slices, not %.200sbyte indices must be integers or slices, not %.200sbytearray indices must be integers or slices, not %.200scan assign only bytes, buffers, or iterables of ints in range(0, 256)attempt to assign bytes of size %zd to extended slice of size %zdcannot modify read-only memorymemoryview slice assignments are currently restricted to ndim = 1multi-dimensional slicing is not implementedzip argument #%zd must support iterationnull file for PyFile_WriteString [Previous line repeated %ld more times] [Previous line repeated %ld more time] Traceback (most recent call last): TypeError: print_exception(): Exception expected for value, '%U' codec can't decode byte 0x%02x in position %zd: %U'%U' codec can't decode bytes in position %zd-%zd: %Ucan't translate character '\x%02x' in position %zd: %Ucan't translate character '\u%04x' in position %zd: %Ucan't translate character '\U%08x' in position %zd: %Ucan't translate characters in position %zd-%zd: %U'%U' codec can't encode character '\x%02x' in position %zd: %U'%U' codec can't encode character '\u%04x' in position %zd: %U'%U' codec can't encode character '\U%08x' in position %zd: %U'%U' codec can't encode characters in position %zd-%zd: %UFormat specifier must be a string, not %.200sType %.100s doesn't define __format____format__ must return a str, not %.200scannot switch from automatic field numbering to manual field specificationFormat string contains positional fieldsUnknown conversion specifier %cUnknown conversion specifier \x%xcannot switch from manual field specification to automatic field numberingintermediate overflow during divisioninteger division result too large for a floatinteger division or modulo by zeropow() 3rd argument cannot be 0pow() 2nd argument cannot be negative when 3rd argument specifiednon-integer arguments in divisionreduce() arg 2 must support iterationreduce() of empty sequence with no initial valuedecoder must return a tuple (object,integer)encoder must return a tuple (object, integer)no codec search functions registered: can't find encodingcodec search functions must return 4-tuples'%.400s' is not a text encoding; use %s to handle arbitrary codecsPy_Initialize: Unable to get the locale encodingobject %.50s does not have __anext__ methodobject %.50s does not have __aiter__ methodobject %.50s does not have __await__ method__hash__ method should return an integer/builddir/build/BUILD/Python-3.6.8/Objects/fileobject.cobject.readline() returned non-stringfileno() returned a non-integerargument must be an int, or have a fileno() method.file descriptor cannot be a negative integer (%i)PyErr_NewException: name must be module.classdescriptor '%V' requires a '%.100s' object but received a '%.100s'isinstance() arg 2 must be a type or tuple of typesupdate() takes at most 1 positional argument (%d given)expected at most 1 arguments, got %dgetattr(): attribute name must be stringcan't delete numeric/char attributeattribute value type must be boolTruncation of value to unsigned charTruncation of value to unsigned shortWriting negative value into unsigned fieldTruncation of value to unsigned int%s() arg 1 must be a %s objectsource code string cannot contain null bytescan only assign string to %s.__name__, not '%s'type name must not contain null charactersError in PYTHONINTMAXSTRDIGITS: invalid limit; must be >= 640 or 0 for unlimited. Error in -X int_max_str_digits: invalid limit; must be >= 640 or 0 for unlimited. __trunc__ returned non-Integral (type %.200s)int() argument must be a string, a bytes-like object or a number, not '%.200s'%%%c format: an integer is required, not %.200s%%%c format: a number is required, not %.200sunsupported format character '%c' (0x%x) at index %zdnot all arguments converted during string formatting%%b requires a bytes-like object, or an object that implements __bytes__, not '%.100s'%%%c format: %s is required, not %.200s%c requires an integer in range(256) or a single bytenot all arguments converted during bytes formattinghexadecimal string too long to converthexadecimal value too large to represent as a floatinvalid hexadecimal floating-point stringfloat() argument must be a string or a number, not '%.200s'Non-UTF-8 code starting with '\x%.2x' in file %U on line %i, but no encoding declared; see http://python.org/dev/peps/pep-0263/ for detailsencoder %s returned bytearray instead of bytes; use codecs.encode() to encode to arbitrary types'%.400s' encoder returned '%.400s' instead of 'bytes'; use codecs.encode() to encode to arbitrary typesmust be %d-item sequence, not %.50smust be sequence of length %d, not %zdunsigned byte integer is less than minimumunsigned byte integer is greater than maximumsigned short integer is less than minimumsigned short integer is greater than maximumsigned integer is greater than maximumsigned integer is less than minimum(unknown parser marker combination)encoded string too long (%zd, maximum length %zd)encoded string without null bytes(invalid use of 'w' format character)Invalid format string (| specified twice)Invalid format string ($ before |)Invalid format string ($ specified twice)More keyword list entries (%d) than format specifiers (%d)more argument specifiers than keyword list entries (remaining format:'%s')%s%s takes at most %d argument%s (%zd given)Function takes %s %d positional arguments (%d given)Argument given by name ('%U') and position (%d)Required argument '%U' (pos %d) not found'%U' is an invalid keyword argument for this functioncannot deepcopy this match objectcannot deepcopy this pattern objectregular expression code size limit exceededsplit() requires a non-empty pattern match.Argument given by name ('%s') and position (%d)Required argument '%s' (pos %d) not foundtimeout must be greater than 0Timeout (%lu:%02lu:%02lu.%06lu)! unable to start watchdog threadthe first argument must be callablemaxsize should be integer or Nonecallable finalizer expected, got %.50scallable firstiter expected, got %.50smaxdigits must be 0 or larger than %dtype %.100s doesn't define __round__ methodCannot specify a default for %s() with multiple positional argumentsmemoryview: format argument must be a stringmemoryview: casts are restricted to C-contiguous viewsshape must be a list or a tuplememoryview: cast must be 1D -> ND or ND -> 1Dmemoryview: destination format must be a native single character format prefixed with an optional '@'memoryview: cannot cast between two non-byte formatsmemoryview: length is not a multiple of itemsizememoryview.cast(): elements of shape must be integersmemoryview.cast(): elements of shape must be integers > 0memoryview.cast(): product(shape) > SSIZE_MAXmemoryview: product(shape) * itemsize != buffer sizememoryview: cannot cast view with zeros in shape or strides'signed' is a keyword-only argumentbyteorder must be either 'little' or 'big'length argument must be non-negativeint() base must be >= 2 and <= 36, or 0int() can't convert non-string with explicit basemust use keyword argument for key functionarg 3 (name) must be None or stringarg 4 (defaults) must be None or tuplearg 5 (closure) must be None or tuple%U requires closure of length %zd, not %zdarg 5 (closure) expected cell, found %scomplex() can't take second arg if first is a stringcomplex() second arg can't be a stringcomplex() second argument must be a number, not '%.200s'float(r) didn't return a floatcomplex() first argument must be a string or a number, not '%.200s'On:combinations_with_replacementrepeat argument cannot be negativemust be str or None, not %.100stoo many tuple nesting levels in argument format string%.200s%s takes at least one argumentold style getargs format uses new featuresnew style getargs format but argument is not a tuple%.150s%s takes %s %d argument%s (%ld given)No such frozen object named %Rcannot add more objects to bytearray/builddir/build/BUILD/Python-3.6.8/Modules/zipimport.cinvalid whence (%i, should be 0, 1 or 2)Tuple or struct_time argument requireddeque already at its maximum sizecomparing strings with non-ASCII characters is not supportedunsupported operand types(s) or combination of types: '%.100s' and '%.100s'Buffer must be single dimensionsize must be 0 or a positive valuesetting stack size not supportedrecursion limit must be greater or equal than 1cannot set the recursion limit to %i at the recursion depth %i: the limit is too lowsys.getcheckinterval() and sys.setcheckinterval() are deprecated. Use sys.setswitchinterval() instead.switch interval must be strictly positivesuper(): __class__ is not a type (%s)super(): __class__ cell not foundunsupported format string passed to %.200s.__format__tuple.index(x): x not in tuple__setformat__() argument 1 must be 'double' or 'float'__setformat__() argument 2 must be 'unknown', 'IEEE, little-endian' or 'IEEE, big-endian'can only set %s format to 'unknown' or the detected platform valuerounded value too large to representInvalid whence (%i, should be 0, 1 or 2)Can't do nonzero cur-relative seeksillegal decoder state: the first item should be a bytes object, not '%.200s'underlying %s() should have returned a bytes-like object, not '%.200s's*|z:raw_unicode_escape_decodeunicode_internal codec has been deprecatedstat_float_times() is deprecatedfirst maketrans argument must be a string if there is a second argumentthe first two maketrans arguments must have equal lengthif you give only one argument to maketrans it must be a dictstring keys in translate table must be of length 1keys in translate table must be strings or integerstuple for startswith must only contain str, not %.100sstartswith first arg must be str or a tuple of str, not %.100stuple for endswith must only contain str, not %.100sendswith first arg must be str or a tuple of str, not %.100s%s first arg must be bytes or a tuple of bytes, not %sstring argument without an encodingerrors without a string argumentencoding or errors without sequence argumentencoding without a string argumentinvalid \x escape at position %ddecoding error; unknown error handling code: %.400sencoding or errors without a string argumentonly 'strict' and 'surrogateescape' error handlers are supported, not '%s'mbstowcs() encountered an invalid multibyte sequencestrerror() argument out of rangeZero padding is not allowed in complex format specifier'=' alignment flag is not allowed in complex format specifierPrecision not allowed in integer format specifierSign not allowed with integer format specifier 'c'Alternate form (#) not allowed with integer format specifier 'c'Exception ignored when trying to write to the signal wakeup fd: signal only works in main threadsignal handler must be signal.SIG_IGN, signal.SIG_DFL, or a callable objectsetgroups argument must be a sequencegetrandom is not FIPS compliantwritev() arg 2 must be a sequencereadv() arg 2 must be a sequencecould not allocate a large enough CPU setexpected an iterator of ints, but iterator yielded %Rutime: you may specify either 'times' or 'ns' but not bothutime: 'times' must be either a tuple of two ints or Noneutime: 'ns' must be a tuple of two ints%s: can't specify dir_fd without matching path%s: can't specify both dir_fd and fd%s: cannot use fd and follow_symlinks togetherillegal environment variable nameUnable to decode path variables in getpath.c: memory error/builddir/build/BUILD/Python-3.6.8Could not find platform independent libraries <prefix> Could not find platform dependent libraries <exec_prefix> Consider setting $PYTHONHOME to <prefix>[:<exec_prefix>] Not enough memory for dynamic PYTHONPATHunbounded read returned more bytes than a Python bytes object can holdset_wakeup_fd only works in main threadthe fd %i must be in non-blocking modeclock_gettime(CLOCK_MONOTONIC)sleep length must be non-negativecan't specify a timeout for a non-blocking calltimeout value must be positivegc: collecting generation %d... gc: objects in each generation:gc: done, %zd unreachable, %zd uncollectablegc couldn't create gc.garbage listunexpected exception during garbage collectionInternal lock count overflowedstr() or repr() returned '%.100s' type : %s refcount: %ld address : %p %s:%d: %s: Assertion "%s" failed. Error in atexit._run_exitfuncs: pow() 3rd argument not allowed unless all arguments are integers0.0 cannot be raised to a negative power%s: cannot use dir_fd and follow_symlinks together%s%s%s unavailable on this platform%s: src and dst must be the same typesymlink: src and dst must be the same typelink: src and dst must be the same typewcstombs() encountered an unencodable wide characterdomain must be a non-empty stringstring, bytes, os.PathLike, integer or Nonestring, bytes, os.PathLike or integerstring, bytes, os.PathLike or None%s%s%s should be %s, not %.200s%s%sembedded null character in %sexecv() arg 2 must be a tuple or listexecv() arg 2 must not be emptyexecv() arg 2 first element cannot be emptycan't decompress data; zlib not availablewrite could not complete without blockingCouldn't get thread-state dictionaryInitialization arguments are not supportedNot enough memory to allocate new values arrayPyMemoryView_FromBuffer(): info->buf must not be NULLraw write() returned invalid length %zd (should have been between 0 and %zd)raw readinto() returned invalid length %zd (should have been between 0 and %zd)'%.400s' decoder returned '%.400s' instead of 'str'; use codecs.decode() to decode to arbitrary typesdecoding to str: need a bytes-like object, %.80s foundpath should be string, bytes, or os.PathLike, not %.200sunable to determine login nameRAND_bytes() size is limited to 2GB./dev/urandom (or equivalent) not foundFailed to read %zi bytes from /dev/urandomPYTHONHASHSEED must be "random" or an integer in range [0; 4294967295]failed to get random numbers to initialize Pythonbad central directory size or offsetbootstrap issue: python%i%i.zip contains non-ASCII filenames without the unicode flag# zipimport: found %u names in %R '%.100s' object has no attribute '%U''%.50s' object attribute '%U' is read-onlycan't set attributes of built-in/extension type '%s'Out of memory interning an attribute nameexecve: argv must be a tuple or listexecve: argv must not be emptyexecve: environment must be a mapping objectexecve: argv first element cannot be emptyenv.keys() or env.values() is not a list%.200s.__setstate__ argument should be 3-tuple, got %.200ssecond item of state must be an integer, not %.200sposition value cannot be negativethird item of state should be a dict, got a %.200simport %U # previously loaded (%R) no positional arguments expectedCan't initialize import variables/builddir/build/BUILD/Python-3.6.8/Python/import.cCan't instantiate abstract class %s with abstract methods %U__new__() called with non-type 'self'%s.__new__(): not enough arguments%s.__new__(X): X is not a type object (%s)%s.__new__(%s): %s is not a subtype of %s%s.__new__(%s) is not safe, use %s.__new__()%U() missing %i required %s argument%s: %Ureadline() should have returned a str object, not '%.200s'newline must be str or None, not %.200sinitial_value must be str or None, not %.200sstring argument expected, got '%s'reentrant call inside %s.__repr__<_io.FileIO fd=%d mode='%s' closefd=%s><_io.FileIO name=%R mode='%s' closefd=%s>keywords dict changed size during iterationmust assign iterable to extended sliceattempt to assign sequence of size %zd to extended slice of size %zdsequence item %zd: expected a bytes-like object, %.80s foundsequence changed size during iterationread length must be positive or -1readline() should have returned a bytes object, not '%.200s'%.200s() must return a deque, not %.200snot enough values to unpack (expected %d, got %d)not enough values to unpack (expected at least %d, got %d)too many values to unpack (expected %d)not enough values to unpack (expected at least %d, got %zd)Cannot extend an incomplete type '%.100s'mro() returned a non-class ('%.500s')mro() returned base with unsuitable layout ('%.500s')can only assign tuple to %s.__bases__, not %scan only assign non-empty tuple to %s.__bases__, not ()%s.__bases__ must be tuple of classes, not '%s'a __bases__ item causes an inheritance cycledir(): expected keys() of locals to be a list, not '%.200s'object does not provide __dir__cannot convert dictionary update sequence element #%zd to a sequencedictionary update sequence element #%zd has length %zd; 2 is requiredwrapper %s doesn't take keyword argumentsuninitialized classmethod objectType spec does not define the name field.builtin type %.200s has no __module__ attributenonempty __slots__ not supported for subtype of '%s'__slots__ items must be strings, not '%.200s'__dict__ slot disallowed: we already got one__weakref__ slot disallowed: either we already got one, or __itemsize__ != 0%R in __slots__ conflicts with class variabletype __qualname__ must be a str, not %s__classcell__ must be a nonlocal cell, not %.200RError calling __set_name__ on '%.100s' instance %R in '%.100s'__init__() should return None, not '%.200s'coroutine ignored GeneratorExitgenerator ignored GeneratorExitasync generator ignored GeneratorExitthrow() third argument must be a traceback objectinstance exception may not have a separate valueexceptions must be classes or instances deriving from BaseException, not %scoroutine '%.50S' was never awaitedcannot clear an executing framesep must be None or a string, not %.200send must be None or a string, not %.200scode: argcount must not be negativecode: kwonlyargcount must not be negativecode: nlocals must not be negativeasynchronous comprehension outside of an asynchronous functionunary op %d should not be possible'yield from' inside async function'await' outside async functionUnrecognized conversion characterparam invalid in attribute expressionparam invalid in subscript expressionstarred assignment target must be in a list or tuplecan't use starred expression hereextended slice invalid in nested slicetoo many statically nested blockstoo many expressions in star-unpacking assignmenttwo starred expressions in assignmentcan only concatenate deque (not "%.200s") to dequeexpected some sort of operator, but got %Rexpected some sort of expr_context, but got %RExtSlice field "dims" must be a list, not a %.200sExtSlice field "dims" changed size during iterationrequired field "dims" missing from ExtSlicerequired field "value" missing from Indexexpected some sort of slice, but got %Rrequired field "lineno" missing from exprrequired field "col_offset" missing from exprexpected some sort of boolop, but got %Rrequired field "op" missing from BoolOpBoolOp field "values" must be a list, not a %.200sBoolOp field "values" changed size during iterationrequired field "values" missing from BoolOprequired field "left" missing from BinOprequired field "op" missing from BinOprequired field "right" missing from BinOpexpected some sort of unaryop, but got %Rrequired field "op" missing from UnaryOprequired field "operand" missing from UnaryOprequired field "args" missing from Lambdarequired field "body" missing from Lambdarequired field "test" missing from IfExprequired field "body" missing from IfExprequired field "orelse" missing from IfExpDict field "keys" must be a list, not a %.200sDict field "keys" changed size during iterationrequired field "keys" missing from DictDict field "values" must be a list, not a %.200sDict field "values" changed size during iterationrequired field "values" missing from DictSet field "elts" must be a list, not a %.200sSet field "elts" changed size during iterationrequired field "elts" missing from Setrequired field "elt" missing from ListCompListComp field "generators" must be a list, not a %.200sListComp field "generators" changed size during iterationrequired field "generators" missing from ListComprequired field "elt" missing from SetCompSetComp field "generators" must be a list, not a %.200sSetComp field "generators" changed size during iterationrequired field "generators" missing from SetComprequired field "key" missing from DictComprequired field "value" missing from DictCompDictComp field "generators" must be a list, not a %.200sDictComp field "generators" changed size during iterationrequired field "generators" missing from DictComprequired field "elt" missing from GeneratorExpGeneratorExp field "generators" must be a list, not a %.200sGeneratorExp field "generators" changed size during iterationrequired field "generators" missing from GeneratorExprequired field "value" missing from Awaitrequired field "value" missing from YieldFromrequired field "left" missing from CompareCompare field "ops" must be a list, not a %.200sexpected some sort of cmpop, but got %RCompare field "ops" changed size during iterationrequired field "ops" missing from CompareCompare field "comparators" must be a list, not a %.200sCompare field "comparators" changed size during iterationrequired field "comparators" missing from Comparerequired field "func" missing from CallCall field "args" must be a list, not a %.200sCall field "args" changed size during iterationrequired field "args" missing from CallCall field "keywords" must be a list, not a %.200sCall field "keywords" changed size during iterationrequired field "keywords" missing from Callrequired field "n" missing from NumAST string must be of type strrequired field "s" missing from Strrequired field "value" missing from FormattedValueJoinedStr field "values" must be a list, not a %.200sJoinedStr field "values" changed size during iterationrequired field "values" missing from JoinedStrAST bytes must be of type bytesrequired field "s" missing from BytesAST singleton must be True, False, or Nonerequired field "value" missing from NameConstantrequired field "value" missing from Constantrequired field "value" missing from Attributerequired field "attr" missing from Attributerequired field "ctx" missing from Attributerequired field "value" missing from Subscriptrequired field "slice" missing from Subscriptrequired field "ctx" missing from Subscriptrequired field "value" missing from Starredrequired field "ctx" missing from Starredrequired field "id" missing from Namerequired field "ctx" missing from NameList field "elts" must be a list, not a %.200sList field "elts" changed size during iterationrequired field "elts" missing from Listrequired field "ctx" missing from ListTuple field "elts" must be a list, not a %.200sTuple field "elts" changed size during iterationrequired field "elts" missing from Tuplerequired field "ctx" missing from Tupleexpected some sort of expr, but got %Rrequired field "value" missing from keywordrequired field "arg" missing from argrequired field "lineno" missing from argrequired field "col_offset" missing from argarguments field "args" must be a list, not a %.200sarguments field "args" changed size during iterationrequired field "args" missing from argumentsarguments field "kwonlyargs" must be a list, not a %.200sarguments field "kwonlyargs" changed size during iterationrequired field "kwonlyargs" missing from argumentsarguments field "kw_defaults" must be a list, not a %.200sarguments field "kw_defaults" changed size during iterationrequired field "kw_defaults" missing from argumentsarguments field "defaults" must be a list, not a %.200sarguments field "defaults" changed size during iterationrequired field "defaults" missing from argumentsrequired field "target" missing from comprehensionrequired field "iter" missing from comprehensioncomprehension field "ifs" must be a list, not a %.200scomprehension field "ifs" changed size during iterationrequired field "ifs" missing from comprehensionrequired field "is_async" missing from comprehensionrequired field "context_expr" missing from withitemrequired field "lineno" missing from stmtrequired field "col_offset" missing from stmtrequired field "name" missing from FunctionDefrequired field "args" missing from FunctionDefFunctionDef field "body" must be a list, not a %.200sFunctionDef field "body" changed size during iterationrequired field "body" missing from FunctionDefFunctionDef field "decorator_list" must be a list, not a %.200sFunctionDef field "decorator_list" changed size during iterationrequired field "decorator_list" missing from FunctionDefrequired field "name" missing from AsyncFunctionDefrequired field "args" missing from AsyncFunctionDefAsyncFunctionDef field "body" must be a list, not a %.200sAsyncFunctionDef field "body" changed size during iterationrequired field "body" missing from AsyncFunctionDefAsyncFunctionDef field "decorator_list" must be a list, not a %.200sAsyncFunctionDef field "decorator_list" changed size during iterationrequired field "decorator_list" missing from AsyncFunctionDefrequired field "name" missing from ClassDefClassDef field "bases" must be a list, not a %.200sClassDef field "bases" changed size during iterationrequired field "bases" missing from ClassDefClassDef field "keywords" must be a list, not a %.200sClassDef field "keywords" changed size during iterationrequired field "keywords" missing from ClassDefClassDef field "body" must be a list, not a %.200sClassDef field "body" changed size during iterationrequired field "body" missing from ClassDefClassDef field "decorator_list" must be a list, not a %.200sClassDef field "decorator_list" changed size during iterationrequired field "decorator_list" missing from ClassDefDelete field "targets" must be a list, not a %.200sDelete field "targets" changed size during iterationrequired field "targets" missing from DeleteAssign field "targets" must be a list, not a %.200sAssign field "targets" changed size during iterationrequired field "targets" missing from Assignrequired field "value" missing from Assignrequired field "target" missing from AugAssignrequired field "op" missing from AugAssignrequired field "value" missing from AugAssignrequired field "target" missing from AnnAssignrequired field "annotation" missing from AnnAssignrequired field "simple" missing from AnnAssignrequired field "target" missing from Forrequired field "iter" missing from ForFor field "body" must be a list, not a %.200sFor field "body" changed size during iterationrequired field "body" missing from ForFor field "orelse" must be a list, not a %.200sFor field "orelse" changed size during iterationrequired field "orelse" missing from Forrequired field "target" missing from AsyncForrequired field "iter" missing from AsyncForAsyncFor field "body" must be a list, not a %.200sAsyncFor field "body" changed size during iterationrequired field "body" missing from AsyncForAsyncFor field "orelse" must be a list, not a %.200sAsyncFor field "orelse" changed size during iterationrequired field "orelse" missing from AsyncForrequired field "test" missing from WhileWhile field "body" must be a list, not a %.200sWhile field "body" changed size during iterationrequired field "body" missing from WhileWhile field "orelse" must be a list, not a %.200sWhile field "orelse" changed size during iterationrequired field "orelse" missing from Whilerequired field "test" missing from IfIf field "body" must be a list, not a %.200sIf field "body" changed size during iterationrequired field "body" missing from IfIf field "orelse" must be a list, not a %.200sIf field "orelse" changed size during iterationrequired field "orelse" missing from IfWith field "items" must be a list, not a %.200sWith field "items" changed size during iterationrequired field "items" missing from WithWith field "body" must be a list, not a %.200sWith field "body" changed size during iterationrequired field "body" missing from WithAsyncWith field "items" must be a list, not a %.200sAsyncWith field "items" changed size during iterationrequired field "items" missing from AsyncWithAsyncWith field "body" must be a list, not a %.200sAsyncWith field "body" changed size during iterationrequired field "body" missing from AsyncWithTry field "body" must be a list, not a %.200sTry field "body" changed size during iterationrequired field "body" missing from TryTry field "handlers" must be a list, not a %.200srequired field "lineno" missing from excepthandlerrequired field "col_offset" missing from excepthandlerExceptHandler field "body" must be a list, not a %.200sExceptHandler field "body" changed size during iterationrequired field "body" missing from ExceptHandlerexpected some sort of excepthandler, but got %RTry field "handlers" changed size during iterationrequired field "handlers" missing from TryTry field "orelse" must be a list, not a %.200sTry field "orelse" changed size during iterationrequired field "orelse" missing from TryTry field "finalbody" must be a list, not a %.200sTry field "finalbody" changed size during iterationrequired field "finalbody" missing from Tryrequired field "test" missing from AssertImport field "names" must be a list, not a %.200sImport field "names" changed size during iterationrequired field "names" missing from ImportImportFrom field "names" must be a list, not a %.200sImportFrom field "names" changed size during iterationrequired field "names" missing from ImportFromGlobal field "names" must be a list, not a %.200sGlobal field "names" changed size during iterationrequired field "names" missing from GlobalNonlocal field "names" must be a list, not a %.200sNonlocal field "names" changed size during iterationrequired field "names" missing from Nonlocalrequired field "value" missing from Exprexpected some sort of stmt, but got %RFailed to initialize __main__.__annotations__Failed to retrieve builtins moduleFailed to initialize __main__.__builtins__Failed to retrieve BuiltinImporterFailed to initialize __main__.__loader__PyImport_ExecCodeModuleWithPathnames: no interpreter!PyCapsule_Import could not import module "%s"PyCapsule_Import "%s" is not validunknown Unicode character name\N escapes not supported (can't load unicodedata module)'%.100s' object has no attributes (%s .%U)'%.100s' object has only read-only attributes (%s .%U)duplicate argument '%U' in function definitionmaximum recursion depth exceeded during compilationimport * only allowed at module levelBUG: internal directive bookkeeping brokenname '%U' is parameter and globalname '%U' is nonlocal and globalname '%U' is parameter and nonlocalnonlocal declaration not allowed at module levelno binding for nonlocal '%U' foundannotated name '%U' can't be globalannotated name '%U' can't be nonlocalname '%U' is used prior to global declarationname '%U' is assigned to before global declarationname '%U' is used prior to nonlocal declarationname '%U' is assigned to before nonlocal declarationthis compiler does not handle Suitesfrom __future__ imports must occur at the beginning of the filefuture feature %.100s is not definedModule field "body" must be a list, not a %.200sModule field "body" changed size during iterationrequired field "body" missing from ModuleInteractive field "body" must be a list, not a %.200sInteractive field "body" changed size during iterationrequired field "body" missing from Interactiverequired field "body" missing from ExpressionSuite field "body" must be a list, not a %.200sSuite field "body" changed size during iterationrequired field "body" missing from Suiteexpected some sort of mod, but got %Rmodule functions cannot set METH_CLASS or METH_STATICmodule %s: m_size may not be negative for multi-phase initializationmodule %s has multiple create slotsmodule %s uses unknown slot ID %icreation of module %s failed without setting an exceptioncreation of module %s raised unreported exceptionmodule %s is not a module object, but requests module statemodule %s specifies execution slots, but did not create a ModuleType instancedynamic module does not define module export function (%s_%s)initialization of %s failed without raising an exceptioninitialization of %s raised unreported exceptioninit function of %s returned uninitialized objectinitialization of * did not return PyModuleDefinitialization of %s did not return an extension modulePython import machinery not initializedmodule %s: PyModule_Create is incompatible with m_slots%.400s constructor takes %s%zd positional argument%sMust have exactly one of create/read/write/append mode and at most one plusCannot use closefd=False with file nameunicodedata.normalize() must return a string, not %.200sconstructor requires a sequence%.500s() takes a dict as second arg, if any%.500s() takes an at least %zd-sequence (%zd-sequence given)%.500s() takes an at most %zd-sequence (%zd-sequence given)%.500s() takes a %zd-sequence (%zd-sequence given)getpwnam(): name not found: %RPython error: <stdin> is a directory, cannot continue partial character in shift sequencenon-zero padding bits in shift sequenceO!n;translating error handler must return (str, int) tuple__getnewargs_ex__ should return a tuple, not '%.200s'__getnewargs_ex__ should return a tuple of length 2, not %zdsecond item of the tuple returned by __getnewargs_ex__ must be a dict, not '%.200s'__getnewargs__ should return a tuple, not '%.200s'%.200s.__slotnames__ should be a list or None, not %.200scopyreg._slotnames didn't return a list or None__slotsname__ changed size during iterationfirst item of the tuple returned by __getnewargs_ex__ must be a tuple, not '%.200s'PyUnicode_AsDecodedObject() is deprecated; use PyCodec_Decode() to decode from strPyUnicode_AsDecodedUnicode() is deprecated; use PyCodec_Decode() to decode from str to strPyUnicode_AsEncodedObject() is deprecated; use PyUnicode_AsEncodedString() to encode from str to bytes or PyCodec_Encode() for generic encodingPyUnicode_AsEncodedUnicode() is deprecated; use PyCodec_Encode() to encode from str to str'%.400s' encoder returned '%.400s' instead of 'str'; use codecs.encode() to encode to arbitrary typesillegal code point (> 0x10FFFF)range_iterator(): creating instances of range_iterator by calling range_iterator type is deprecatedlll;range_iterator() requires 3 int argumentsrange_iterator() arg 3 must not be zeroComparison between bytes and stringComparison between bytes and intComparison between bytearray and stringcategory must be a Warning subclass, not '%s''return' with value in async generatorinplace binary op %d should not be possibleinvalid node type (%d) for augmented assignmentinvalid node type (%d) for annotated assignmentassertion is always true, perhaps remove parentheses?default 'except:' must be lastmodule kind %d should not be possible'async' and 'await' will become reserved keywords in Python 3.7unexpected expression in assignment %d (line %d)gc: %zd uncollectable objects at shutdowngc: %zd uncollectable objects at shutdown; use gc.set_debug(gc.DEBUG_UNCOLLECTABLE) to list themPy_EndInterpreter: thread is not currentPy_EndInterpreter: thread still has a framePy_EndInterpreter: not the last threadstate argument must be a tuplecould not determine default encodingunderlying stream is not seekabletelling position disabled by next() callcan't reconstruct logical file positioncan't do nonzero cur-relative seekscan't do nonzero end-relative seeksinvalid whence (%d, should be 0, 1 or 2)underlying read() should have returned a bytes object, not '%.200s'can't restore logical file positionencoder should return a bytes object, not '%.200s'read() returned too much data: %zd bytes requested, %zd returnedpeek() should have returned a bytes object, not '%.200s'read() should have returned a bytes object, not '%.200s'mode U cannot be combined with x', 'w', 'a', or '+'can't have text and binary mode at oncemust have exactly one of create/read/write/append modebinary mode doesn't take an encoding argumentbinary mode doesn't take an errors argumentbinary mode doesn't take a newline argumentcan't have unbuffered text I/OEOF read where object expectedbad marshal data (long size out of range)bad marshal data (unnormalized long data)bad marshal data (digit out of range in long)bad marshal data (bytes object size out of range)bad marshal data (string size out of range)bad marshal data (tuple size out of range)NULL object in marshal data for tuplebad marshal data (list size out of range)NULL object in marshal data for listbad marshal data (set size out of range)bad marshal data (index list too large)NULL object in marshal data for setbad marshal data (invalid reference)bad marshal data (unknown type code)XXX readobject called with exception set NULL object in marshal data for objectExcluded frozen object named %Rfrozen object %R is not a code objectf.read() returned not bytes but %.100sno locals found when storing annotationNo active exception to reraisecalling %R should have returned an instance of BaseException, not %Rexceptions must derive from BaseExceptionexception causes must derive from BaseException'async for' requires an object with __aiter__ method, got %.100s'async for' received an invalid object from __aiter__: %.100s'%.100s' implements legacy __aiter__ protocol; __aiter__ should return an asynchronous iterator, not awaitable'async for' requires an iterator with __anext__ method, got %.100s'async for' received an invalid object from __anext__: %.100s'async with' received an object from __aenter__ that does not implement __await__: %.100s'async with' received an object from __aexit__ that does not implement __await__: %.100scoroutine is being awaited alreadypopped block is not an except handlerno locals found when storing %Rno locals found when setting up annotationsbad BUILD_CONST_KEY_MAP keys argument'%.200s' object is not a mapping%.200s%.200s keywords must be strings%.200s%.200s got multiple values for keyword argument '%U'catching classes that do not inherit from BaseException is not allowedno locals found during 'import *'from-import-* object has no __dict__ and no __all__cannot 'yield from' a coroutine object in a non-coroutine generatorerror return without exception setillegal expression for augmented assignmentonly single target (not list) can be annotatedonly single target (not tuple) can be annotatedassignment to yield expression not possibletrailing comma not allowed without surrounding parenthesesUnexpected node-type in from-importunknown import statement: starts with command '%s'improper number of parts to 'assert' statement: %dunhandled small_stmt: TYPE=%d NCH=%d unexpected token in 'if' statement: %swrong number of tokens for 'while' statement: %dwrong number of children for 'except' clause: %dinvalid node %d for PyAST_FromNodesymtable() arg 3 must be 'exec' or 'eval' or 'single'compiled module %R is not a code objectzipimport: no memory to allocate source bufferimport %U # loaded from Zip %U compile(): invalid optimize valuecompile() mode must be 'exec', 'eval' or 'single'globals and locals cannot be NULLexec() globals must be a dict, not %.100slocals must be a mapping or None, not %.100scode object passed to exec() may not contain free variablesglobals must be a real dict; try eval(expr, {}, mapping)eval must be given globals and locals when called without a framecode object passed to eval() may not contain free variablesf-string: single '}' is not allowedf-string: expressions nested too deeplyf-string expression part cannot include a backslashf-string expression part cannot include '#'f-string: mismatched '(', '{', or '['f-string: invalid conversion character: expected 's', 'r', or 'a'f-string: unexpected end of stringf-string: empty expression not allowedinvalid comp_op: has %d children/builddir/build/BUILD/Python-3.6.8/Python/ast.cbytes can only contain ASCII literal characters.cannot mix bytes and nonbytes literals%S - Consider hexadecimal for huge integer literals to avoid decimal conversion limits.dict unpacking cannot be used in dict comprehensionnamed arguments must follow bare *logic error in count_comp_forsiterable unpacking cannot be used in comprehensionGenerator expression must be parenthesized if not sole argumentpositional argument follows keyword argument unpackingpositional argument follows keyword argumentiterable argument unpacking follows keyword argument unpackinglambda cannot contain assignmentkeyword can't be an expressionnon-default argument follows default argumentunexpected node in varargslist: %d @ %d%.200s.__setstate__ argument should be 4-tuple, got %.200sthird item of state must be an integer, got %.200sfourth item of state should be a dict, got a %.200sregister() takes at least 1 argument (0 given)methodcaller needs at least one argument, the method nametype 'partial' takes at least one argument__build_class__: args is not a tuple__build_class__: not enough arguments__build_class__: func must be a function__build_class__: name is not a string%.200s.__prepare__() must return a mapping, not %.200s__class__ not set defining %.200R as %.200R. Was __classcell__ propagated to type.__new__?__class__ set to %.200R defining %.200R as %.200Rtype.__init__() takes no keyword argumentstype.__init__() takes 1 or 3 argumentsthe tracemalloc module has been unloadedthe number of frames must be in range [1; %i]PYTHONTRACEMALLOC: invalid number of frames-X tracemalloc=NFRAME: invalid number of framesEnable tracemalloc to get the memory block allocation traceback
Memory block allocated at (most recent call first): bad ID: Allocated using API '%c', verified using API '%c'Debug memory block at address p=%p: %zu bytes originally requested The %d pad bytes at p-%d are Because memory is corrupted at the start, the count of bytes requested may be bogus, and checking the trailing pad bytes may segfault. The %d pad bytes at tail=%p are The block was made by call #%zu to debug malloc/realloc. not all FORBIDDENBYTE (0x%02x): deallocated BytesIO object has exported buffersCould not import runpy module Could not access runpy._run_module_as_main Could not convert module name to unicode Could not create arguments for runpy._run_module_as_main Failed calling sys.__interactivehook__ Failed to import the site module initializing sys.meta_path, sys.path_hooks, or path_importer_cache failed# can't import zipimport.zipimporter Py_Initialize: can't import _frozen_importlibimport _frozen_importlib # frozen Py_Initialize: couldn't get _frozen_importlib from sys.modulesPy_Initialize: __import__ not foundPy_Initialize: can't import _impPy_Initialize: can't save _imp to sys.modulesPy_Initialize: importlib install failedPython runtime initialized with LC_CTYPE=C (a locale with default ASCII encoding), which may cause Unicode compatibility problems. Using C.UTF-8, C.utf8, or UTF-8 (if available) as alternative Unicode-compatible locales is recommended. Py_Initialize: can't make first interpreterPy_Initialize: can't make first threadPy_Initialize: can't init longsPy_Initialize: can't init floatPy_Initialize: can't make modules dictionaryPy_Initialize: can't initialize unicodePy_Initialize: can't initialize structseqPy_Initialize: can't initialize builtins modulesPy_Initialize: can't initialize builtins dictPy_Initialize: can't initialize sysPy_Initialize: can't initialize sys dictPy_Initialize: can't set preliminary stderrPy_Initialize: can't initialize timePy_Initialize: can't initialize faulthandlerPy_Initialize: unable to load the file system codecPy_Initialize: can't import signalPy_Initialize: can't initialize tracemallocPy_Initialize: can't initialize sys standard streams'import warnings' failed; traceback: deallocated bytearray object has exported bufferspython: Can't reopen .pyc file python: failed to set __main__.__loader__ Unhandled exception in thread started by Py_NewInterpreter: call Py_Initialize firstError in PYTHONMALLOC: unknown allocator "%s"! not enough memory to copy -c argumentfailure in handling of -W argumentTry `python -h' for more information. not enough memory to copy PYTHONWARNINGSType "help", "copyright", "credits" or "license" for more information.Failed checking if argv[0] is an import path entry Unable to decode the command from the command line: %ls: '%ls' is a directory, cannot continue %ls: can't open file '%s': [Errno %d] %s Unable to decode the command line argument #%i object too deeply nested to marshalan int variable for demonstration purposesReturn symbol and scope dictionaries used internally by compiler.enable(file=sys.stderr, all_threads=True): enable the fault handlerdisable(): disable the fault handleris_enabled()->bool: check if the handler is enableddump_traceback(file=sys.stderr, all_threads=True): dump the traceback of the current thread, or of all threads if all_threads is True, into filedump_traceback_later(timeout, repeat=False, file=sys.stderrn, exit=False): dump the traceback of all threads in timeout seconds, or each timeout seconds if repeat is True. If exit is True, call _exit(1) which is not safe.cancel_dump_traceback_later(): cancel the previous call to dump_traceback_later().register(signum, file=sys.stderr, all_threads=True, chain=False): register a handler for the signal 'signum': dump the traceback of the current thread, or of all threads if all_threads is True, into fileunregister(signum): unregister the handler of the signal 'signum' registered by register()_read_null(): read from NULL, raise a SIGSEGV or SIGBUS signal depending on the platform_sigsegv(release_gil=False): raise a SIGSEGV signalfatal_error_c_thread(): call Py_FatalError() in a new C thread._sigabrt(): raise a SIGABRT signal_sigfpe(): raise a SIGFPE signal_fatal_error(message): call Py_FatalError(message)_stack_overflow(): recursive call to raise a stack overflowOi|O:IncrementalNewlineDecoderTrue if the file descriptor will be closed by close().day of week, range [0, 6], Monday is 01 if summer time is in effect, 0 if not, and -1 if unknownThe time value as returned by gmtime(), localtime(), and strptime(), and accepted by asctime(), mktime() and strftime(). May be considered as a sequence of 9 integers.
Note that several fields' values are not the same as those defined by the C language standard for struct tm. For example, the value of the field tm_year is the actual year, not year - 1900. See individual fields' descriptions for details.errno associated with this signalreal user ID of sending processitertools.combinations_with_replacementmaximum size of a deque or None if unboundedFactory for default value called by __missing__()._collections._deque_reverse_iteratortruth(a) -- Return True if a is true, False otherwise.contains(a, b) -- Same as b in a (note reversed operands).indexOf(a, b) -- Return the first index of b in a.countOf(a, b) -- Return the number of times b occurs in a.is_not(a, b) -- Same as a is not b.index(a) -- Same as a.__index__()matmul(a, b) -- Same as a @ b.floordiv(a, b) -- Same as a // b.truediv(a, b) -- Same as a / b.lshift(a, b) -- Same as a << b.rshift(a, b) -- Same as a >> b.a = iadd(a, b) -- Same as a += b.a = isub(a, b) -- Same as a -= b.a = imul(a, b) -- Same as a *= b.a = imatmul(a, b) -- Same as a @= b.a = ifloordiv(a, b) -- Same as a //= b.a = itruediv(a, b) -- Same as a /= ba = imod(a, b) -- Same as a %= b.a = ilshift(a, b) -- Same as a <<= b.a = irshift(a, b) -- Same as a >>= b.a = iand(a, b) -- Same as a &= b.a = ixor(a, b) -- Same as a ^= b.a = ior(a, b) -- Same as a |= b.concat(a, b) -- Same as a + b, for a and b sequences.a = iconcat(a, b) -- Same as a += b, for a and b sequences.getitem(a, b) -- Same as a[b].setitem(a, b, c) -- Same as a[b] = c.delitem(a, b) -- Same as del a[b].a = ipow(a, b) -- Same as a **= b.function object to use in future partial callstuple of arguments to future partial callsdictionary of keyword arguments to future partial callsValue wrapped by a key function.Weak-reference support module.A dictionary mapping group names to group numbers.integer time of last modificationtime of last access in nanosecondstime of last modification in nanosecondstime of last change in nanosecondsname of machine on network (implementation-defined)elapsed time since an arbitrary point in the pastwidth of the terminal window in charactersheight of the terminal window in charactersthe entry's base filename, relative to scandir() "path" argumentthe entry's full path name; equivalent to os.path.join(scandir_path, entry.name)return True if the entry is a directory; cached per entryreturn True if the entry is a file; cached per entryreturn True if the entry is a symbolic link; cached per entryreturn stat_result object for the entry; cached per entryreturn inode of the entry; cached per entryreturns the path for the entryCS_XBS5_ILP32_OFFBIG_LINTFLAGSCS_XBS5_LPBIG_OFFBIG_LINTFLAGSSC_THREAD_DESTRUCTOR_ITERATIONSname of the thread implementationname of the lock implementationname and version of the thread library.cpython-36m-x86_64-linux-gnu.soHook to intercept first iterationHook to intercept finalizationwidth of the type used for hashing, in bitsprime number giving the modulus on which the hash function is basedvalue to be used for hash of a positive infinityvalue to be used for hash of a nanmultiplier used for the imaginary part of a complex numbername of the algorithm for hashing of str, bytes and memoryviewsinternal output size of hash algorithmsmall string optimization cutoff'alpha', 'beta', 'candidate', or 'final'Implements the 'strict' error handling, which raises a UnicodeError on coding errors.Implements the 'ignore' error handling, which ignores malformed data and continues.Implements the 'replace' error handling, which replaces malformed data with a replacement marker.Implements the 'xmlcharrefreplace' error handling, which replaces an unencodable character with the appropriate XML character reference.Implements the 'backslashreplace' error handling, which replaces malformed data with a backslashed escape sequence.Implements the 'namereplace' error handling, which replaces an unencodable character with a \N{...} escape sequence.Return the size (in bytes) of this objectsplit the argument as a field nameparse the argument as a format stringmro() -> list return a type's method resolution order__subclasses__() -> list of immediate subclasses__prepare__() -> dict used to create the namespace for the class statement__instancecheck__() -> bool check if an object is an instance__subclasscheck__() -> bool check if a class is a subclass__dir__() -> list specialized __dir__ implementation for types__sizeof__() -> int return memory consumption of the type object__sizeof__() -> int size of object in memory, in bytes__dir__() -> list default dir() implementationthe instance invoking super(); may be Nonethe type of the instance invoking super(); may be Nonedictionary for instance variables (if defined)list of weak references to the object (if defined)__new__($type, *args, **kwargs) --
Create and return a new object. See help(type) for accurate signature.__repr__($self, /) --
The most base type__dir__() -> list specialized dir() implementationthe real part of a complex numberthe imaginary part of a complex numberthe numerator of a rational number in lowest termsthe denominator of a rational number in lowest termsReturns self, the complex conjugate of any int.Truncating an Integral returns itself.Flooring an Integral returns itself.Ceiling of an Integral returns itself.Rounding an Integral returns itself. Rounding with an ndigits argument also returns an integer.Returns size in memory, in bytessize in bytes of the C type used to represent a digitmaximum string conversion digits limitationminimum positive value for int_max_str_digitsDBL_MAX -- maximum representable finite floatDBL_MAX_EXP -- maximum int e such that radix**(e-1) is representableDBL_MAX_10_EXP -- maximum int e such that 10**e is representableDBL_MIN -- Minimum positive normalized floatDBL_MIN_EXP -- minimum int e such that radix**(e-1) is a normalized floatDBL_MIN_10_EXP -- minimum int e such that 10**e is a normalizedDBL_MANT_DIG -- mantissa digitsDBL_EPSILON -- Difference between 1 and the next representable floatFLT_RADIX -- radix of exponentReturn self, the complex conjugate of any float.Return the Integral closest to x between 0 and x.Return the Integral closest to x, rounding half toward even. When an argument is passed, work like built-in round(x, ndigits).Return True if the float is an integer.qualified name of the generatorobject being iterated by yield from, or Nonequalified name of the coroutineobject being awaited on, or Nonequalified name of the async generatorA wrapper object for __aiter__ bakwards compatibility.A wrapper object implementing __await__ for coroutines.Operation only works on directories.Operation doesn't work on directories.Base class for warnings about resource usage.Base class for warnings about bytes and buffer related problems, mostly related to conversion from str or comparing to str.Base class for warnings about Unicode related problems, mostly related to conversion problems.Base class for warnings about probable mistakes in module importsBase class for warnings about constructs that will change semantically in the future.Base class for warnings about dubious runtime behavior.Base class for warnings about dubious syntax.Base class for warnings about features which will be deprecated in the future.Base class for warnings about deprecated features.Base class for warnings generated by user code.Base class for warning categories.Weak ref proxy used after referent went away.Internal error in the Python interpreter.
Please report this to the Python maintainer, along with the traceback, the Python version, and the hardware/OS platform and version.Second argument to a division or modulo operation was zero.Result too large to be represented.Floating point operation failed.Base class for arithmetic errors.Inappropriate argument value (of correct type).Improper mixture of spaces and tabs.Local name referenced but not bound to a value.Method or function hasn't been implemented yet.Base class for I/O related errors.Import can't find module, or can't find name in module.Request to exit from the interpreter.Request that a generator exit.Signal the end from iterator.__next__().Signal the end from iterator.__anext__().Common base class for all non-exit exceptions.Common base class for all exceptionsD.get(k[,d]) -> D[k] if k in D, else d. d defaults to None.D.values() -> list of D's valuesD.items() -> list of D's (key, value) pairs, as 2-tuplesD.copy() -> a shallow copy of Dthe function (or other callable) implementing a methodthe instance to which a method is bound----help-c-mr home =os.pyLibrb--versionpyvenv.cfglib64/python00.zipModules/Setuppybuilddir.txtlib64/lib-dynloadbBc:dEhiIJm:OqRsStuvVW:xX:?__main__python3�?�?0C��.A333333�?�C�������?��������A��UUUUUU�?�?������y?�������?UUUUUU�?�?�������?�������?UUUUUU�?�$I�$I�?�?�q�q�?$@�������?Y@@�@��@j�@�חA _�B��mB&@UUUUUU�?@(@*@@,@.@@0@1@!@2@3@@UUUUUU�?�������?4@i@@�@��@jA5@^ A6@7@8@9@:@;@<@=@@�?�?333333�?�?�?333333�?>@�r@p�@L�@�OA?@@@�@@A@�A@B@�B@C@�C@@�������?D@y@@�@��@jA�D@E@�E@^AF@�F@G@�G@H@�H@@�������?@�?I@@@��@j�@��A@N@��@p�@L�@�O"A@�������?@�?�Q@�@X�@�@�\%A @T@�@@�@��@j(A"@@�V@ �@��@��@@w+A�e��AP?���ؗ�Ҝ<3���#�I9=��D��2�����[%Co�d(h�����A�5�����?5�5�?�5�����?aCoc���?��`�(��?�y�PD�?<�s�Ou���ư>�?��&�.>�A�<�>p>0>�@`ApAP� �^�4@�C���������?C��쵠�ƠB�<�M[�M[�4?��4?������������������� �?��������
0A(A BBBA@�Y��D��2�_B�E�E �E(�G0�C8�B@t8D0A(B BBB\�I�/B�B�E �B(�A0�A8�D�W�G�G�B�V��8A0A(B BBBT@���B�E�E �B(�D0�G8�DPhXJ`JhDpIPU8D0A(B BBB����DE I����DB IЧt�DB L\�k��B�B�B �B(�A0�A8�D���J�G�G�X��8A0A(B BBBTL���B�E�E �E(�G0�C8�DPSXJ`MhDpNP`8D0A(B BBBL�����'B�B�B �B(�A0�A8�G�� 8A0A(B BBBA���p�D�8B�L�B �B(�A0�A8�G�� 8A0A(B BBBAj�L�U�A�o�V�G�B�,/ ��H����VB�B�B �B(�D0�D8�G@18D0A(B BBB���L�,(��0B�B�B �A(�D0�n (A BBBEO (D BBBEP�4�A(C BBB8`���yE�E�E �D(�D0�Z(A BBB����6D���(���B�B�B �E(�D0�A8�GP�8D0A(B BBB,���H��(���B�E�B �B(�A0�A8�GpM 8D0A(B BBBA�2d�9`l�P*��\B�G�B �E(�A0�D8�GPs 8A0A(B BBBE� 8A0A(B BBBE$�%�D8C0A(B BBBH��$+���B�E�E �B(�D0�C8�D`R 8A0A(B BBBAH���2\X�T-���B�B�E �A(�D0�Y (A BBBEA (A BBBEA(A BBBȠ��#Y(C BBBLج��B�B�B �B(�D0�D8�D�" 8A0A(B BBBA�@3�p<�-���B�E�B �B(�A0�D8�E@�HAPIHA@A 8A0A(B BBBAQHUPGHB@ZHSPFHB@����Hĭ(!�B�B�B �E(�A0�D8�DP� 8D0A(B BBBAD�d�\$��"�B�B�B �E(�A0�D8�D�� 8A0A(B BBBAP�I�M�A�B��e(���)�JP�H�I bA�A�����ACA`�L-��B�B�E �B(�A0�A8�D@�HJPIHA@A 8A0A(B BBBAFHJPJHA@P�\�@X��-���B�D�D �G�@�B�W�A�l AABAH���(�B�B�B �B(�A0�A8�D`� 8D0A(B BBBF���> ���4�mA�[ F AA\ ���%A�G�DpzxH�M�M�F�G�SpxA�qxApVxB�fxAp\AAH���4�B�B�B �B(�A0�D8�Gpo 8A0A(B BBBC$8>��8�<:��B�S�A �A(�GP� (A ABBA���k80��:�hB�B�A �A(�D@ (D ABBK$���m8��D ��B�B�A �A(�A0�(A ABB<��@,���B�E�E �A(�A0�D@�0A(A BBB$��!�K 0A(A BBBE0$��,��B�A�A �D@� AABAp��!�'Hl� <�B�B�B �B(�A0�A8�A@� 8D0A(B BBBAĚ�!�h̲-���B�B�B �B(�A0�A8�D�<�G�J�B�B�B�I�� 8A0A(B BBBA�F�!��(L�=�A�D�G0X AAAd�$�~@��@/���B�E�E �D(�A0�G@� 0A(A BBBA��$�v ��/��sA�KP` AA$S�$�0�0���B�H�A �G`^ AABA V5%�d�h1���A�D �A��%�(���%�DJ�I�C cCAA��DĴ�1���B�E�E �B(�A0�A8�G`�8D0A(B BBB��%�# ��%�7A�D@0A(D��'�A�D�F`�AAp� )�D �(���1���A�A�D0� AAA��Y)�ȵ=*�*A�h�82����D2��9F�oA�̯*� (�*�<�*�eA�Z4X�c*�SB�H�A �D(�A0y(D ABBH��L:�B�B�L �E(�A0�A8�G` 8A0A(B BBBA�2*��2*�aD0\L��<�.B�B�B �B(�A0�A8�J�o 8A0A(B BBBCX/+*��(l��0�:B�D�D �iDB���0�A�DP�AP���1��\�B�B �A(�A0�� �(A� B�B�B�EA(A BBBX�2�[B�B�B �B(�A0�D8�D�q�C�d�A��8A0A(B BBB4h�6��Q�E�D �A(�D0�(A ABB(���6�$B�D�D �RAB(̸�6�RF�D�D A�A�$���6�A�D�D FGA@ ��6�TB�B�B �D(�A0�DP<0A(A BBBd��7�5Ac EKD���7�B�B�B �B(�D0�C8�A@�8A0A(B BBB̹`8�#BP EK�c8�H��G��B�B�B �E(�A0�A8�A@� 8A0A(B BBBAX�8�54`�/8�YB�B�A �C(�D0B(A ABB��P8�A}���8�kJ_Ⱥ9�AP�9�=H�t8���G� B�B�B �A(�D0�~ (H BBBIH8��8�B�B�B �B(�D0�D8�D��8A0A(B BBB4��B<�B�E�D �D(�A0�(D ABB4���<�B�B�D �D(�D0�(D ABB4�=�B�B�D �D(�D0�(D ABB4,��=�D�E�D �D(�B0m(D ABB\d��=�B�I�E �G(�D0�a (A BBBBL (A BBBBq(D BBBļ>�ؼ >�\�>�B�I�E �G(�D0�a (A BBBBL (A BBBBA(D BBBL�Q>�`�P>�4t�N>�fB�B�G �A(�A0O(D ABB���*��ANħd>��,ܽ�*���B�A�A �s ABAt��>�? ��>�4�,��A� L�,���B�A�A �D@���>�^ AABA���,��:A�A�Fp���>��9 AAAо�,����D��A�� I��XA�L@��,���B�E�B �A(�A0�N@� 0A(A BBBAl�LA�p<p��B�A�H�A g AABT AAEAAA���,��"A`ȩ�B�?}ܿ�,���A�F �Ax��B�Q` AB4�d-���B�I�A �A(�D@�(A ABB ��B�r (C ABBE8t��-��B�B�E �A(�A0��(A BBB��6C�H�x.��!B�B�B �B(�A0�A8�A@� 8A0A(B BBBE(�zC�_# 8A0A(B BBBA<�01��P��E� \d�(C�lA�A�G0� AAA� AAAK DAFD DAC DAC��/E�-$��0��XA�D�K EAA�� E�,�8E�T(�+E�:B�B�E �L(�D0�A8�D`NhMpQhA`�8A0A(B BBB�� I� ��I����H�A�](���H�OB�D�G �~AB��I�H�I�xB�B�B �H(�D0�A8�DPV8A0A(B BBBHP�7J�sB�E�D �D(�I0y (M ABBEA(D ABB��^J���PJ���@J� ��6J�(���.���A�A�G@� AAA�U�I��8,��J��I�B�B �A(�A0��(D BBBLh�D/���B�B�B �B(�D0�H8�J�& 8A0A(B BBBA0tU&L���H�N�D�i�P�L�B�H���W��B�E�B �B(�A0�A8�FP�8D0A(B BBB8�$4��'A�a�kZ�A8h�YZ��B�A�A �G� L�@I�A� AAB8���3���B�J�I �A(�D�� (A ABBA�9�Z����4��eD0[ A�[�$$�[�A�K�D@�AADL��[�B�F�B �E(�A0�A8�D@p8D0A(B BBB ���[�fA�I@ZA��@���J�`!�`!�8!Ƣ!.�!�P!�O!�!�� .�!�`!�`!%a!� @�fa! �� ��� p�}� P�p!��� � � � i!�ba!�a!ba!�a!ba!�a!�b!F!c!�b!�M!F!c!�`!�� .�!�`!�b!�M!�c!�c!d! d! d!d! d! �c!�c!�c!d!d!d!d!(d!0d!8d!@d!Hd!Pd!Xd! `d!!hd!"pd!#yd!$�d!%&d!.d!6d!>d!Fd!Nd!Vd!^d!fd!nd!wd!�d!�d!�d!�d!�d!(�d!)�d!*�d!&�d!'�d!�d!+�d!,�d!.�d!0�d!1�d!/�d!�d!e!l�l!�� .�!�l!�� .�!,!�W!'!�)!�m!(n!3n!8n!�!�!3n!�� n!n!�� n!n!�� An!p/!�� n!n!p/!Jn!�� �&!Jn!�� �&!�� n!n!,!�� n!n!,!�� n!n!,!!o!-o!;o!Eo!Ro!\o! go!@ro!�{o!�r!�.!�W!��!��!Z.!��!�!Z.!��!�!v�!�W!Z.!��!�!Z.!��!�!��!Lg!Lg!Lg!Lg!Lg!Lg!Lg!�,!�,!�,!��!��!��!c!tp!_t!��!c!_t!�,!�,!4t!E,!�,!�,!��!�W!c!_t!+g!�O!�O!+g!8t!8t!��!�!P*!Lg!��!8%!]q!_t!Z.!��!_t!��!_t!?t!j.!f!Gt!_t!��!_t!j.!f![t!ft!j.!f![t!ft!qt!wt!�r!qt!wt!��!c!_t!��!_t!��!j.!f![t!ft!Z.!��!��!Eg!�p!�,!Eg!�p!��!Eg!�p!_t!Z.!�,!c!��!c!_t!Z.!��!��!c!_t!{t!Z.!��!_t!Z.!�G!�t!�t!�t!�t!�t!�t!�t!�t!�t!u!u!u!,u!9u!Hu!Tu!`u!ku!xu!�u!�u!�u!�u!�u!�u!�u!�u!h�!l�!5�!� �� � R!�U!�!�!Չ!܉!�!�6!=!�6!=!�!-=!��!�!�!�!1�!&�!�!D[!!([![!�W!��!uHp�������v�uHuHuHIVO���uHuH�^.uH����uH�Y�g�+������uHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuH�H�I�IuHuH$�a�uH�C�l�2�������&V�������uH����P ���z��k��+��`�k��<4D���Y���� �IuHg�����H����7����!��� ����P�P�uHuH�������uH����� �uHuH���I���uH�����*uHuH��8�}�������U�}�H�}0H3I�� ;uHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHuHp/!ݝ!c!�W!��!�!+!�!+�!�1!Y� f!��!�R!�!y(!An!y(!An!�� .�!��!�R!�!y(!An!y(!An!�� .�!x!x!�w!z��[!�q#^!��>^!�J�H^!�Ju���S^!�J�Ufv���ڔpe �� ��J��J���o���5 ����J� �D��О ���o���o8����o�o�����o�#��J�e�e�e�e�e�eff&f6fFfVfffvf�f�f�f�f�f�f�f�fgg&g6gFgVgfgvg�g�g�g�g�g�g�g�ghh&h6hFhVhfhvh�h�h�h�h�h�h�h�hii&i6iFiVifivi�i�i�i�i�i�i�i�ijj&j6jFjVjfjvj�j�j�j�j�j�j�j�jkk&k6kFkVkfkvk�k�k�k�k�k�k�k�kll&l6lFlVlflvl�l�l�l�l�l�l�l�lmm&m6mFmVmfmvm�m�m�m�m�m�m�m�mnn&n6nFnVnfnvn�n�n�n�n�n�n�n�noo&o6oFoVofovo�o�o�o�o�o�o�o�opp&p6pFpVpfpvp�p�p�p�p�p�p�p�pqq&q6qFqVqfqvq�q�q�q�q�q�q�q�qrr&r6rFrVrfrvr�r�r�r�r�r�r�r�rss&s6sFsVsfsvs�s�s�s�s�s�s�s�stt&t6tFtVtftvt�t�t�t�t�t�t�t�tuu&u6uFuVufuvu�u�u�u�u�u�u�u�uvv&v6vFvVvfvvv�v�v�v�v�v�v�v�vww&w6wFwVwfwvw�w�w�w�w�w�w�w�wxx&x6xFxVxfxvx�x�x�x�x�x�x�x�xyy&y6yFyVyfyvy�y�y�y�y�y�y�y�yzz&z6zFzVzfzvz�z�z�z�z�z�z�z�z{{&{6{F{V{f{v{�{�@sdZed�dS)TzHello world!N)�initialized�print�rr�./Tools/freeze/flag.py�<module>sxxsubtype is an example module showing how to subtype builtin types from C. test_descr.py in the standard test suite requires it in order to complete. If you don't care about the examples, and don't intend to run the Python test suite, you can recompile Python without Modules/xxsubtype.c.get_traced_memory() -> (int, int)
Get the current size and peak size of memory blocks traced by the tracemalloc module as a tuple: (current: int, peak: int).get_tracemalloc_memory() -> int
Get the memory usage in bytes of the tracemalloc module used internally to trace memory allocations.get_traceback_limit() -> int
Get the maximum number of frames stored in the traceback of a trace.
By default, a trace of an allocated memory block only stores the most recent frame: the limit is 1.stop()
Stop tracing Python memory allocations and clear traces of memory blocks allocated by Python.start(nframe: int=1)
Start tracing Python memory allocations. Set also the maximum number of frames stored in the traceback of a trace to nframe._get_object_traceback(obj)
Get the traceback where the Python object obj was allocated. Return a tuple of (filename: str, lineno: int) tuples.
Return None if the tracemalloc module is disabled or did not trace the allocation of the object._get_traces() -> list
Get traces of all memory blocks allocated by Python. Return a list of (size: int, traceback: tuple) tuples. traceback is a tuple of (filename: str, lineno: int) tuples.
Return an empty list if the tracemalloc module is disabled.clear_traces()
Clear traces of memory blocks allocated by Python.is_tracing()->bool
True if the tracemalloc module is tracing Python memory allocations, False otherwise.Debug module to trace memory blocks allocated by Python.����faulthandler module.����is_package(fullname) -> bool.
Return True if the module specified by fullname is a package. Raise ZipImportError if the module couldn't be found.get_filename(fullname) -> filename string.
Return the filename for the specified module.get_source(fullname) -> source string.
Return the source code for the specified module. Raise ZipImportError if the module couldn't be found, return None if the archive does contain the module, but has no source for it.get_code(fullname) -> code object.
Return the code object for the specified module. Raise ZipImportError if the module couldn't be found.get_data(pathname) -> string with file data.
Return the data associated with 'pathname'. Raise IOError if the file wasn't found.load_module(fullname) -> module.
Load the module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the imported module, or raises ZipImportError if it wasn't found.find_loader(fullname, path=None) -> self, str or None.
Search for a module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the zipimporter instance itself if the module was found, a string containing the full path name if it's possibly a portion of a namespace package, or None otherwise. The optional 'path' argument is ignored -- it's there for compatibility with the importer protocol.find_module(fullname, path=None) -> self or None.
Search for a module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the zipimporter instance itself if the module was found, or None if it wasn't. The optional 'path' argument is ignored -- it's there for compatibility with the importer protocol.zipimporter(archivepath) -> zipimporter object
Create a new zipimporter instance. 'archivepath' must be a path to a zipfile, or to a specific path inside a zipfile. For example, it can be '/tmp/myimport.zip', or '/tmp/myimport.zip/mydirectory', if mydirectory is a valid directory inside the archive.
'ZipImportError is raised if 'archivepath' doesn't point to a valid Zip archive.
The 'archive' attribute of zipimporter objects contains the name of the zipfile targeted.zipimport provides support for importing Python modules from Zip archives.
This module exports three objects: - zipimporter: a class; its constructor takes a path to a Zip archive. - ZipImportError: exception raised by zipimporter objects. It's a subclass of ImportError, so it can be caught as ImportError, too. - _zip_directory_cache: a dict, mapping archive paths to zip directory info dicts, as used in zipimporter._files.
It is usually not needed to use the zipimport module explicitly; it is used by the builtin import mechanism for sys.path items that are paths to Zip archives./__init__.pyc/__init__.py.pyc.pywritable($self, /) --
Returns True if the IO object can be written.readable($self, /) --
Returns True if the IO object can be read.seekable($self, /) --
Returns True if the IO object can be seeked.write($self, s, /) --
Write string to file.
Returns the number of characters written, which is always equal to the length of the string.seek($self, pos, whence=0, /) --
Change stream position.
Seek to character offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos must be 0; 2 End of stream - pos must be 0. Returns the new absolute position.truncate($self, pos=None, /) --
Truncate size to pos.
The pos argument defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new absolute position.tell($self, /) --
Tell the current file position.readline($self, size=None, /) --
Read until newline or EOF.
Returns an empty string if EOF is hit immediately.read($self, size=None, /) --
Read at most size characters, returned as a string.
If the argument is negative or omitted, read until EOF is reached. Return an empty string at EOF.getvalue($self, /) --
Retrieve the entire contents of the object.close($self, /) --
Close the IO object.
Attempting any further operation after the object is closed will raise a ValueError.
This method has no effect if the file is already closed.StringIO(initial_value='', newline='\n') --
Text I/O implementation using an in-memory buffer.
The initial_value argument sets the value of object. The newline argument is like the one of TextIOWrapper's constructor.Write string to stream. Returns the number of characters written (which is always equal to the length of the string). Read until newline or EOF.
Returns an empty string if EOF is hit immediately. Read at most n characters from stream.
Read from underlying buffer until we have n characters or we hit EOF. If n is negative or omitted, read until EOF. Separate the underlying buffer from the TextIOBase and return it.
After the underlying buffer has been detached, the TextIO is in an unusable state. The error setting of the decoder or encoder.
Subclasses should override. Line endings translated so far.
Only line endings translated during reading are considered.
Subclasses should override. Encoding of the text stream.
Subclasses should override. Base class for text I/O.
This class provides a character and line based interface to stream I/O. There is no readinto method because Python's character strings are immutable. There is no public constructor. reset($self, /) --
Codec used when reading a file in universal newlines mode.
It wraps another incremental decoder, translating \r\n and \r into \n. It also records the types of newlines encountered. When used with translate=False, it ensures that the newline sequence is returned in one piece. When used with decoder=None, it expects unicode strings as decode input and translates newlines without first invoking an external decoder.truncate($self, pos=None, /) --
Character and line based layer over a BufferedIOBase object, buffer.
encoding gives the name of the encoding that the stream will be decoded or encoded with. It defaults to locale.getpreferredencoding(False).
errors determines the strictness of encoding and decoding (see help(codecs.Codec) or the documentation for codecs.register) and defaults to "strict".
newline controls how line endings are handled. It can be None, '', '\n', '\r', and '\r\n'. It works as follows:
* On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated.
* On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '' or '\n', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string.
If line_buffering is True, a call to flush is implied when a call to write contains a newline character.Write the given buffer to the IO stream.
Returns the number of bytes written, which is always the length of b in bytes.
Raises BlockingIOError if the buffer is full and the underlying raw stream cannot accept more data at the moment. readinto1($self, buffer, /) --
readinto($self, buffer, /) --
Read and return up to n bytes, with at most one read() call to the underlying raw stream. A short result does not imply that EOF is imminent.
Returns an empty bytes object on EOF. Read and return up to n bytes.
If the argument is omitted, None, or negative, reads and returns all data until EOF.
If the argument is positive, and the underlying raw stream is not 'interactive', multiple raw reads may be issued to satisfy the byte count (unless EOF is reached first). But for interactive raw streams (as well as sockets and pipes), at most one raw read will be issued, and a short result does not imply that EOF is imminent.
Returns an empty bytes object on EOF.
Returns None if the underlying raw stream was open in non-blocking mode and no data is available at the moment. detach($self, /) --
Disconnect this buffer from its underlying raw stream and return it.
After the raw stream has been detached, the buffer is in an unusable state.Base class for buffered IO objects.
The main difference with RawIOBase is that the read() method supports omitting the size argument, and does not have a default implementation that defers to readinto().
In addition, read(), readinto() and write() may raise BlockingIOError if the underlying raw stream is in non-blocking mode and not ready; unlike their raw counterparts, they will never return None.
A typical implementation should not inherit from a RawIOBase implementation, but wrap one. BufferedReader(raw, buffer_size=DEFAULT_BUFFER_SIZE) --
Create a new buffered reader using the given readable raw IO object.BufferedWriter(raw, buffer_size=DEFAULT_BUFFER_SIZE) --
A buffer for a writeable sequential RawIO object.
The constructor creates a BufferedWriter for the given writeable raw stream. If the buffer_size is not given, it defaults to DEFAULT_BUFFER_SIZE.BufferedRWPair(reader, writer, buffer_size=DEFAULT_BUFFER_SIZE, /) --
A buffered reader and writer object together.
A buffered reader object and buffered writer object put together to form a sequential IO object that can read and write. This is typically used with a socket or two-way pipe.
reader and writer are RawIOBase objects that are readable and writeable respectively. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE.write($self, buffer, /) --
The constructor creates a reader and writer for a seekable stream, raw, given in the first argument. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE.truncate($self, size=None, /) --
Truncate the file to at most size bytes.
Size defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new size.seek($self, pos, whence=0, /) --
Change stream position.
Seek to byte offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos may be negative; 2 End of stream - pos usually negative. Returns the new absolute position.getvalue($self, /) --
Retrieve the entire contents of the BytesIO object.getbuffer($self, /) --
Get a read-write view over the contents of the BytesIO object.read($self, size=None, /) --
Read at most size bytes, returned as a bytes object.
If the size argument is negative, read until EOF is reached. Return an empty bytes object at EOF.readlines($self, size=None, /) --
List of bytes objects, each a line from the file.
Call readline() repeatedly and return a list of the lines so read. The optional size argument, if given, is an approximate bound on the total number of bytes in the lines returned.readline($self, size=None, /) --
Next line from the file, as a bytes object.
Retain newline. A non-negative size argument limits the maximum number of bytes to return (an incomplete line may be returned then). Return an empty bytes object at EOF.readinto($self, buffer, /) --
Read bytes into buffer.
Returns number of bytes read (0 for EOF), or None if the object is set not to block and has no data to read.read1($self, size, /) --
Read at most size bytes, returned as a bytes object.
If the size argument is negative or omitted, read until EOF is reached. Return an empty bytes object at EOF.writelines($self, lines, /) --
Write lines to the file.
Note that newlines are not added. lines can be any iterable object producing bytes-like objects. This is equivalent to calling write() for each element.write($self, b, /) --
Write bytes to file.
Return the number of bytes written.tell($self, /) --
Current file position, an integer.isatty($self, /) --
Always returns False.
BytesIO objects are not connected to a TTY-like device.flush($self, /) --
Does nothing.close($self, /) --
Disable all I/O operations.writable($self, /) --
Returns True if the IO object can be written.seekable($self, /) --
Returns True if the IO object can be seeked.readable($self, /) --
Returns True if the IO object can be read.BytesIO(initial_bytes=b'') --
Buffered I/O implementation using an in-memory bytes buffer.FileIO(file, mode='r', closefd=True, opener=None) --
Open a file.
The mode can be 'r' (default), 'w', 'x' or 'a' for reading, writing, exclusive creation or appending. The file will be created if it doesn't exist when opened for writing or appending; it will be truncated when opened for writing. A FileExistsError will be raised if it already exists when opened for creating. Opening a file for creating implies writing so this mode behaves in a similar way to 'w'.Add a '+' to the mode to allow simultaneous reading and writing. A custom opener can be used by passing a callable as *opener*. The underlying file descriptor for the file object is then obtained by calling opener with (*name*, *flags*). *opener* must return an open file descriptor (passing os.open as *opener* results in functionality similar to passing None).isatty($self, /) --
True if the file is connected to a TTY device.fileno($self, /) --
Return the underlying file descriptor (an integer).writable($self, /) --
True if file was opened in a write mode.readable($self, /) --
True if file was opened in a read mode.seekable($self, /) --
True if file supports random-access.close($self, /) --
Close the file.
A closed file cannot be used for further I/O operations. close() may be called more than once without error.truncate($self, size=None, /) --
Truncate the file to at most size bytes and return the truncated size.
Size defaults to the current file position, as returned by tell(). The current file position is changed to the value of size.tell($self, /) --
Current file position.
Can raise OSError for non seekable files.seek($self, pos, whence=0, /) --
Move to new file position and return the file position.
Argument offset is a byte count. Optional argument whence defaults to SEEK_SET or 0 (offset from start of file, offset should be >= 0); other values are SEEK_CUR or 1 (move relative to current position, positive or negative), and SEEK_END or 2 (move relative to end of file, usually negative, although many platforms allow seeking beyond the end of a file).
Note that not all file objects are seekable.write($self, b, /) --
Write buffer b to file, return number of bytes written.
Only makes one system call, so not all of the data may be written. The number of bytes actually written is returned. In non-blocking mode, returns None if the write would block.readinto($self, buffer, /) --
Same as RawIOBase.readinto().readall($self, /) --
Read all data from the file, returned as bytes.
In non-blocking mode, returns as much as is immediately available, or None if no data is available. Return an empty bytes object at EOF.read($self, size=-1, /) --
Read at most size bytes, returned as bytes.
Only makes one system call, so less data may be returned than requested. In non-blocking mode, returns None if no data is available. Return an empty bytes object at EOF.writelines($self, lines, /) --
readlines($self, hint=-1, /) --
Return a list of lines from the stream.
hint can be specified to control the number of lines read: no more lines will be read if the total size (in bytes/characters) of all lines so far exceeds hint.readline($self, size=-1, /) --
Read and return a line from the stream.
If size is specified, at most size bytes will be read.
The line terminator is always b'\n' for binary files; for text files, the newlines argument to open can be used to select the line terminator(s) recognized.isatty($self, /) --
Return whether this is an 'interactive' stream.
Return False if it can't be determined.fileno($self, /) --
Returns underlying file descriptor if one exists.
OSError is raised if the IO object does not use a file descriptor.writable($self, /) --
Return whether object was opened for writing.
If False, write() will raise OSError.readable($self, /) --
Return whether object was opened for reading.
If False, read() will raise OSError.seekable($self, /) --
Return whether object supports random access.
If False, seek(), tell() and truncate() will raise OSError. This method may need to do a test seek().close($self, /) --
Flush and close the IO object.
This method has no effect if the file is already closed.flush($self, /) --
Flush write buffers, if applicable.
This is not implemented for read-only and non-blocking streams.Truncate file to size bytes.
File pointer is left unchanged. Size defaults to the current IO position as reported by tell(). Returns the new size.tell($self, /) --
Return current stream position.Change stream position.
Change the stream position to the given byte offset. The offset is interpreted relative to the position indicated by whence. Values for whence are:
* 0 -- start of stream (the default); offset should be zero or positive * 1 -- current stream position; offset may be negative * 2 -- end of stream; offset is usually negative
Return the new absolute position.The abstract base class for all I/O classes, acting on streams of bytes. There is no public constructor.
This class provides dummy implementations for many methods that derived classes can override selectively; the default implementations represent a file that cannot be read, written or seeked.
Even though IOBase does not declare read, readinto, or write because their signatures will vary, implementations and clients should consider those methods part of the interface. Also, implementations may raise UnsupportedOperation when operations they do not support are called.
The basic type used for binary data read from or written to a file is bytes. Other bytes-like objects are accepted as method arguments too. In some cases (such as readinto), a writable object is required. Text I/O classes work with str data.
Note that calling any method (except additional calls to close(), which are ignored) on a closed stream should raise a ValueError.
IOBase (and its subclasses) support the iterator protocol, meaning that an IOBase object can be iterated over yielding the lines in a stream.
IOBase also supports the :keyword:`with` statement. In this example, fp is closed after the suite of the with statement is complete:
with open('spam.txt', 'r') as fp: fp.write('Spam and eggs!') readall($self, /) --
Read until EOF, using multiple read() call.read($self, size=-1, /) --
Base class for raw binary I/O.open($module, /, file, mode='r', buffering=-1, encoding=None, errors=None, newline=None, closefd=True, opener=None) --
Open file and return a stream. Raise IOError upon failure.
file is either a text or byte string giving the name (and the path if the file isn't in the current working directory) of the file to be opened or an integer file descriptor of the file to be wrapped. (If a file descriptor is given, it is closed when the returned I/O object is closed, unless closefd is set to False.)
mode is an optional string that specifies the mode in which the file is opened. It defaults to 'r' which means open for reading in text mode. Other common values are 'w' for writing (truncating the file if it already exists), 'x' for creating and writing to a new file, and 'a' for appending (which on some Unix systems, means that all writes append to the end of the file regardless of the current seek position). In text mode, if encoding is not specified the encoding used is platform dependent: locale.getpreferredencoding(False) is called to get the current locale encoding. (For reading and writing raw bytes use binary mode and leave encoding unspecified.) The available modes are:
========= =============================================================== Character Meaning --------- --------------------------------------------------------------- 'r' open for reading (default) 'w' open for writing, truncating the file first 'x' create a new file and open it for writing 'a' open for writing, appending to the end of the file if it exists 'b' binary mode 't' text mode (default) '+' open a disk file for updating (reading and writing) 'U' universal newline mode (deprecated) ========= ===============================================================
The default mode is 'rt' (open for reading text). For binary random access, the mode 'w+b' opens and truncates the file to 0 bytes, while 'r+b' opens the file without truncation. The 'x' mode implies 'w' and raises an `FileExistsError` if the file already exists.
Python distinguishes between files opened in binary and text modes, even when the underlying operating system doesn't. Files opened in binary mode (appending 'b' to the mode argument) return contents as bytes objects without any decoding. In text mode (the default, or when 't' is appended to the mode argument), the contents of the file are returned as strings, the bytes having been first decoded using a platform-dependent encoding or using the specified encoding if given.
'U' mode is deprecated and will raise an exception in future versions of Python. It has no effect in Python 3. Use newline to control universal newlines mode.
buffering is an optional integer used to set the buffering policy. Pass 0 to switch buffering off (only allowed in binary mode), 1 to select line buffering (only usable in text mode), and an integer > 1 to indicate the size of a fixed-size chunk buffer. When no buffering argument is given, the default buffering policy works as follows:
* Binary files are buffered in fixed-size chunks; the size of the buffer is chosen using a heuristic trying to determine the underlying device's "block size" and falling back on `io.DEFAULT_BUFFER_SIZE`. On many systems, the buffer will typically be 4096 or 8192 bytes long.
* "Interactive" text files (files for which isatty() returns True) use line buffering. Other text files use the policy described above for binary files.
encoding is the name of the encoding used to decode or encode the file. This should only be used in text mode. The default encoding is platform dependent, but any encoding supported by Python can be passed. See the codecs module for the list of supported encodings.
errors is an optional string that specifies how encoding errors are to be handled---this argument should not be used in binary mode. Pass 'strict' to raise a ValueError exception if there is an encoding error (the default of None has the same effect), or pass 'ignore' to ignore errors. (Note that ignoring encoding errors can lead to data loss.) See the documentation for codecs.register or run 'help(codecs.Codec)' for a list of the permitted encoding error strings.
newline controls how universal newlines works (it only applies to text mode). It can be None, '', '\n', '\r', and '\r\n'. It works as follows:
* On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated.
* On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '' or '\n', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string.
If closefd is False, the underlying file descriptor will be kept open when the file is closed. This does not work when a file name is given and must be True in that case.
A custom opener can be used by passing a callable as *opener*. The underlying file descriptor for the file object is then obtained by calling *opener* with (*file*, *flags*). *opener* must return an open file descriptor (passing os.open as *opener* results in functionality similar to passing None).
open() returns a file object whose type depends on the mode, and through which the standard file operations such as reading and writing are performed. When open() is used to open a file in a text mode ('w', 'r', 'wt', 'rt', etc.), it returns a TextIOWrapper. When used to open a file in a binary mode, the returned class varies: in read binary mode, it returns a BufferedReader; in write binary and append binary modes, it returns a BufferedWriter, and in read/write mode, it returns a BufferedRandom.
It is also possible to use a string or bytearray as a file for both reading and writing. For strings StringIO can be used like a file opened in a text mode, and for bytes a BytesIO can be used like a file opened in a binary mode.The io module provides the Python interfaces to stream handling. The builtin open function is defined in this module.
At the top of the I/O hierarchy is the abstract base class IOBase. It defines the basic interface to a stream. Note, however, that there is no separation between reading and writing to streams; implementations are allowed to raise an IOError if they do not support a given operation.
Extending IOBase is RawIOBase which deals simply with the reading and writing of raw bytes to a stream. FileIO subclasses RawIOBase to provide an interface to OS files.
BufferedIOBase deals with buffering on a raw byte stream (RawIOBase). Its subclasses, BufferedWriter, BufferedReader, and BufferedRWPair buffer streams that are readable, writable, and both respectively. BufferedRandom provides a buffered interface to random access streams. BytesIO is a simple stream of in-memory bytes.
Another IOBase subclass, TextIOBase, deals with the encoding and decoding of streams into text. TextIOWrapper, which extends it, is a buffered text interface to a buffered raw stream (`BufferedIOBase`). Finally, StringIO is an in-memory stream for text.
Argument names are not part of the specification, and only the arguments of open() are intended to be used as keyword arguments.
data:
DEFAULT_BUFFER_SIZE
An int containing the default buffer size used by the module's buffered I/O classes. open() uses the file's blksize (as obtained by os.stat) if possible. bind_textdomain_codeset(domain, codeset) -> string Bind the C library's domain to codeset.bindtextdomain(domain, dir) -> string Bind the C library's domain to dir.textdomain(domain) -> string Set the C library's textdmain to domain, returning the new domain.dcgettext(domain, msg, category) -> string Return translation of msg in domain and category.dgettext(domain, msg) -> string Return translation of msg in domain.gettext(msg) -> string Return translation of msg.nl_langinfo(key) -> string Return the value for the locale information associated with key.strxfrm(string) -> string.
Return a string that can be used as a key for locale-aware comparisons.string,string -> int. Compares two strings according to the locale.() -> dict. Returns numeric and monetary locale-specific parameters.(integer,string=None) -> string. Activates/queries locale processing.Support for POSIX locales.get_clock_info(name: str) -> dict
Get information of the specified clock.perf_counter() -> float
Performance counter for benchmarking.process_time() -> float
Process time for profiling: sum of the kernel and user-space CPU time.monotonic() -> float
Monotonic clock, cannot go backward.tzset()
Initialize, or reinitialize, the local timezone to the value stored in os.environ['TZ']. The TZ environment variable should be specified in standard Unix timezone format as documented in the tzset man page (eg. 'US/Eastern', 'Europe/Amsterdam'). Unknown timezones will silently fall back to UTC. If the TZ environment variable is not set, the local timezone is set to the systems best guess of wallclock time. Changing the TZ environment variable without calling tzset *may* change the local timezone used by methods such as localtime, but this behaviour should not be relied on.strptime(string, format) -> struct_time
Parse a string to a time tuple according to a format specification. See the library reference manual for formatting codes (same as strftime()).
Commonly used format codes:
%Y Year with century as a decimal number. %m Month as a decimal number [01,12]. %d Day of the month as a decimal number [01,31]. %H Hour (24-hour clock) as a decimal number [00,23]. %M Minute as a decimal number [00,59]. %S Second as a decimal number [00,61]. %z Time zone offset from UTC. %a Locale's abbreviated weekday name. %A Locale's full weekday name. %b Locale's abbreviated month name. %B Locale's full month name. %c Locale's appropriate date and time representation. %I Hour (12-hour clock) as a decimal number [01,12]. %p Locale's equivalent of either AM or PM.
Other codes may be available on your platform. See documentation for the C library strftime function. strftime(format[, tuple]) -> string
Convert a time tuple to a string according to a format specification. See the library reference manual for formatting codes. When the time tuple is not present, current time as returned by localtime() is used.
Commonly used format codes:
%Y Year with century as a decimal number. %m Month as a decimal number [01,12]. %d Day of the month as a decimal number [01,31]. %H Hour (24-hour clock) as a decimal number [00,23]. %M Minute as a decimal number [00,59]. %S Second as a decimal number [00,61]. %z Time zone offset from UTC. %a Locale's abbreviated weekday name. %A Locale's full weekday name. %b Locale's abbreviated month name. %B Locale's full month name. %c Locale's appropriate date and time representation. %I Hour (12-hour clock) as a decimal number [01,12]. %p Locale's equivalent of either AM or PM.
Other codes may be available on your platform. See documentation for the C library strftime function. mktime(tuple) -> floating point number
Convert a time tuple in local time to seconds since the Epoch. Note that mktime(gmtime(0)) will not generally return zero for most time zones; instead the returned value will either be equal to that of the timezone or altzone attributes on the time module.ctime(seconds) -> string
Convert a time in seconds since the Epoch to a string in local time. This is equivalent to asctime(localtime(seconds)). When the time tuple is not present, current time as returned by localtime() is used.asctime([tuple]) -> string
Convert a time tuple to a string, e.g. 'Sat Jun 06 16:26:11 1998'. When the time tuple is not present, current time as returned by localtime() is used.localtime([seconds]) -> (tm_year,tm_mon,tm_mday,tm_hour,tm_min, tm_sec,tm_wday,tm_yday,tm_isdst)
Convert seconds since the Epoch to a time tuple expressing local time. When 'seconds' is not passed in, convert the current time instead.gmtime([seconds]) -> (tm_year, tm_mon, tm_mday, tm_hour, tm_min, tm_sec, tm_wday, tm_yday, tm_isdst)
Convert seconds since the Epoch to a time tuple expressing UTC (a.k.a. GMT). When 'seconds' is not passed in, convert the current time instead.
If the platform supports the tm_gmtoff and tm_zone, they are available as attributes only.sleep(seconds)
Delay execution for a given number of seconds. The argument may be a floating point number for subsecond precision.clock_getres(clk_id) -> floating point number
Return the resolution (precision) of the specified clock clk_id.clock_settime(clk_id, time)
Set the time of the specified clock clk_id.clock_gettime(clk_id) -> floating point number
Return the time of the specified clock clk_id.clock() -> floating point number
Return the CPU time or real time since the start of the process or since the first call to clock(). This has as much precision as the system records.time() -> floating point number
Return the current time in seconds since the Epoch. Fractions of a second may be present if the system clock provides them.This module provides various functions to manipulate time values.
There are two standard representations of time. One is the number of seconds since the Epoch, in UTC (a.k.a. GMT). It may be an integer or a floating point number (to represent fractions of seconds). The Epoch is system-defined; on Unix, it is generally January 1st, 1970. The actual value can be retrieved by calling gmtime(0).
The other representation is a tuple of 9 integers giving local time. The tuple items are: year (including century, e.g. 1998) month (1-12) day (1-31) hours (0-23) minutes (0-59) seconds (0-59) weekday (0-6, Monday is 0) Julian day (day in the year, 1-366) DST (Daylight Savings Time) flag (-1, 0 or 1) If the DST flag is 0, the time is given in the regular time zone; if it is 1, the time is given in the DST time zone; if it is -1, mktime() should guess based on the date and time. ��������Convert a file's mode to a string of the form '-rwxrwxrwx'Return the portion of the file's mode that describes the file type.Return the portion of the file's mode that can be set by os.chmod().S_ISWHT(mode) -> bool
Return True if mode is from a whiteout.S_ISPORT(mode) -> bool
Return True if mode is from an event port.S_ISDOOR(mode) -> bool
Return True if mode is from a door.S_ISSOCK(mode) -> bool
Return True if mode is from a socket.S_ISLNK(mode) -> bool
Return True if mode is from a symbolic link.S_ISFIFO(mode) -> bool
Return True if mode is from a FIFO (named pipe).S_ISREG(mode) -> bool
Return True if mode is from a regular file.S_ISBLK(mode) -> bool
Return True if mode is from a block special device file.S_ISCHR(mode) -> bool
Return True if mode is from a character special device file.S_ISDIR(mode) -> bool
Return True if mode is from a directory.S_IFMT_: file type bits S_IFDIR: directory S_IFCHR: character device S_IFBLK: block device S_IFREG: regular file S_IFIFO: fifo (named pipe) S_IFLNK: symbolic link S_IFSOCK: socket file S_IFDOOR: door S_IFPORT: event port S_IFWHT: whiteout
S_ISUID: set UID bit S_ISGID: set GID bit S_ENFMT: file locking enforcement S_ISVTX: sticky bit S_IREAD: Unix V7 synonym for S_IRUSR S_IWRITE: Unix V7 synonym for S_IWUSR S_IEXEC: Unix V7 synonym for S_IXUSR S_IRWXU: mask for owner permissions S_IRUSR: read by owner S_IWUSR: write by owner S_IXUSR: execute by owner S_IRWXG: mask for group permissions S_IRGRP: read by group S_IWGRP: write by group S_IXGRP: execute by group S_IRWXO: mask for others (not in group) permissions S_IROTH: read by others S_IWOTH: write by others S_IXOTH: execute by others
UF_NODUMP: do not dump file UF_IMMUTABLE: file may not be changed UF_APPEND: file may only be appended to UF_OPAQUE: directory is opaque when viewed through a union stack UF_NOUNLINK: file may not be renamed or deleted UF_COMPRESSED: OS X: file is hfs-compressed UF_HIDDEN: OS X: file should not be displayed SF_ARCHIVED: file may be archived SF_IMMUTABLE: file may not be changed SF_APPEND: file may only be appended to SF_NOUNLINK: file may not be renamed or deleted SF_SNAPSHOT: file is a snapshot file
FILE_ATTRIBUTE_*: Windows file attribute constants (only present on Windows) struct_siginfo: Result from sigwaitinfo or sigtimedwait.
This object may be accessed either as a tuple of (si_signo, si_code, si_errno, si_pid, si_uid, si_status, si_band), or via the attributes si_signo, si_code, and so on.sigtimedwait($module, sigset, timeout, /) --
Like sigwaitinfo(), but with a timeout.
The timeout is specified in seconds, with floating point numbers allowed.sigwaitinfo($module, sigset, /) --
Wait synchronously until one of the signals in *sigset* is delivered.
Returns a struct_siginfo containing information about the signal.sigwait($module, sigset, /) --
Wait for a signal.
Suspend execution of the calling thread until the delivery of one of the signals specified in the signal set sigset. The function accepts the signal and returns the signal number.sigpending($module, /) --
Examine pending signals.
Returns a set of signal numbers that are pending for delivery to the calling thread.pthread_sigmask($module, how, mask, /) --
Fetch and/or change the signal mask of the calling thread.pthread_kill($module, thread_id, signalnum, /) --
Send a signal to a thread.pause($module, /) --
Wait until a signal arrives.siginterrupt($module, signalnum, flag, /) --
Change system call restart behaviour.
If flag is False, system calls will be restarted when interrupted by signal sig, else system calls will be interrupted.set_wakeup_fd(fd) -> fd
Sets the fd to be written to (with the signal number) when a signal comes in. A library can use this to wakeup select or poll. The previous fd or -1 is returned.
The fd must be non-blocking.getsignal($module, signalnum, /) --
Return the current action for the given signal.
The return value can be: SIG_IGN -- if the signal is being ignored SIG_DFL -- if the default action for the signal is in effect None -- if an unknown handler is in effect anything else -- the callable Python object used as a handlersignal($module, signalnum, handler, /) --
Set the action for the given signal.
The action can be SIG_DFL, SIG_IGN, or a callable Python object. The previous action is returned. See getsignal() for possible return values.
*** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame.getitimer($module, which, /) --
Returns current value of given itimer.setitimer($module, which, seconds, interval=0.0, /) --
Sets given itimer (one of ITIMER_REAL, ITIMER_VIRTUAL or ITIMER_PROF).
The timer will fire after value seconds and after that every interval seconds. The itimer can be cleared by setting seconds to zero.
Returns old values as a tuple: (delay, interval).alarm($module, seconds, /) --
Arrange for SIGALRM to arrive after the given number of seconds.default_int_handler(...)
The default handler for SIGINT installed by Python. It raises KeyboardInterrupt.This module provides mechanisms to use signal handlers in Python.
Functions:
alarm() -- cause SIGALRM after a specified time [Unix only] setitimer() -- cause a signal (described below) after a specified float time and the timer may restart then [Unix only] getitimer() -- get current value of timer [Unix only] signal() -- set the action for a given signal getsignal() -- get the signal action for a given signal pause() -- wait until a signal arrives [Unix only] default_int_handler() -- default SIGINT handler
signal constants: SIG_DFL -- used to refer to the system default handler SIG_IGN -- used to ignore the signal NSIG -- number of defined signals SIGINT, SIGTERM, etc. -- signal numbers
itimer constants: ITIMER_REAL -- decrements in real time, and delivers SIGALRM upon expiration ITIMER_VIRTUAL -- decrements only when the process is executing, and delivers SIGVTALRM upon expiration ITIMER_PROF -- decrements both when the process is executing and when the system is executing on behalf of the process. Coupled with ITIMER_VIRTUAL, this timer is usually used to profile the time spent by the application in user and kernel space. SIGPROF is delivered upon expiration.
*** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame.����_ncallbacks() -> int
Return the number of registered exit functions._run_exitfuncs() -> None
Run all registered exit functions.unregister(func) -> None
Unregister an exit function which was previously registered using atexit.register
func - function to be unregistered_clear() -> None
Clear the list of previously registered exit functions.register(func, *args, **kwargs) -> func
Register a function to be executed upon normal program termination
func - function to be called at exit args - optional arguments to pass to func kwargs - optional keyword arguments to pass to func
func is returned to facilitate usage as a decorator.allow programmer to define multiple exit functions to be executedupon normal program termination.
Two public functions, register and unregister, are defined. groupby(iterable, key=None) -> make an iterator that returns consecutive keys and groups from the iterable. If the key function is not specified or is None, the element itself is used for grouping. Data container common to multiple tee objects.Iterator wrapped to make it copyableReturns an independent iterator.cycle(iterable) --> cycle object
Return elements from the iterable until it is exhausted. Then repeat the sequence indefinitely.dropwhile(predicate, iterable) --> dropwhile object
Drop items from the iterable while predicate(item) is true. Afterwards, return every element until the iterable is exhausted.takewhile(predicate, iterable) --> takewhile object
Return successive entries from an iterable as long as the predicate evaluates to true for each entry.islice(iterable, stop) --> islice object islice(iterable, start, stop[, step]) --> islice object
Return an iterator whose next() method returns selected values from an iterable. If start is specified, will skip all preceding elements; otherwise, start defaults to zero. Step defaults to one. If specified as another value, step determines how many values are skipped between successive calls. Works like a slice() on a list but returns an iterator.starmap(function, sequence) --> starmap object
Return an iterator whose values are returned from the function evaluated with an argument tuple taken from the given sequence.chain(*iterables) --> chain object
Return a chain object whose .__next__() method returns elements from the first iterable until it is exhausted, then elements from the next iterable, until all of the iterables are exhausted.chain.from_iterable(iterable) --> chain object
Alternate chain() constructor taking a single iterable argument that evaluates lazily.product(*iterables, repeat=1) --> product object
Cartesian product of input iterables. Equivalent to nested for-loops.
For example, product(A, B) returns the same as: ((x,y) for x in A for y in B). The leftmost iterators are in the outermost for-loop, so the output tuples cycle in a manner similar to an odometer (with the rightmost element changing on every iteration).
To compute the product of an iterable with itself, specify the number of repetitions with the optional repeat keyword argument. For example, product(A, repeat=4) means the same as product(A, A, A, A).
Return successive r-length combinations of elements in the iterable allowing individual elements to have successive repeats. combinations_with_replacement('ABC', 2) --> AA AB AC BB BC CCReturns size in memory, in bytes.permutations(iterable[, r]) --> permutations object
Return successive r-length permutations of elements in the iterable.
Return series of accumulated sums (or other binary function results).compress(data, selectors) --> iterator over selected data
Return data elements corresponding to true selector elements. Forms a shorter iterator from selected data elements using the selectors to choose the data elements.filterfalse(function or None, sequence) --> filterfalse object
Return those items of sequence for which function(item) is false. If function is None, return the items that are false.count(start=0, step=1) --> count object
Return a count object whose .__next__() method returns consecutive values. Equivalent to:
def count(firstval=0, step=1): x = firstval while 1: yield x x += step Private method returning an estimate of len(list(it)).repeat(object [,times]) -> create an iterator which returns the object for the specified number of times. If not specified, returns the object endlessly.Set state information for unpickling.Return state information for pickling.zip_longest(iter1 [,iter2 [...]], [fillvalue=None]) --> zip_longest object
Return a zip_longest object whose .__next__() method returns a tuple where the i-th element comes from the i-th iterable argument. The .__next__() method continues until the longest iterable in the argument sequence is exhausted and then it raises StopIteration. When the shorter iterables are exhausted, the fillvalue is substituted in their place. The fillvalue defaults to None or can be specified by a keyword argument. tee(iterable, n=2) --> tuple of n independent iterators.Functional tools for creating and using iterators.
Infinite iterators: count(start=0, step=1) --> start, start+step, start+2*step, ... cycle(p) --> p0, p1, ... plast, p0, p1, ... repeat(elem [,n]) --> elem, elem, elem, ... endlessly or up to n times
Iterators terminating on the shortest input sequence: accumulate(p[, func]) --> p0, p0+p1, p0+p1+p2 chain(p, q, ...) --> p0, p1, ... plast, q0, q1, ... chain.from_iterable([p, q, ...]) --> p0, p1, ... plast, q0, q1, ... compress(data, selectors) --> (d[0] if s[0]), (d[1] if s[1]), ... dropwhile(pred, seq) --> seq[n], seq[n+1], starting when pred fails groupby(iterable[, keyfunc]) --> sub-iterators grouped by value of keyfunc(v) filterfalse(pred, seq) --> elements of seq where pred(elem) is False islice(seq, [start,] stop [, step]) --> elements from seq[start:stop:step] starmap(fun, seq) --> fun(*seq[0]), fun(*seq[1]), ... tee(it, n=2) --> (it1, it2 , ... itn) splits one iterator into n takewhile(pred, seq) --> seq[0], seq[1], until pred fails zip_longest(p, q, ...) --> (p[0], q[0]), (p[1], q[1]), ...
Combinatoric generators: product(p, q, ... [repeat=1]) --> cartesian product permutations(p[, r]) combinations(p, r) combinations_with_replacement(p, r) D.__sizeof__() -- size of D in memory, in bytesRotate the deque n steps to the right (default n=1). If n is negative, rotates left.D.reverse() -- reverse *IN PLACE*D.__reversed__() -- return a reverse iterator over the dequeD.remove(value) -- remove first occurrence of value.Remove and return the leftmost element.Remove and return the rightmost element.D.insert(index, object) -- insert object before indexD.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.Extend the left side of the deque with elements from the iterableExtend the right side of the deque with elements from the iterableD.count(value) -> integer -- return number of occurrences of valueReturn a shallow copy of a deque.Remove all elements from the deque.Add an element to the left side of the deque.Add an element to the right side of the deque.deque([iterable[, maxlen]]) --> deque object
A list-like sequence optimized for data accesses near its endpoints.Private method returning an estimate of len(list(it)).Return state information for pickling.D.copy() -> a shallow copy of D.__missing__(key) # Called by __getitem__ for missing key; pseudo-code: if self.default_factory is None: raise KeyError((key,)) self[key] = value = self.default_factory() return value defaultdict(default_factory[, ...]) --> dict with default factory
The default factory is called without arguments to produce a new value when a key is not present, in __getitem__ only. A defaultdict compares equal to a dict with the same items. All remaining arguments are treated the same as if they were passed to the dict constructor, including keyword arguments. _count_elements(mapping, iterable) -> None
Count elements in the iterable, updating the mappingHigh performance data structures. - deque: ordered collection accessible from endpoints only - defaultdict: dict subclass with a default value factory length_hint(obj, default=0) -> int Return an estimate of the number of items in obj. This is useful for presizing containers when building from an iterable.
If the object supports len(), the result will be exact. Otherwise, it may over- or under-estimate by an arbitrary amount. The result will be an integer >= 0.compare_digest(a, b) -> bool
Return 'a == b'. This function uses an approach designed to prevent timing analysis, making it appropriate for cryptography. a and b must both be of the same type: either str (ASCII only), or any bytes-like object.
Note: If a and b are of different lengths, or if an error occurs, a timing attack could theoretically reveal information about the types and lengths of a and b--but not their values. itemgetter(item, ...) --> itemgetter object
Return a callable object that fetches the given item(s) from its operand. After f = itemgetter(2), the call f(r) returns r[2]. After g = itemgetter(2, 5, 3), the call g(r) returns (r[2], r[5], r[3])attrgetter(attr, ...) --> attrgetter object
Return a callable object that fetches the given attribute(s) from its operand. After f = attrgetter('name'), the call f(r) returns r.name. After g = attrgetter('name', 'date'), the call g(r) returns (r.name, r.date). After h = attrgetter('name.first', 'name.last'), the call h(r) returns (r.name.first, r.name.last).Return state information for picklingmethodcaller(name, ...) --> methodcaller object
Return a callable object that calls the given method on its operand. After f = methodcaller('name'), the call f(r) returns r.name(). After g = methodcaller('name', 'date', foo=1), the call g(r) returns r.name('date', foo=1).Operator interface.
This module exports a set of functions implemented in C corresponding to the intrinsic operators of Python. For example, operator.add(x, y) is equivalent to the expression x+y. The function names are those used for special methods; variants without leading and trailing '__' are also provided for convenience.partial(func, *args, **keywords) - new function with partial application of the given arguments and keywords. Create a cached callable that wraps another function.
user_function: the function being cached
maxsize: 0 for no caching None for unlimited cache size n for a bounded cache
typed: False cache f(3) and f(3.0) as identical calls True cache f(3) and f(3.0) as distinct calls
cache_info_type: namedtuple class with the fields: hits misses currsize maxsize Convert a cmp= function into a key= function.reduce(function, sequence[, initial]) -> value
Apply a function of two arguments cumulatively to the items of a sequence, from left to right, so as to reduce the sequence to a single value. For example, reduce(lambda x, y: x+y, [1, 2, 3, 4, 5]) calculates ((((1+2)+3)+4)+5). If initial is present, it is placed before the items of the sequence in the calculation, and serves as a default when the sequence is empty.Tools that operate on functions.proxy(object[, callback]) -- create a proxy object that weakly references 'object'. 'callback', if given, is called with a reference to the proxy when 'object' is about to be finalized.getweakrefs(object) -- return a list of all weak reference objects that point to 'object'._remove_dead_weakref($module, dct, key, /) --
Atomically remove key from dict if it points to a dead weakref.getweakrefcount($module, object, /) --
Return the number of weak references to 'object'._forget_codec($module, encoding, /) --
Purge the named codec from the internal codec lookup cachelookup_error($module, name, /) --
lookup_error(errors) -> handler
Return the error handler for the specified error handling name or raise a LookupError, if no handler exists under this name.register_error($module, errors, handler, /) --
Register the specified error handler under the name errors.
handler must be a callable object, that will be called with an exception instance containing information about the location of the encoding/decoding error and must return a (replacement, new position) tuple.readbuffer_encode($module, data, errors=None, /) --
Decodes obj using the codec registered for encoding.
Default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore', 'replace' and 'backslashreplace' as well as any other name registered with codecs.register_error that can handle ValueErrors.encode($module, /, obj, encoding='utf-8', errors='strict') --
Encodes obj using the codec registered for encoding.
The default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore', 'replace' and 'backslashreplace' as well as any other name registered with codecs.register_error that can handle ValueErrors.lookup($module, encoding, /) --
Looks up a codec tuple in the Python codec registry and returns a CodecInfo object.register($module, search_function, /) --
Register a codec search function.
Search functions are expected to take one argument, the encoding name in all lower case letters, and either return None, or a tuple of functions (encoder, decoder, stream_reader, stream_writer) (or a CodecInfo object).Compiled regular expression objectsThe result of re.match() and re.search(). Match objects always have a boolean value of True.__deepcopy__($self, /, memo) --
Return an iterator over all non-overlapping matches for the RE pattern in string.
For each match, the iterator returns a match object.split($self, /, string=None, maxsplit=0, *, source=None) --
Split string by the occurrences of pattern.findall($self, /, string=None, pos=0, endpos=sys.maxsize, *, source=None) --
Return a list of all non-overlapping matches of pattern in string.subn($self, /, repl, string, count=0) --
Return the tuple (new_string, number_of_subs_made) found by replacing the leftmost non-overlapping occurrences of pattern with the replacement repl.sub($self, /, repl, string, count=0) --
Return the string obtained by replacing the leftmost non-overlapping occurrences of pattern in string by the replacement repl.search($self, /, string=None, pos=0, endpos=sys.maxsize, *, pattern=None) --
Scan through string looking for a match, and return a corresponding match object instance.
Return None if no position in the string matches.fullmatch($self, /, string=None, pos=0, endpos=sys.maxsize, *, pattern=None) --
Matches against all of the stringmatch($self, /, string=None, pos=0, endpos=sys.maxsize, *, pattern=None) --
Matches zero or more characters at the beginning of the string.__deepcopy__($self, /, memo) --
__copy__($self, /) --
expand($self, /, template) --
Return the string obtained by doing backslash substitution on the string template, as done by the sub() method.groupdict($self, /, default=None) --
Return a dictionary containing all the named subgroups of the match, keyed by the subgroup name.
default Is used for groups that did not participate in the match.groups($self, /, default=None) --
Return a tuple containing all the subgroups of the match, from 1.
default Is used for groups that did not participate in the match.span($self, group=0, /) --
For MatchObject m, return the 2-tuple (m.start(group), m.end(group)).end($self, group=0, /) --
Return index of the end of the substring matched by group.start($self, group=0, /) --
Return index of the start of the substring matched by group.group([group1, ...]) -> str or tuple. Return subgroup(s) of the match by indices or names. For 0 returns the entire match.search($self, /) --
pwd.struct_passwd: Results from getpw*() routines.
This object may be accessed either as a tuple of (pw_name,pw_passwd,pw_uid,pw_gid,pw_gecos,pw_dir,pw_shell) or via the object attributes as named in the above tuple.getpwall($module, /) --
Return a list of all available password database entries, in arbitrary order.
See help(pwd) for more on password database entries.getpwnam($module, arg, /) --
Return the password database entry for the given user name.
See `help(pwd)` for more on password database entries.getpwuid($module, uidobj, /) --
Return the password database entry for the given numeric user ID.
See `help(pwd)` for more on password database entries.This module provides access to the Unix password database. It is available on all Unix versions.
Password database entries are reported as 7-tuples containing the following items from the password database (see `<pwd.h>'), in order: pw_name, pw_passwd, pw_uid, pw_gid, pw_gecos, pw_dir, pw_shell. The uid and gid items are integers, all others are strings. An exception is raised if the entry asked for cannot be found.This module makes available standard errno system symbols.
The value of each symbol is the corresponding integer value, e.g., on most systems, errno.ENOENT equals the integer 2.
The dictionary errno.errorcode maps numeric codes to symbol names, e.g., errno.errorcode[2] could be the string 'ENOENT'.
Symbols that are not relevant to the underlying system are not defined.
To map error codes to error messages, use the function os.strerror(), e.g. os.strerror(2) could return 'No such file or directory'.stat_result: Result from stat, fstat, or lstat.
This object may be accessed either as a tuple of (mode, ino, dev, nlink, uid, gid, size, atime, mtime, ctime) or via the attributes st_mode, st_ino, st_dev, st_nlink, st_uid, and so on.
Posix/windows: If your platform supports st_blksize, st_blocks, st_rdev, or st_flags, they are available as attributes only.
See os.stat for more information.statvfs_result: Result from statvfs or fstatvfs.
This object may be accessed either as a tuple of (bsize, frsize, blocks, bfree, bavail, files, ffree, favail, flag, namemax), or via the attributes f_bsize, f_frsize, f_blocks, f_bfree, and so on.
See os.statvfs for more information.waitid_result: Result from waitid.
This object may be accessed either as a tuple of (si_pid, si_uid, si_signo, si_status, si_code), or via the attributes si_pid, si_uid, and so on.
See os.waitid for more information.uname_result: Result from os.uname().
This object may be accessed either as a tuple of (sysname, nodename, release, version, machine), or via the attributes sysname, nodename, release, version, and machine.
See os.uname for more information.times_result: Result from os.times().
This object may be accessed either as a tuple of (user, system, children_user, children_system, elapsed), or via the attributes user, system, children_user, children_system, and elapsed.
See os.times for more information.A tuple of (columns, lines) for holding terminal window sizesched_param(sched_priority) --
Current has only one field: sched_priority");
sched_priority A scheduling parameter.getrandom($module, /, size, flags=0) --
Obtain a series of random bytes.fspath($module, /, path) --
Return the file system path representation of the object.
If the object is str or bytes, then allow it to pass through as-is. If the object defines __fspath__(), then return the result of that method. All other types raise a TypeError.scandir(path='.') -> iterator of DirEntry objects for given pathset_blocking(fd, blocking)
Set the blocking mode of the specified file descriptor. Set the O_NONBLOCK flag if blocking is False, clear the O_NONBLOCK flag otherwise.get_blocking(fd) -> bool
Get the blocking mode of the file descriptor: False if the O_NONBLOCK flag is set, True if the flag is cleared.set_inheritable($module, fd, inheritable, /) --
Set the inheritable flag of the specified file descriptor.get_inheritable($module, fd, /) --
Get the close-on-exe flag of the specified file descriptor.cpu_count($module, /) --
Return the number of CPUs in the system; return None if indeterminable.
This number is not equivalent to the number of CPUs the current process can use. The number of usable CPUs can be obtained with ``len(os.sched_getaffinity(0))``Return the size of the terminal window as (columns, lines).
The optional argument fd (default standard output) specifies which file descriptor should be queried.
If the file descriptor is not connected to a terminal, an OSError is thrown.
This function will only be defined if an implementation is available for this system.
shutil.get_terminal_size is the high-level function which should normally be used, os.get_terminal_size is the low-level implementation.listxattr($module, /, path=None, *, follow_symlinks=True) --
Return a list of extended attributes on path.
path may be either None, a string, a path-like object, or an open file descriptor. if path is None, listxattr will examine the current directory. If follow_symlinks is False, and the last element of the path is a symbolic link, listxattr will examine the symbolic link itself instead of the file the link points to.removexattr($module, /, path, attribute, *, follow_symlinks=True) --
Remove extended attribute attribute on path.
path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, removexattr will modify the symbolic link itself instead of the file the link points to.setxattr($module, /, path, attribute, value, flags=0, *, follow_symlinks=True) --
Set extended attribute attribute on path to value.
path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, setxattr will modify the symbolic link itself instead of the file the link points to.getxattr($module, /, path, attribute, *, follow_symlinks=True) --
Return the value of extended attribute attribute on path.
path may be either a string, a path-like object, or an open file descriptor. If follow_symlinks is False, and the last element of the path is a symbolic link, getxattr will examine the symbolic link itself instead of the file the link points to.getresgid($module, /) --
Return a tuple of the current process's real, effective, and saved group ids.getresuid($module, /) --
Return a tuple of the current process's real, effective, and saved user ids.setresgid($module, rgid, egid, sgid, /) --
Set the current process's real, effective, and saved group ids.setresuid($module, ruid, euid, suid, /) --
Set the current process's real, effective, and saved user ids.urandom($module, size, /) --
Return a bytes object containing random bytes suitable for cryptographic use.getloadavg($module, /) --
Return average recent system load information.
Return the number of processes in the system run queue averaged over the last 1, 5, and 15 minutes as a tuple of three floats. Raises OSError if the load average was unobtainable.abort($module, /) --
Abort the interpreter immediately.
This function 'dumps core' or otherwise fails in the hardest way possible on the hosting operating system. This function never returns.pathconf($module, /, path, name) --
Return the configuration limit name for the file or directory path.
If there is no limit, return -1. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.fpathconf($module, fd, name, /) --
Return the configuration limit name for the file descriptor fd.
If there is no limit, return -1.sysconf($module, name, /) --
Return an integer-valued system configuration variable.confstr($module, name, /) --
Return a string-valued system configuration variable.statvfs($module, /, path) --
Perform a statvfs system call on the given path.
path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.fstatvfs($module, fd, /) --
Perform an fstatvfs system call on the given fd.
Equivalent to statvfs(fd).WSTOPSIG($module, /, status) --
Return the signal that stopped the process that provided the status value.WTERMSIG($module, /, status) --
Return the signal that terminated the process that provided the status value.WEXITSTATUS($module, /, status) --
Return the process return code from status.WIFEXITED($module, /, status) --
Return True if the process returning status exited via the exit() system call.WIFSIGNALED($module, /, status) --
Return True if the process returning status was terminated by a signal.WIFSTOPPED($module, /, status) --
Return True if the process returning status was stopped.WIFCONTINUED($module, /, status) --
Return True if a particular process was continued from a job control stop.
Return True if the process returning status was continued from a job control stop.WCOREDUMP($module, status, /) --
Return True if the process returning status was dumped to a core file.fdatasync($module, /, fd) --
Force write of fd to disk without forcing update of metadata.sync($module, /) --
Force write of everything to disk.fsync($module, /, fd) --
Force write of fd to disk.fchdir($module, /, fd) --
Change to the directory of the given file descriptor.
fd must be opened on a directory, not a file. Equivalent to os.chdir(fd).strerror($module, code, /) --
Translate an error code to a message string.unsetenv($module, name, /) --
Delete an environment variable.putenv($module, name, value, /) --
Change or add an environment variable.posix_fadvise($module, fd, offset, length, advice, /) --
Announce an intention to access data in a specific pattern.
Announce an intention to access data in a specific pattern, thus allowing the kernel to make optimizations. The advice applies to the region of the file specified by fd starting at offset and continuing for length bytes. advice is one of POSIX_FADV_NORMAL, POSIX_FADV_SEQUENTIAL, POSIX_FADV_RANDOM, POSIX_FADV_NOREUSE, POSIX_FADV_WILLNEED, or POSIX_FADV_DONTNEED.posix_fallocate($module, fd, offset, length, /) --
Ensure a file has allocated at least a particular number of bytes on disk.
Ensure that the file specified by fd encompasses a range of bytes starting at offset bytes from the beginning and continuing for length bytes.truncate($module, /, path, length) --
Truncate a file, specified by path, to a specific length.
On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.ftruncate($module, fd, length, /) --
Truncate a file, specified by file descriptor, to a specific length.makedev($module, major, minor, /) --
Composes a raw device number from the major and minor device numbers.minor($module, device, /) --
Extracts a device minor number from a raw device number.major($module, device, /) --
Extracts a device major number from a raw device number.mknod($module, /, path, mode=384, device=0, *, dir_fd=None) --
Create a node in the file system.
Create a node in the file system (file, device special file or named pipe) at path. mode specifies both the permissions to use and the type of node to be created, being combined (bitwise OR) with one of S_IFREG, S_IFCHR, S_IFBLK, and S_IFIFO. If S_IFCHR or S_IFBLK is set on mode, device defines the newly created device special file (probably using os.makedev()). Otherwise device is ignored.
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.mkfifo($module, /, path, mode=438, *, dir_fd=None) --
Create a "fifo" (a POSIX named pipe).
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.pipe2($module, flags, /) --
Create a pipe with flags set atomically.
Returns a tuple of two file descriptors: (read_fd, write_fd)
flags can be constructed by ORing together one or more of these values: O_NONBLOCK, O_CLOEXEC.pipe($module, /) --
Create a pipe.
Returns a tuple of two file descriptors: (read_fd, write_fd)isatty($module, fd, /) --
Return True if the fd is connected to a terminal.
Return True if the file descriptor is an open file descriptor connected to the slave end of a terminal.fstat($module, /, fd) --
Perform a stat system call on the given file descriptor.
Like stat(), but for an open file descriptor. Equivalent to os.stat(fd).sendfile(out, in, offset, count) -> byteswritten sendfile(out, in, offset, count[, headers][, trailers], flags=0) -> byteswritten Copy count bytes from file descriptor in to file descriptor out.pwrite($module, fd, buffer, offset, /) --
Write bytes to a file descriptor starting at a particular offset.
Write buffer to fd, starting at offset bytes from the beginning of the file. Returns the number of bytes writte. Does not change the current file offset.writev($module, fd, buffers, /) --
Iterate over buffers, and write the contents of each to a file descriptor.
Returns the total number of bytes written. buffers must be a sequence of bytes-like objects.write($module, fd, data, /) --
Write a bytes object to a file descriptor.pread($module, fd, length, offset, /) --
Read a number of bytes from a file descriptor starting at a particular offset.
Read length bytes from file descriptor fd, starting at offset bytes from the beginning of the file. The file offset remains unchanged.readv($module, fd, buffers, /) --
Read from a file descriptor fd into an iterable of buffers.
The buffers should be mutable buffers accepting bytes. readv will transfer data into each buffer until it is full and then move on to the next buffer in the sequence to hold the rest of the data.
readv returns the total number of bytes read, which may be less than the total capacity of all the buffers.read($module, fd, length, /) --
Read from a file descriptor. Returns a bytes object.lseek($module, fd, position, how, /) --
Set the position of a file descriptor. Return the new position.
Return the new cursor position in number of bytes relative to the beginning of the file.lockf($module, fd, command, length, /) --
Apply, test or remove a POSIX lock on an open file descriptor.
fd An open file descriptor. command One of F_LOCK, F_TLOCK, F_ULOCK or F_TEST. length The number of bytes to lock, starting at the current position.dup2($module, /, fd, fd2, inheritable=True) --
Duplicate file descriptor.dup($module, fd, /) --
Return a duplicate of a file descriptor.device_encoding($module, /, fd) --
Return a string describing the encoding of a terminal's file descriptor.
The file descriptor must be attached to a terminal. If the device is not a terminal, return None.closerange($module, fd_low, fd_high, /) --
Closes all file descriptors in [fd_low, fd_high), ignoring errors.close($module, /, fd) --
Close a file descriptor.open($module, /, path, flags, mode=511, *, dir_fd=None) --
Open a file for low level IO. Returns a file descriptor (integer).
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.tcsetpgrp($module, fd, pgid, /) --
Set the process group associated with the terminal specified by fd.tcgetpgrp($module, fd, /) --
Return the process group associated with the terminal specified by fd.setpgid($module, pid, pgrp, /) --
Call the system call setpgid(pid, pgrp).setsid($module, /) --
Call the system call setsid().getsid($module, pid, /) --
Call the system call getsid(pid) and return the result.waitpid($module, pid, options, /) --
Wait for completion of a given child process.
Returns a tuple of information regarding the child process: (pid, status)
The options argument is ignored on Windows.waitid($module, idtype, id, options, /) --
Returns the result of waiting for a process or processes.
idtype Must be one of be P_PID, P_PGID or P_ALL. id The id to wait on. options Constructed from the ORing of one or more of WEXITED, WSTOPPED or WCONTINUED and additionally may be ORed with WNOHANG or WNOWAIT.
Returns either waitid_result or None if WNOHANG is specified and there are no children in a waitable state.wait4($module, /, pid, options) --
Wait for completion of a specific child process.
Returns a tuple of information about the child process: (pid, status, rusage)wait3($module, /, options) --
Wait for completion of a child process.
Returns a tuple of information about the child process: (pid, status, rusage)wait($module, /) --
Wait for completion of a child process.
Returns a tuple of information about the child process: (pid, status)setpgrp($module, /) --
Make the current process the leader of its process group.getpgid($module, /, pid) --
Call the system call getpgid(), and return the result.initgroups(username, gid) -> None
Call the system initgroups() to initialize the group access list with all of the groups of which the specified username is a member, plus the specified group id.setgroups($module, groups, /) --
Set the groups of the current process to list.setregid($module, rgid, egid, /) --
Set the current process's real and effective group ids.setegid($module, egid, /) --
Set the current process's effective group id.setgid($module, gid, /) --
Set the current process's group id.setreuid($module, ruid, euid, /) --
Set the current process's real and effective user ids.seteuid($module, euid, /) --
Set the current process's effective user id.setuid($module, uid, /) --
Set the current process's user id.killpg($module, pgid, signal, /) --
Kill a process group with a signal.kill($module, pid, signal, /) --
Kill a process with a signal.getlogin($module, /) --
Return the actual login name.getuid($module, /) --
Return the current process's user id.getppid($module, /) --
Return the parent's process id.
If the parent process has already exited, Windows machines will still return its id; others systems will return the id of the 'init' process (1).getpgrp($module, /) --
Return the current process group id.getpid($module, /) --
Return the current process id.getgroups($module, /) --
Return list of supplemental group IDs for the process.getgrouplist(user, group) -> list of groups to which a user belongs
Returns a list of groups to which a user belongs.
user: username to lookup group: base group id of the usergetgid($module, /) --
Return the current process's group id.geteuid($module, /) --
Return the current process's effective user id.getegid($module, /) --
Return the current process's effective group id.forkpty($module, /) --
Fork a new process with a new pseudo-terminal as controlling tty.
Returns a tuple of (pid, master_fd). Like fork(), return pid of 0 to the child process, and pid of child to the parent process. To both, return fd of newly opened pseudo-terminal.openpty($module, /) --
Open a pseudo-terminal.
Return a tuple of (master_fd, slave_fd) containing open file descriptors for both the master and slave ends.sched_getaffinity($module, pid, /) --
Return the affinity of the process identified by pid (or the current process if zero).
The affinity is returned as a set of CPU identifiers.sched_setaffinity($module, pid, mask, /) --
Set the CPU affinity of the process identified by pid to mask.
mask should be an iterable of integers identifying CPUs.sched_yield($module, /) --
Voluntarily relinquish the CPU.sched_setscheduler($module, pid, policy, param, /) --
Set the scheduling policy for the process identified by pid.
If pid is 0, the calling process is changed. param is an instance of sched_param.sched_setparam($module, pid, param, /) --
Set scheduling parameters for the process identified by pid.
If pid is 0, sets parameters for the calling process. param should be an instance of sched_param.sched_rr_get_interval($module, pid, /) --
Return the round-robin quantum for the process identified by pid, in seconds.
Value returned is a float.sched_getscheduler($module, pid, /) --
Get the scheduling policy for the process identifiedy by pid.
Passing 0 for pid returns the scheduling policy for the calling process.sched_getparam($module, pid, /) --
Returns scheduling parameters for the process identified by pid.
If pid is 0, returns parameters for the calling process. Return value is an instance of sched_param.sched_get_priority_min($module, /, policy) --
Get the minimum scheduling priority for policy.sched_get_priority_max($module, /, policy) --
Get the maximum scheduling priority for policy.fork($module, /) --
Fork a child process.
Return 0 to child process and PID of child to parent process.execve($module, /, path, argv, env) --
Execute an executable path with arguments, replacing current process.
path Path of executable file. argv Tuple or list of strings. env Dictionary of strings mapping to strings.execv($module, path, argv, /) --
Execute an executable path with arguments, replacing current process.
path Path of executable file. argv Tuple or list of strings._exit($module, /, status) --
Exit to the system with specified status, without normal exit processing.times($module, /) --
Return a collection containing process timing information.
The object returned behaves like a named tuple with these fields: (utime, stime, cutime, cstime, elapsed_time) All fields are floating point numbers.utime($module, /, path, times=None, *, ns=None, dir_fd=None, follow_symlinks=True) --
Set the access and modified time of path.
path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.
If times is not None, it must be a tuple (atime, mtime); atime and mtime should be expressed as float seconds since the epoch. If ns is specified, it must be a tuple (atime_ns, mtime_ns); atime_ns and mtime_ns should be expressed as integer nanoseconds since the epoch. If times is None and ns is unspecified, utime uses the current time. Specifying tuples for both times and ns is an error.
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. If follow_symlinks is False, and the last element of the path is a symbolic link, utime will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be available on your platform. If they are unavailable, using them will raise a NotImplementedError.remove($module, /, path, *, dir_fd=None) --
Remove a file (same as unlink()).
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.unlink($module, /, path, *, dir_fd=None) --
Remove a file (same as remove()).
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.uname($module, /) --
Return an object identifying the current operating system.
The object behaves like a named tuple with the following fields: (sysname, nodename, release, version, machine)umask($module, mask, /) --
Set the current numeric umask and return the previous umask.system($module, /, command) --
Execute the command in a subshell.symlink($module, /, src, dst, target_is_directory=False, *, dir_fd=None) --
Create a symbolic link pointing to src named dst.
target_is_directory is required on Windows if the target is to be interpreted as a directory. (On Windows, symlink requires Windows 6.0 or greater, and raises a NotImplementedError otherwise.) target_is_directory is ignored on non-Windows platforms.
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.stat_float_times([newval]) -> oldval
Determine whether os.[lf]stat represents time stamps as float objects.
If value is True, future calls to stat() return floats; if it is False, future calls return ints. If value is omitted, return the current setting. rmdir($module, /, path, *, dir_fd=None) --
Remove a directory.
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.replace($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None) --
Rename a file or directory, overwriting the destination.
If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. src_dir_fd and dst_dir_fd, may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError."rename($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None) --
Rename a file or directory.
If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. src_dir_fd and dst_dir_fd, may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.readlink(path, *, dir_fd=None) -> path
Return a string representing the path to which the symbolic link points.
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.setpriority($module, /, which, who, priority) --
Set program scheduling priority.getpriority($module, /, which, who) --
Return program scheduling priority.nice($module, increment, /) --
Add increment to the priority of process and return the new priority.mkdir($module, /, path, mode=511, *, dir_fd=None) --
Create a directory.
If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. dir_fd may not be implemented on your platform. If it is unavailable, using it will raise a NotImplementedError.
The mode argument is ignored on Windows.lstat($module, /, path, *, dir_fd=None) --
Perform a stat system call on the given path, without following symbolic links.
Like stat(), but do not follow symbolic links. Equivalent to stat(path, follow_symlinks=False).listdir($module, /, path=None) --
Return a list containing the names of the files in the directory.
path can be specified as either str, bytes, or a path-like object. If path is bytes, the filenames returned will also be bytes; in all other circumstances the filenames returned will be str. If path is None, uses the path='.'. On some platforms, path may also be specified as an open file descriptor;\ the file descriptor must refer to a directory. If this functionality is unavailable, using it raises NotImplementedError.
The list is in arbitrary order. It does not include the special entries '.' and '..' even if they are present in the directory.link($module, /, src, dst, *, src_dir_fd=None, dst_dir_fd=None, follow_symlinks=True) --
Create a hard link to a file.
If either src_dir_fd or dst_dir_fd is not None, it should be a file descriptor open to a directory, and the respective path string (src or dst) should be relative; the path will then be relative to that directory. If follow_symlinks is False, and the last element of src is a symbolic link, link will create a link to the symbolic link itself instead of the file the link points to. src_dir_fd, dst_dir_fd, and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.getcwdb($module, /) --
Return a bytes string representing the current working directory.getcwd($module, /) --
Return a unicode string representing the current working directory.ctermid($module, /) --
Return the name of the controlling terminal for this process.chroot($module, /, path) --
Change root directory to path.lchown($module, /, path, uid, gid) --
Change the owner and group id of path to the numeric uid and gid.
This function will not follow symbolic links. Equivalent to os.chown(path, uid, gid, follow_symlinks=False).fchown($module, /, fd, uid, gid) --
Change the owner and group id of the file specified by file descriptor.
Change the owner and group id of path to the numeric uid and gid.\
path Path to be examined; can be string, bytes, a path-like object, or open-file-descriptor int. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, stat will examine the symbolic link itself instead of the file the link points to.
path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. If dir_fd is not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. If follow_symlinks is False, and the last element of the path is a symbolic link, chown will modify the symbolic link itself instead of the file the link points to. It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.fchmod($module, /, fd, mode) --
Change the access permissions of the file given by file descriptor fd.
path Path to be modified. May always be specified as a str, bytes, or a path-like object. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception. mode Operating-system mode bitfield. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, chmod will modify the symbolic link itself instead of the file the link points to.
It is an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor. dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.chdir($module, /, path) --
Change the current working directory to the specified path.
path may always be specified as a string. On some platforms, path may also be specified as an open file descriptor. If this functionality is unavailable, using it raises an exception.ttyname($module, fd, /) --
Return the name of the terminal device connected to 'fd'.
Use the real uid/gid to test for access to a path.
path Path to be tested; can be string, bytes, or a path-like object. mode Operating-system mode bitfield. Can be F_OK to test existence, or the inclusive-OR of R_OK, W_OK, and X_OK. dir_fd If not None, it should be a file descriptor open to a directory, and path should be relative; path will then be relative to that directory. effective_ids If True, access will use the effective uid/gid instead of the real uid/gid. follow_symlinks If False, and the last element of the path is a symbolic link, access will examine the symbolic link itself instead of the file the link points to.
dir_fd, effective_ids, and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.
Note that most operations will use the effective uid/gid, therefore this routine can be used in a suid/sgid environment to test if the invoking user has the specified access to the path.stat($module, /, path, *, dir_fd=None, follow_symlinks=True) --
Perform a stat system call on the given path.
path Path to be examined; can be string, bytes, a path-like object or open-file-descriptor int. dir_fd If not None, it should be a file descriptor open to a directory, and path should be a relative string; path will then be relative to that directory. follow_symlinks If False, and the last element of the path is a symbolic link, stat will examine the symbolic link itself instead of the file the link points to.
dir_fd and follow_symlinks may not be implemented on your platform. If they are unavailable, using them will raise a NotImplementedError.
It's an error to use dir_fd or follow_symlinks when specifying path as an open file descriptor.This module provides access to operating system functionality that is standardized by the C Standard and the POSIX standard (a thinly disguised Unix interface). Refer to the library manual and corresponding Unix manual entries for more information on calls.������������locked() -> bool (locked_lock() is an obsolete synonym)
Return whether the lock is in the locked state.release() (release_lock() is an obsolete synonym)
Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, but it needn't be locked by the same thread that unlocks it.acquire(blocking=True, timeout=-1) -> bool (acquire_lock() is an obsolete synonym)
Lock the lock. Without argument, this blocks if the lock is already locked (even by the same thread), waiting for another thread to release the lock, and return True once the lock is acquired. With an argument, this will only block if the argument is true, and the return value reflects whether the lock is acquired. The blocking operation is interruptible._release_save() -> tuple
For internal use by `threading.Condition`._acquire_restore(state) -> None
For internal use by `threading.Condition`._is_owned() -> bool
For internal use by `threading.Condition`.release()
Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, and must be locked by the same thread that unlocks it; otherwise a `RuntimeError` is raised.
Do note that if the lock was acquire()d several times in a row by the current thread, release() needs to be called as many times for the lock to be available for other threads.acquire(blocking=True) -> bool
Lock the lock. `blocking` indicates whether we should wait for the lock to be available or not. If `blocking` is False and another thread holds the lock, the method will return False immediately. If `blocking` is True and another thread holds the lock, the method will wait for the lock to be released, take it and then return True. (note: the blocking operation is interruptible.)
In all other cases, the method will return True immediately. Precisely, if the current thread already holds the lock, its internal counter is simply incremented. If nobody holds the lock, the lock is taken and its internal counter initialized to 1._set_sentinel() -> lock
Set a sentinel lock that will be released when the current thread state is finalized (after it is untied from the interpreter).
This is a private API for the threading module.stack_size([size]) -> size
Return the thread stack size used when creating new threads. The optional size argument specifies the stack size (in bytes) to be used for subsequently created threads, and must be 0 (use platform or configured default) or a positive integer value of at least 32,768 (32k). If changing the thread stack size is unsupported, a ThreadError exception is raised. If the specified size is invalid, a ValueError exception is raised, and the stack size is unmodified. 32k bytes currently the minimum supported stack size value to guarantee sufficient stack space for the interpreter itself.
Note that some platforms may have particular restrictions on values for the stack size, such as requiring a minimum stack size larger than 32kB or requiring allocation in multiples of the system memory page size - platform documentation should be referred to for more information (4kB pages are common; using multiples of 4096 for the stack size is the suggested approach in the absence of more specific information)._count() -> integer
Return the number of currently running Python threads, excluding the main thread. The returned number comprises all threads created through `start_new_thread()` as well as `threading.Thread`, and not yet finished.
This function is meant for internal and specialized purposes only. In most applications `threading.enumerate()` should be used instead.get_ident() -> integer
Return a non-zero integer that uniquely identifies the current thread amongst other threads that exist simultaneously. This may be used to identify per-thread resources. Even though on some platforms threads identities may appear to be allocated consecutive numbers starting at 1, this behavior should not be relied upon, and the number should be seen purely as a magic cookie. A thread's identity may be reused for another thread after it exits.interrupt_main()
Raise a KeyboardInterrupt in the main thread. A subthread can use this function to interrupt the main thread.exit() (exit_thread() is an obsolete synonym)
This is synonymous to ``raise SystemExit''. It will cause the current thread to exit silently unless the exception is caught.allocate_lock() -> lock object (allocate() is an obsolete synonym)
Create a new lock object. See help(type(threading.Lock())) for information about locks.start_new_thread(function, args[, kwargs]) (start_new() is an obsolete synonym)
Start a new thread and return its identifier. The thread will call the function with positional arguments from the tuple args and keyword arguments taken from the optional dictionary kwargs. The thread exits when the function returns; the return value is ignored. The thread will also exit when the function raises an unhandled exception; a stack trace will be printed unless the exception is SystemExit. This module provides primitive operations to write multi-threaded programs. The 'threading' module provides a more convenient interface.A lock object is a synchronization primitive. To create a lock, call threading.Lock(). Methods are:
acquire() -- lock the lock, possibly blocking until it can be obtained release() -- unlock of the lock locked() -- test whether the lock is currently locked
A lock is not owned by the thread that locked it; another thread may unlock it. A thread attempting to lock a lock that it has already locked will block until another thread unlocks it. Deadlocks may ensue.get_referents(*objs) -> list Return the list of objects that are directly referred to by objs.get_referrers(*objs) -> list Return the list of objects that directly refer to any of objs.is_tracked(obj) -> bool
Returns true if the object is tracked by the garbage collector. Simple atomic objects will return false. get_stats() -> [...]
Return a list of dictionaries containing per-generation statistics. get_objects() -> [...]
Return a list of objects tracked by the collector (excluding the list returned). collect([generation]) -> n
With no arguments, run a full collection. The optional argument may be an integer specifying which generation to collect. A ValueError is raised if the generation number is invalid.
The number of unreachable objects is returned. get_threshold() -> (threshold0, threshold1, threshold2)
Return the current collection thresholds set_threshold(threshold0, [threshold1, threshold2]) -> None
Sets the collection thresholds. Setting threshold0 to zero disables collection. get_count() -> (count0, count1, count2)
Return the current collection counts get_debug() -> flags
Get the garbage collection debugging flags. set_debug(flags) -> None
Set the garbage collection debugging flags. Debugging information is written to sys.stderr.
flags is an integer and can have the following bits turned on:
DEBUG_STATS - Print statistics during collection. DEBUG_COLLECTABLE - Print collectable objects found. DEBUG_UNCOLLECTABLE - Print unreachable but uncollectable objects found. DEBUG_SAVEALL - Save objects to gc.garbage rather than freeing them. DEBUG_LEAK - Debug leaking programs (everything but STATS). isenabled() -> status
Returns true if automatic garbage collection is enabled. disable() -> None
Enable automatic garbage collection. This module provides access to the garbage collector for reference cycles.
enable() -- Enable automatic garbage collection. disable() -- Disable automatic garbage collection. isenabled() -- Returns true if automatic collection is enabled. collect() -- Do a full collection right now. get_count() -- Return the current collection counts. get_stats() -- Return list of dictionaries containing per-generation stats. set_debug() -- Set debugging flags. get_debug() -- Get debugging flags. set_threshold() -- Set the collection thresholds. get_threshold() -- Return the current the collection thresholds. get_objects() -- Return a list of all objects tracked by the collector. is_tracked() -- Returns true if a given object is tracked. get_referrers() -- Return the list of objects that refer to an object. get_referents() -- Return the list of objects that an object refers to. sys.thread_info
A struct sequence holding information about the thread implementation.������������asyncgen_hooks
A struct sequence providing information about asynhronous generators hooks. The attributes are read only.hash_info
A struct sequence providing parameters used for computing hashes. The attributes are read only.set_int_max_str_digits($module, /, maxdigits) --
Set the maximum string digits limit for non-binary int<->str conversions.get_int_max_str_digits($module, /) --
Set the maximum string digits limit for non-binary int<->str conversions.get_asyncgen_hooks()
Return a namedtuple of installed asynchronous generators hooks (firstiter, finalizer).set_asyncgen_hooks(*, firstiter=None, finalizer=None)
Set a finalizer for async generators objects.get_coroutine_wrapper()
Return the wrapper for coroutine objects set by sys.set_coroutine_wrapper.set_coroutine_wrapper(wrapper)
Set a wrapper for coroutine objects._debugmallocstats()
Print summary info to stderr about the state of pymalloc's structures.
In Py_DEBUG mode, also perform some expensive internal consistency checks. call_tracing(func, args) -> object
Call func(*args), while tracing is enabled. The tracing state is saved, and restored afterwards. This is intended to be called from a debugger from a checkpoint, to recursively debug some other code.gettrace()
Return the global debug tracing function set with sys.settrace. See the debugger chapter in the library manual.settrace(function)
Set the global debug tracing function. It will be called on each function call. See the debugger chapter in the library manual.setrecursionlimit(n)
Set the maximum depth of the Python interpreter stack to n. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python. The highest possible limit is platform- dependent.getprofile()
Return the profiling function set with sys.setprofile. See the profiler chapter in the library manual.setprofile(function)
Set the profiling function. It will be called on each function call and return. See the profiler chapter in the library manual.setdlopenflags(n) -> None
Set the flags used by the interpreter for dlopen calls, such as when the interpreter loads extension modules. Among other things, this will enable a lazy resolving of symbols when importing a module, if called as sys.setdlopenflags(0). To share symbols across extension modules, call as sys.setdlopenflags(os.RTLD_GLOBAL). Symbolic names for the flag modules can be found in the os module (RTLD_xxx constants, e.g. os.RTLD_LAZY).getswitchinterval() -> current thread switch interval; see setswitchinterval().setswitchinterval(n)
Set the ideal thread switching delay inside the Python interpreter The actual frequency of switching threads can be lower if the interpreter executes long sequences of uninterruptible code (this is implementation-specific and workload-dependent).
The parameter must represent the desired switching delay in seconds A typical value is 0.005 (5 milliseconds).getcheckinterval() -> current check interval; see setcheckinterval().setcheckinterval(n)
Tell the Python interpreter to check for asynchronous events every n instructions. This also affects how often thread switches occur.is_finalizing() Return True if Python is exiting.intern(string) -> string
``Intern'' the given string. This enters the string in the (global) table of interned strings whose purpose is to speed up dictionary lookups. Return the string itself or the previously interned string object with the same value._getframe([depth]) -> frameobject
Return a frame object from the call stack. If optional integer depth is given, return the frame object that many calls below the top of the stack. If that is deeper than the call stack, ValueError is raised. The default for depth is zero, returning the frame at the top of the call stack.
This function should be used for internal and specialized purposes only.getsizeof(object, default) -> int
Return the size of object in bytes.getrecursionlimit()
Return the current value of the recursion limit, the maximum depth of the Python interpreter stack. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python.getrefcount(object) -> integer
Return the reference count of object. The count returned is generally one higher than you might expect, because it includes the (temporary) reference as an argument to getrefcount().getfilesystemencodeerrors() -> string
Return the error mode used to convert Unicode filenames in operating system filenames.getfilesystemencoding() -> string
Return the encoding used to convert Unicode filenames in operating system filenames.getallocatedblocks() -> integer
Return the number of memory blocks currently allocated, regardless of their size.getdlopenflags() -> int
Return the current value of the flags that are used for dlopen calls. The flag constants are defined in the os module.getdefaultencoding() -> string
Return the current default string encoding used by the Unicode implementation.exit([status])
Exit the interpreter by raising SystemExit(status). If the status is omitted or None, it defaults to zero (i.e., success). If the status is an integer, it will be used as the system exit status. If it is another kind of object, it will be printed and the system exit status will be one (i.e., failure).excepthook(exctype, value, traceback) -> None
Handle an exception by displaying it with a traceback on sys.stderr. exc_info() -> (type, value, traceback)
Return information about the most recent exception caught by an except clause in the current stack frame or in an older stack frame.displayhook(object) -> None
Print an object to sys.stdout and also save it in builtins._ _current_frames() -> dictionary
Return a dictionary mapping each current thread T's thread id to T's current stack frame.
This function should be used for specialized purposes only._clear_type_cache() -> None Clear the internal type lookup cache.callstats() -> tuple of integers
Return a tuple of function call statistics, if CALL_PROFILE was defined when Python was built. Otherwise, return None.
When enabled, this function returns detailed, implementation-specific details about the number of function calls executed. The return value is a 11-tuple where the entries in the tuple are counts of: 0. all function calls 1. calls to PyFunction_Type objects 2. PyFunction calls that do not create an argument tuple 3. PyFunction calls that do not create an argument tuple and bypass PyEval_EvalCodeEx() 4. PyMethod calls 5. PyMethod calls on bound methods 6. PyType calls 7. PyCFunction calls 8. generator calls 9. All other calls 10. Number of stack pops performed by call_function()sys.flags
Flags provided through command line arguments or environment vars.sys.version_info
Version information as a named tuple.This module provides access to some objects used or maintained by the interpreter and to functions that interact strongly with the interpreter.
Dynamic objects:
argv -- command line arguments; argv[0] is the script pathname if known path -- module search path; path[0] is the script directory, else '' modules -- dictionary of loaded modules
displayhook -- called to show results in an interactive session excepthook -- called to handle any uncaught exception other than SystemExit To customize printing in an interactive session or to install a custom top-level exception handler, assign other functions to replace these.
stdin -- standard input file object; used by input() stdout -- standard output file object; used by print() stderr -- standard error object; used for error messages By assigning other file objects (or objects that behave like files) to these, it is possible to redirect all of the interpreter's I/O.
last_type -- type of last uncaught exception last_value -- value of last uncaught exception last_traceback -- traceback of last uncaught exception These three are only available in an interactive session after a traceback has been printed.
Static objects:
builtin_module_names -- tuple of module names built into this interpreter copyright -- copyright notice pertaining to this interpreter exec_prefix -- prefix used to find the machine-specific Python library executable -- absolute path of the executable binary of the Python interpreter float_info -- a struct sequence with information about the float implementation. float_repr_style -- string indicating the style of repr() output for floats hash_info -- a struct sequence with information about the hash algorithm. hexversion -- version information encoded as a single integer implementation -- Python implementation information. int_info -- a struct sequence with information about the int implementation. maxsize -- the largest supported length of containers. maxunicode -- the value of the largest Unicode code point platform -- platform identifier prefix -- prefix used to find the Python library thread_info -- a struct sequence with information about the thread implementation. version -- the version of this interpreter as a string version_info -- version information as a named tuple __stdin__ -- the original stdin; don't touch! __stdout__ -- the original stdout; don't touch! __stderr__ -- the original stderr; don't touch! __displayhook__ -- the original displayhook; don't touch! __excepthook__ -- the original excepthook; don't touch!
Functions:
displayhook() -- print an object to the screen, and save it in builtins._ excepthook() -- print an exception and its traceback to sys.stderr exc_info() -- return thread-safe information about the current exception exit() -- exit the interpreter by raising SystemExit getdlopenflags() -- returns flags to be used for dlopen() calls getprofile() -- get the global profiling function getrefcount() -- return the reference count for an object (plus one :-) getrecursionlimit() -- return the max recursion depth for the interpreter getsizeof() -- return the size of an object in bytes gettrace() -- get the global debug tracing function setcheckinterval() -- control how often the interpreter checks for events setdlopenflags() -- set the flags to be used for dlopen() calls setprofile() -- set the global profiling function setrecursionlimit() -- set the max recursion depth for the interpreter settrace() -- set the global debug tracing function d������������loads(bytes)
Convert the bytes-like object to a value. If no valid value is found, raise EOFError, ValueError or TypeError. Extra bytes in the input are ignored.dumps(value[, version])
Return the bytes object that would be written to a file by dump(value, file). The value must be a supported type. Raise a ValueError exception if value has (or contains an object that has) an unsupported type.
The version argument indicates the data format that dumps should use.load(file)
Read one value from the open file and return it. If no valid value is read (e.g. because the data has a different Python version's incompatible marshal format), raise EOFError, ValueError or TypeError. The file must be a readable binary file.
Note: If an object containing an unsupported type was marshalled with dump(), load() will substitute None for the unmarshallable type.dump(value, file[, version])
Write the value on the open file. The value must be a supported type. The file must be a writeable binary file.
If the value has (or contains an object that has) an unsupported type, a ValueError exception is raised - but garbage data will also be written to the file. The object will not be properly read back by load()
The version argument indicates the data format that dump should use.This module contains functions that can read and write Python values in a binary format. The format is specific to Python, but independent of machine architecture issues.
Not all Python object types are supported; in general, only objects whose value is independent from a particular invocation of Python can be written and read by this module. The following types are supported: None, integers, floating point numbers, strings, bytes, bytearrays, tuples, lists, sets, dictionaries, and code objects, where it should be understood that tuples, lists and dictionaries are only supported as long as the values contained therein are themselves supported; and recursive lists and dictionaries should not be written (they will cause infinite loops).
Variables:
version -- indicates the format that the module uses. Version 0 is the historical format, version 1 shares interned strings and version 2 uses a binary format for floating point numbers. Version 3 shares common object references (New in version 3.4).
Functions:
dump() -- write value to a file load() -- read value from a file dumps() -- marshal value as a bytes object loads() -- read value from a bytes-like object_fix_co_filename($module, code, path, /) --
Changes code.co_filename to specify the passed-in file path.
code Code object to change. path File path to use.exec_builtin($module, mod, /) --
Initialize a built-in module.exec_dynamic($module, mod, /) --
Initialize an extension module.create_dynamic($module, spec, file=None, /) --
Create an extension module.is_frozen($module, name, /) --
Returns True if the module name corresponds to a frozen module.is_builtin($module, name, /) --
Returns True if the module name corresponds to a built-in module.init_frozen($module, name, /) --
Initializes a frozen module.create_builtin($module, spec, /) --
Create an extension module.is_frozen_package($module, name, /) --
Returns True if the module name is of a frozen package.get_frozen_object($module, name, /) --
Create a code object for a frozen module.release_lock($module, /) --
Release the interpreter's import lock.
On platforms without threads, this function does nothing.acquire_lock($module, /) --
Acquires the interpreter's import lock for the current thread.
This lock should be used by import hooks to ensure thread-safety when importing modules. On platforms without threads, this function does nothing.lock_held($module, /) --
Return True if the import lock is currently held, else False.
On platforms without threads, return False.extension_suffixes($module, /) --
Returns the list of file suffixes used to identify extension modules.(Extremely) low-level import machinery bits as used by importlib and imp.��������
"
" !" !" $" $
$" $ !" $$ $!"%&%'()*+,-.2/2 01/3 3456789:;<=>?@BACDEFGHIJ K2MLNOQPT! TPRSPRSMVVU U WR X Y Z[\]^_`_]bcacd c fBei hc i hig kjlVVmoncpapqps#tr#tvuxwwyz{lyf|}~���fy�l!������������!����������"������������2� ����S��� 3� 3�� �R� ���l3 l3
Return an iterator yielding those items of iterable for which function(item) is true. If function is None, return the items that are true.map(func, *iterables) --> map object
Make an iterator that computes the function using arguments from each of the iterables. Stops when the shortest iterable is exhausted.Return state information for pickling.zip(iter1 [,iter2 [...]]) --> zip object
Return a zip object whose .__next__() method returns a tuple where the i-th element comes from the i-th iterable argument. The .__next__() method continues until the shortest iterable in the argument sequence is exhausted and then it raises StopIteration.vars([object]) -> dictionary
Without arguments, equivalent to locals(). With an argument, equivalent to object.__dict__.sum($module, iterable, start=0, /) --
Return the sum of a 'start' value (default: 0) plus an iterable of numbers
When the iterable is empty, return the start value. This function is intended specifically for use with numeric values and may reject non-numeric types.sorted($module, iterable, /, *, key=None, reverse=False) --
Return a new list containing all items from the iterable in ascending order.
A custom key function can be supplied to customize the sort order, and the reverse flag can be set to request the result in descending order.setattr($module, obj, name, value, /) --
Sets the named attribute on the given object to the specified value.
setattr(x, 'y', v) is equivalent to ``x.y = v''round(number[, ndigits]) -> number
Round a number to a given precision in decimal digits (default 0 digits). This returns an int when called with one argument, otherwise the same type as the number. ndigits may be negative.repr($module, obj, /) --
Return the canonical string representation of the object.
For many object types, including most builtins, eval(repr(obj)) == obj.print(value, ..., sep=' ', end='\n', file=sys.stdout, flush=False)
Prints the values to a stream, or to sys.stdout by default. Optional keyword arguments: file: a file-like object (stream); defaults to the current sys.stdout. sep: string inserted between values, default a space. end: string appended after the last value, default a newline. flush: whether to forcibly flush the stream.pow($module, x, y, z=None, /) --
Equivalent to x**y (with two arguments) or x**y % z (with three arguments)
Some types, such as ints, are able to use a more efficient algorithm when invoked using the three argument form.ord($module, c, /) --
Return the Unicode code point for a one-character string.oct($module, number, /) --
Return the next item from the iterator. If default is given and the iterator is exhausted, it is returned instead of raising StopIteration.min(iterable, *[, default=obj, key=func]) -> value min(arg1, arg2, *args, *[, key=func]) -> value
With a single iterable argument, return its smallest item. The default keyword-only argument specifies an object to return if the provided iterable is empty. With two or more arguments, return the smallest argument.max(iterable, *[, default=obj, key=func]) -> value max(arg1, arg2, *args, *[, key=func]) -> value
With a single iterable argument, return its biggest item. The default keyword-only argument specifies an object to return if the provided iterable is empty. With two or more arguments, return the largest argument.locals($module, /) --
Return a dictionary containing the current scope's local variables.
NOTE: Whether or not updates to this dictionary will affect name lookups in the local scope and vice-versa is *implementation dependent* and not covered by any backwards compatibility guarantees.len($module, obj, /) --
Return the number of items in a container.iter(iterable) -> iterator iter(callable, sentinel) -> iterator
Get an iterator from an object. In the first form, the argument must supply its own iterator, or be a sequence. In the second form, the callable is called until it returns the sentinel.issubclass($module, cls, class_or_tuple, /) --
Return whether 'cls' is a derived from another class or is the same class.
A tuple, as in ``issubclass(x, (A, B, ...))``, may be given as the target to check against. This is equivalent to ``issubclass(x, A) or issubclass(x, B) or ...`` etc.isinstance($module, obj, class_or_tuple, /) --
Return whether an object is an instance of a class or of a subclass thereof.
A tuple, as in ``isinstance(x, (A, B, ...))``, may be given as the target to check against. This is equivalent to ``isinstance(x, A) or isinstance(x, B) or ...`` etc.input($module, prompt=None, /) --
Read a string from standard input. The trailing newline is stripped.
The prompt string, if given, is printed to standard output without a trailing newline before reading input.
If the user hits EOF (*nix: Ctrl-D, Windows: Ctrl-Z+Return), raise EOFError. On *nix systems, readline is used if available.id($module, obj, /) --
Return the identity of an object.
This is guaranteed to be unique among simultaneously existing objects. (CPython uses the object's memory address.)hex($module, number, /) --
Return the hexadecimal representation of an integer.
Two objects that compare equal must also have the same hash value, but the reverse is not necessarily true.hasattr($module, obj, name, /) --
Return whether the object has an attribute with the given name.
This is done by calling getattr(obj, name) and catching AttributeError.globals($module, /) --
Return the dictionary containing the current scope's global variables.
NOTE: Updates to this dictionary *will* affect name lookups in the current global scope and vice-versa.getattr(object, name[, default]) -> value
Get a named attribute from an object; getattr(x, 'y') is equivalent to x.y. When a default argument is given, it is returned when the attribute doesn't exist; without it, an exception is raised in that case.format($module, value, format_spec='', /) --
Return value.__format__(format_spec)
format_spec defaults to the empty string. See the Format Specification Mini-Language section of help('FORMATTING') for details.exec($module, source, globals=None, locals=None, /) --
Execute the given source in the context of globals and locals.
The source may be a string representing one or more Python statements or a code object as returned by compile(). The globals must be a dictionary and locals can be any mapping, defaulting to the current globals and locals. If only globals is given, locals defaults to it.eval($module, source, globals=None, locals=None, /) --
Evaluate the given source in the context of globals and locals.
The source may be a string representing a Python expression or a code object as returned by compile(). The globals must be a dictionary and locals can be any mapping, defaulting to the current globals and locals. If only globals is given, locals defaults to it.divmod($module, x, y, /) --
Return the tuple (x//y, x%y). Invariant: div*y + mod == x.dir([object]) -> list of strings
If called without an argument, return the names in the current scope. Else, return an alphabetized list of names comprising (some of) the attributes of the given object, and of attributes reachable from it. If the object supplies a method named __dir__, it will be used; otherwise the default dir() logic is used and returns: for a module object: the module's attributes. for a class object: its attributes, and recursively the attributes of its bases. for any other object: its attributes, its class's attributes, and recursively the attributes of its class's base classes.delattr($module, obj, name, /) --
Deletes the named attribute from the given object.
delattr(x, 'y') is equivalent to ``del x.y''compile($module, /, source, filename, mode, flags=0, dont_inherit=False, optimize=-1) --
Compile source into a code object that can be executed by exec() or eval().
The source code may represent a Python module, statement or expression. The filename will be used for run-time error messages. The mode must be 'exec' to compile a module, 'single' to compile a single (interactive) statement, or 'eval' to compile an expression. The flags argument, if present, controls which future statements influence the compilation of the code. The dont_inherit argument, if true, stops the compilation inheriting the effects of any future statements in effect in the code calling compile; if absent or false these statements do influence the compilation, in addition to any features explicitly specified.chr($module, i, /) --
Return a Unicode string of one character with ordinal i; 0 <= i <= 0x10ffff.callable($module, obj, /) --
Return whether the object is callable (i.e., some kind of function).
Note that classes are callable, as are instances of classes with a __call__() method.bin($module, number, /) --
As repr(), return a string containing a printable representation of an object, but escape the non-ASCII characters in the string returned by repr() using \\x, \\u or \\U escapes. This generates a string similar to that returned by repr() in Python 2.any($module, iterable, /) --
Return True if bool(x) is True for any x in the iterable.
If the iterable is empty, return False.all($module, iterable, /) --
Return True if bool(x) is True for all values x in the iterable.
If the iterable is empty, return True.abs($module, x, /) --
Return the absolute value of the argument.__import__(name, globals=None, locals=None, fromlist=(), level=0) -> module
Import a module. Because this function is meant for use by the Python interpreter and not for general use, it is better to use importlib.import_module() to programmatically import a module.
The globals argument is only used to determine the context; they are not modified. The locals argument is unused. The fromlist should be a list of names to emulate ``from name import ...'', or an empty list to emulate ``import name''. When importing a module from a package, note that __import__('A.B', ...) returns package A when fromlist is empty, but its submodule B when fromlist is not empty. The level argument is used to determine whether to perform absolute or relative imports: 0 is absolute, while a positive number is the number of parent directories to search relative to the current module.__build_class__(func, name, *bases, metaclass=None, **kwds) -> class
Internal helper function used by the class statement.Built-in functions, exceptions, and other objects.
Noteworthy: None is the `nil' object; Ellipsis represents `...' in slices.Low-level inferface to warnings functionality.Issue a warning, or maybe ignore it or raise an exception._warnings provides basic warning filtering support. It is a helper module to speed up interpreter start-up.S.__sizeof__() -> size of S in memory, in bytesmaketrans(x, y=None, z=None, /) --
Return a translation table usable for str.translate().
If there is only one argument, it must be a dictionary mapping Unicode ordinals (integers) or characters to Unicode ordinals, strings or None. Character keys will be then converted to ordinals. If there are two arguments, they must be strings of equal length, and in the resulting dictionary, each character in x will be mapped to the character at the same position in y. If there is a third argument, it must be a string, whose characters will be mapped to None in the result.S.__format__(format_spec) -> str
Return a formatted version of S as described by format_spec.S.format_map(mapping) -> str
Return a formatted version of S, using substitutions from mapping. The substitutions are identified by braces ('{' and '}').S.format(*args, **kwargs) -> str
Return a formatted version of S, using substitutions from args and kwargs. The substitutions are identified by braces ('{' and '}').S.zfill(width) -> str
Pad a numeric string S with zeros on the left, to fill a field of the specified width. The string S is never truncated.S.isprintable() -> bool
Return True if all characters in S are considered printable in repr() or S is empty, False otherwise.S.isidentifier() -> bool
Return True if S is a valid identifier according to the language definition.
Use keyword.iskeyword() to test for reserved identifiers such as "def" and "class". S.isalnum() -> bool
Return True if all characters in S are alphanumeric and there is at least one character in S, False otherwise.S.isalpha() -> bool
Return True if all characters in S are alphabetic and there is at least one character in S, False otherwise.S.isnumeric() -> bool
Return True if there are only numeric characters in S, False otherwise.S.isdigit() -> bool
Return True if all characters in S are digits and there is at least one character in S, False otherwise.S.isdecimal() -> bool
Return True if there are only decimal characters in S, False otherwise.S.isspace() -> bool
Return True if all characters in S are whitespace and there is at least one character in S, False otherwise.S.istitle() -> bool
Return True if S is a titlecased string and there is at least one character in S, i.e. upper- and titlecase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.S.isupper() -> bool
Return True if all cased characters in S are uppercase and there is at least one cased character in S, False otherwise.S.islower() -> bool
Return True if all cased characters in S are lowercase and there is at least one cased character in S, False otherwise.S.endswith(suffix[, start[, end]]) -> bool
Return True if S ends with the specified suffix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. suffix can also be a tuple of strings to try.S.startswith(prefix[, start[, end]]) -> bool
Return True if S starts with the specified prefix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. prefix can also be a tuple of strings to try.S.upper() -> str
Return a copy of S converted to uppercase.S.translate(table) -> str
Return a copy of the string S in which each character has been mapped through the given translation table. The table must implement lookup/indexing via __getitem__, for instance a dictionary or list, mapping Unicode ordinals to Unicode ordinals, strings, or None. If this operation raises LookupError, the character is left untouched. Characters mapped to None are deleted.S.swapcase() -> str
Return a copy of S with uppercase characters converted to lowercase and vice versa.S.strip([chars]) -> str
Return a copy of the string S with leading and trailing whitespace removed. If chars is given and not None, remove characters in chars instead.S.splitlines([keepends]) -> list of strings
Return a list of the lines in S, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.S.rpartition(sep) -> (head, sep, tail)
Search for the separator sep in S, starting at the end of S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return two empty strings and S.S.rstrip([chars]) -> str
Return a copy of the string S with trailing whitespace removed. If chars is given and not None, remove characters in chars instead.S.rjust(width[, fillchar]) -> str
Return S right-justified in a string of length width. Padding is done using the specified fill character (default is a space).S.rindex(sub[, start[, end]]) -> int
Return the highest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation.
Raises ValueError when the substring is not found.S.rfind(sub[, start[, end]]) -> int
Return the highest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation.
Return -1 on failure.S.lstrip([chars]) -> str
Return a copy of the string S with leading whitespace removed. If chars is given and not None, remove characters in chars instead.S.lower() -> str
Return a copy of the string S converted to lowercase.S.ljust(width[, fillchar]) -> str
Return S left-justified in a Unicode string of length width. Padding is done using the specified fill character (default is a space).S.index(sub[, start[, end]]) -> int
Return the lowest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation.
Raises ValueError when the substring is not found.S.partition(sep) -> (head, sep, tail)
Search for the separator sep in S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return S and two empty strings.S.find(sub[, start[, end]]) -> int
Return the lowest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation.
Return -1 on failure.S.expandtabs(tabsize=8) -> str
Return a copy of S where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.S.count(sub[, start[, end]]) -> int
Return the number of non-overlapping occurrences of substring sub in string S[start:end]. Optional arguments start and end are interpreted as in slice notation.S.center(width[, fillchar]) -> str
Return S centered in a string of length width. Padding is done using the specified fill character (default is a space)S.title() -> str
Return a titlecased version of S, i.e. words start with title case characters, all remaining cased characters have lower case.S.casefold() -> str
Return a version of S suitable for caseless comparisons.S.capitalize() -> str
Return a capitalized version of S, i.e. make the first character have upper case and the rest lower case.S.join(iterable) -> str
Return a string which is the concatenation of the strings in the iterable. The separator between elements is S.S.rsplit(sep=None, maxsplit=-1) -> list of strings
Return a list of the words in S, using sep as the delimiter string, starting at the end of the string and working to the front. If maxsplit is given, at most maxsplit splits are done. If sep is not specified, any whitespace string is a separator.S.split(sep=None, maxsplit=-1) -> list of strings
Return a list of the words in S, using sep as the delimiter string. If maxsplit is given, at most maxsplit splits are done. If sep is not specified or is None, any whitespace string is a separator and empty strings are removed from the result.S.replace(old, new[, count]) -> str
Return a copy of S with all occurrences of substring old replaced by new. If the optional argument count is given, only the first count occurrences are replaced.S.encode(encoding='utf-8', errors='strict') -> bytes
Encode S using the codec registered for encoding. Default encoding is 'utf-8'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeEncodeError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that can handle UnicodeEncodeErrors.str(object='') -> str str(bytes_or_buffer[, encoding[, errors]]) -> str
Create a new string object from the given object. If encoding or errors is specified, then the object must expose a data buffer that will be decoded using the given encoding and error handler. Otherwise, returns the result of object.__str__() (if defined) or repr(object). encoding defaults to sys.getdefaultencoding(). errors defaults to 'strict'.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).��������type(object_or_name, bases, dict) type(object) -> the object's type type(name, bases, dict) -> a new typeThis method is called when a class is subclassed.
The default implementation does nothing. It may be overridden to extend subclasses. Abstract classes can override this to customize issubclass().
This is invoked early on by abc.ABCMeta.__subclasscheck__(). It should return True, False or NotImplemented. If it returns NotImplemented, the normal algorithm is used. Otherwise, it overrides the normal algorithm (and the outcome is cached). super() -> same as super(__class__, <first argument>) super(type) -> unbound super object super(type, obj) -> bound super object; requires isinstance(obj, type) super(type, type2) -> bound super object; requires issubclass(type2, type) Typical use to call a cooperative superclass method: class C(B): def meth(self, arg): super().meth(arg) This works for class methods too: class C(B): @classmethod def cmeth(cls, arg): super().cmeth(arg) T.count(value) -> integer -- return number of occurrences of valueT.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.tuple() -> empty tuple tuple(iterable) -> tuple initialized from iterable's items
If the argument is a tuple, the return value is the same object.Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).Return state information for pickling.S.indices(len) -> (start, stop, stride)
Assuming a sequence of length len, calculate the start and stop indices, and the stride length of the extended slice described by S. Out of bounds indices are clipped in a manner consistent with the handling of normal slices.slice(stop) slice(start, stop[, step])
Create a slice object. This is used for extended slicing (e.g. a[0:10:2]).Private method returning an estimate of len(list(it)).Update a set with the union of itself and others.Update a set with the symmetric difference of itself and another.Remove an element from a set; it must be a member.
If the element is not a member, raise a KeyError.Remove and return an arbitrary set element. Raises KeyError if the set is empty.Update a set with the intersection of itself and another.Remove all elements of another set from this set.Remove an element from a set if it is a member.
If the element is not a member, do nothing.Remove all elements from this set.Add an element to a set.
This has no effect if the element is already present.set() -> new empty set object set(iterable) -> new set object
Build an unordered collection of unique elements.Return the union of sets as a new set.
(i.e. all elements that are in either set.)Return the symmetric difference of two sets as a new set.
(i.e. all elements that are in exactly one of the sets.)S.__sizeof__() -> size of S in memory, in bytesReturn state information for pickling.Report whether this set contains another set.Report whether another set contains this set.Return True if two sets have a null intersection.Return the intersection of two sets as a new set.
(i.e. all elements that are in both sets.)Return the difference of two or more sets as a new set.
(i.e. all elements that are in this set but not the others.)Return a shallow copy of a set.x.__contains__(y) <==> y in x.frozenset() -> empty frozenset object frozenset(iterable) -> frozenset object
Build an immutable unordered collection of unique elements.rangeobject.index(value, [start, [stop]]) -> integer -- return index of value. Raise ValueError if the value is not present.rangeobject.count(value) -> integer -- return number of occurrences of valueReturn a reverse iterator.range(stop) -> range object range(start, stop[, step]) -> range object
Return an object that produces a sequence of integers from start (inclusive) to stop (exclusive) by step. range(i, j) produces i, i+1, i+2, ..., j-1. start defaults to 0, and stop is omitted! range(4) produces 0, 1, 2, 3. These are exactly the valid indices for a list of 4 elements. When step is given, it specifies the increment (or decrement).Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).Capsule objects let you wrap a C "void *" pointer in a Python object. They're a way of passing data through the Python interpreter without creating your own custom type.
Capsules are used for communication between extension modules. They provide a way for an extension module to export a C interface to other extension modules, so that extension modules can use the Python import mechanism to link to one another. ��������Return state information for picklingA simple attribute-based namespace.
SimpleNamespace(**kwargs)module(name[, doc])
Create a module object. The name must be a string; the optional doc argument can have any type.A bool indicating whether the memory is contiguous.A bool indicating whether the memory is Fortran contiguous.A bool indicating whether the memory is C contiguous.A tuple of integers used internally for PIL-style arrays.A tuple of ndim integers giving the size in bytes to access each element for each dimension of the array.A tuple of ndim integers giving the shape of the memory as an N-dimensional array.An integer indicating how many dimensions of a multi-dimensional array the memory represents.A string containing the format (in struct module style) for each element in the view.The size in bytes of each element of the memoryview.A bool indicating whether the memory is read only.The amount of space in bytes that the array would use in a contiguous representation.The underlying object of the memoryview.cast($self, /, format, *, shape) --
Cast a memoryview to a new format or shape.tolist($self, /) --
Return the data in the buffer as a list of elements.hex($self, /) --
Return the data in the buffer as a string of hexadecimal numbers.tobytes($self, /) --
Return the data in the buffer as a byte string.release($self, /) --
Release the underlying buffer exposed by the memoryview object.memoryview(object) --
Create a new memoryview object which references the given object.Move an existing element to the end (or beginning if last==False).
Raises KeyError if the element does not exist. When last=True, acts like a fast version of self[key]=self.pop(key).
od.__reversed__() <==> reversed(od)od.copy() -> a shallow copy of odod.clear() -> None. Remove all items from od.popitem($self, /, last=True) --
Remove and return a (key, value) pair from the dictionary.
Pairs are returned in LIFO order if last is true or FIFO order if false.od.pop(k[,d]) -> v, remove specified key and return the corresponding value. If key is not found, d is returned if given, otherwise KeyError is raised.
od.setdefault(k[,d]) -> od.get(k,d), also set od[k]=d if k not in odReturn state information for picklingOD.fromkeys(S[, v]) -> New ordered dictionary with keys from S. If not specified, the value defaults to None.
od.__setitem__(i, y) <==> od[i]=yod.__repr__() <==> repr(od)od.__iter__() <==> iter(od)Initialize an ordered dictionary. The signature is the same as regular dictionaries. Keyword argument order is preserved.
od.__eq__(y) <==> od==y. Comparison to another OD is order-sensitive while comparison to a regular mapping is order-insensitive. od.__delitem__(y) <==> del od[y]Dictionary that remembers insertion orderReturn state information for picklingD.copy() -> a shallow copy of DD.clear() -> None. Remove all items from D.fromkeys($type, iterable, value=None, /) --
Returns a new dict with keys from iterable and values equal to value.D.update([E, ]**F) -> None. Update D from dict/iterable E and F. If E is present and has a .keys() method, then does: for k in E: D[k] = E[k] If E is present and lacks a .keys() method, then does: for k, v in E: D[k] = v In either case, this is followed by: for k in F: D[k] = F[k]D.values() -> an object providing a view on D's valuesD.items() -> a set-like object providing a view on D's itemsD.keys() -> a set-like object providing a view on D's keysD.popitem() -> (k, v), remove and return some (key, value) pair as a 2-tuple; but raise KeyError if D is empty.D.pop(k[,d]) -> v, remove specified key and return the corresponding value. If key is not found, d is returned if given, otherwise KeyError is raisedD.setdefault(k[,d]) -> D.get(k,d), also set D[k]=d if k not in DD.get(k[,d]) -> D[k] if k in D, else d. d defaults to None.D.__sizeof__() -> size of D in memory, in bytesx.__getitem__(y) <==> x[y]__contains__($self, key, /) --
True if D has a key k, else False.dict() -> new empty dictionary dict(mapping) -> new dictionary initialized from a mapping object's (key, value) pairs dict(iterable) -> new dictionary initialized as if via: d = {} for k, v in iterable: d[k] = v dict(**kwargs) -> new dictionary initialized with the name=value pairs in the keyword argument list. For example: dict(one=1, two=2)Return state information for pickling.Private method returning an estimate of len(list(it)).Return True if the view and the given iterable have a null intersection.int.from_bytes(bytes, byteorder, *, signed=False) -> int
Return the integer represented by the given array of bytes.
The bytes argument must be a bytes-like object (e.g. bytes or bytearray).
The byteorder argument determines the byte order used to represent the integer. If byteorder is 'big', the most significant byte is at the beginning of the byte array. If byteorder is 'little', the most significant byte is at the end of the byte array. To request the native byte order of the host system, use `sys.byteorder' as the byte order value.
The signed keyword-only argument indicates whether two's complement is used to represent the integer.int.to_bytes(length, byteorder, *, signed=False) -> bytes
Return an array of bytes representing an integer.
The integer is represented using length bytes. An OverflowError is raised if the integer is not representable with the given number of bytes.
The byteorder argument determines the byte order used to represent the integer. If byteorder is 'big', the most significant byte is at the beginning of the byte array. If byteorder is 'little', the most significant byte is at the end of the byte array. To request the native byte order of the host system, use `sys.byteorder' as the byte order value.
The signed keyword-only argument determines whether two's complement is used to represent the integer. If signed is False and a negative integer is given, an OverflowError is raised.int.bit_length() -> int
Number of bits necessary to represent self in binary. >>> bin(37) '0b100101' >>> (37).bit_length() 6int(x=0) -> integer int(x, base=10) -> integer
Convert a number or string to an integer, or return 0 if no arguments are given. If x is a number, return x.__int__(). For floating point numbers, this truncates towards zero.
If x is not a number or if base is given, then x must be a string, bytes, or bytearray instance representing an integer literal in the given base. The literal can be preceded by '+' or '-' and be surrounded by whitespace. The base defaults to 10. Valid bases are 0 and 2-36. Base 0 means to interpret the base from the string as an integer literal. >>> int('0b100', base=0) 4sys.int_info
A struct sequence that holds information about Python's internal representation of integers. The attributes are read only.%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %%%%%%%
!"#%%%%%%
!"#%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%L.sort(key=None, reverse=False) -> None -- stable sort *IN PLACE*L.reverse() -- reverse *IN PLACE*L.count(value) -> integer -- return number of occurrences of valueL.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.L.remove(value) -> None -- remove first occurrence of value. Raises ValueError if the value is not present.L.pop([index]) -> item -- remove and return item at index (default last). Raises IndexError if list is empty or index is out of range.L.extend(iterable) -> None -- extend list by appending elements from the iterableL.insert(index, object) -- insert object before indexL.append(object) -> None -- append object to endL.copy() -> list -- a shallow copy of LL.clear() -> None -- remove all items from LL.__sizeof__() -- size of L in memory, in bytesL.__reversed__() -- return a reverse iterator over the listx.__getitem__(y) <==> x[y]list() -> new empty list list(iterable) -> new list initialized from iterable's itemsSet state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).Set state information for unpickling.Private method returning an estimate of len(list(it)).Return state information for pickling.function(code, globals[, name[, argdefs[, closure]]])
Create a function object from a code object and a dictionary. The optional name string overrides the name from the code object. The optional argdefs tuple specifies the default argument values. The optional closure tuple supplies the bindings for free variables.classmethod(function) -> method
Convert a function to be a class method.
A class method receives the class as implicit first argument, just like an instance method receives the instance. To declare a class method, use this idiom:
class C: @classmethod def f(cls, arg1, arg2, ...): ...
It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). The instance is ignored except for its class. If a class method is called for a derived class, the derived class object is passed as the implied first argument.
Class methods are different than C++ or Java static methods. If you want those, see the staticmethod builtin.staticmethod(function) -> method
Convert a function to be a static method.
A static method does not receive an implicit first argument. To declare a static method, use this idiom:
class C: @staticmethod def f(arg1, arg2, ...): ...
It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). The instance is ignored except for its class.
Static methods in Python are similar to those found in Java or C++. For a more advanced concept, see the classmethod builtin.F.__sizeof__() -> size of F in memory, in bytesF.clear(): clear most references held by the framesys.float_info
A structseq holding information about the float type. It contains low level information about the precision and internal representation. Please study your system's :file:`float.h` for more information.float.__format__(format_spec) -> string
Formats the float according to format_spec.float.__setformat__(typestr, fmt) -> None
You probably don't want to use this function. It exists mainly to be used in Python's test suite.
typestr must be 'double' or 'float'. fmt must be one of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian', and in addition can only be one of the latter two if it appears to match the underlying C reality.
Override the automatic determination of C-level floating point type. This affects how floats are converted to and from binary strings.float.__getformat__(typestr) -> string
You probably don't want to use this function. It exists mainly to be used in Python's test suite.
typestr must be 'double' or 'float'. This function returns whichever of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian' best describes the format of floating point numbers used by the C type named by typestr.float.hex() -> string
Return a hexadecimal representation of a floating-point number. >>> (-0.1).hex() '-0x1.999999999999ap-4' >>> 3.14159.hex() '0x1.921f9f01b866ep+1'float.fromhex(string) -> float
Create a floating-point number from a hexadecimal string. >>> float.fromhex('0x1.ffffp10') 2047.984375 >>> float.fromhex('-0x1p-1074') -5e-324float.as_integer_ratio() -> (int, int)
Return a pair of integers, whose ratio is exactly equal to the original float and with a positive denominator. Raise OverflowError on infinities and a ValueError on NaNs.
>>> (10.0).as_integer_ratio() (10, 1) >>> (0.0).as_integer_ratio() (0, 1) >>> (-.25).as_integer_ratio() (-1, 4)float(x) -> floating point number
Convert a string or number to a floating point number, if possible.close() -> raise GeneratorExit inside coroutine.throw(typ[,val[,tb]]) -> raise exception in coroutine, return next iterated value or raise StopIteration.send(arg) -> send 'arg' into coroutine, return next iterated value or raise StopIteration.aclose() -> raise GeneratorExit inside generator.athrow(typ[,val[,tb]]) -> raise exception in generator.asend(v) -> send 'v' in generator.close() -> raise GeneratorExit inside generator.throw(typ[,val[,tb]]) -> raise exception in generator, return next yielded value or raise StopIteration.send(arg) -> send 'arg' into generator, return next yielded value or raise StopIteration.Exception.with_traceback(tb) -- set self.__traceback__ to tb and return self.enumerate(iterable[, start]) -> iterator for index, value of iterable
Return an enumerate object. iterable must be another object that supports iteration. The enumerate object yields pairs containing a count (from start, which defaults to zero) and a value yielded by the iterable argument. enumerate is useful for obtaining an indexed list: (0, seq[0]), (1, seq[1]), (2, seq[2]), ...Set state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).reversed(sequence) -> reverse iterator over values of the sequence
Return a reverse iteratorDescriptor to change the deleter on a property.Descriptor to change the setter on a property.Descriptor to change the getter on a property.property(fget=None, fset=None, fdel=None, doc=None) -> property attribute
fget is a function to be used for getting an attribute value, and likewise fset is a function for setting, and fdel a function for del'ing, an attribute. Typical use is to define a managed attribute x:
class C(object): def getx(self): return self._x def setx(self, value): self._x = value def delx(self): del self._x x = property(getx, setx, delx, "I'm the 'x' property.")
Decorators make defining new properties or modifying existing ones easy:
class C(object): @property def x(self): "I am the 'x' property." return self._x @x.setter def x(self, value): self._x = value @x.deleter def x(self): del self._x complex.__format__() -> str
Convert to a string according to format_spec.complex.conjugate() -> complex
Return the complex conjugate of its argument. (3-4j).conjugate() == 3+4j.complex(real[, imag]) -> complex number
Create a complex number from a real part and an optional imaginary part. This is equivalent to (real + imag*1j) where imag defaults to 0.code(argcount, kwonlyargcount, nlocals, stacksize, flags, codestring, constants, names, varnames, filename, name, firstlineno, lnotab[, freevars[, cellvars]])
Create a code object. Not for the faint of heart.method(function, instance)
Create a bound instance method object.instancemethod(function)
Bind a function to a class.translate($self, table, /, delete=b'') --
Return a copy with each character mapped by the given translation table.
table Translation table, which must be a bytes object of length 256.
All characters occurring in the optional argument delete are removed. The remaining characters are mapped through the given translation table.strip($self, bytes=None, /) --
Strip leading and trailing bytes contained in the argument.
If the argument is omitted or None, strip leading and trailing ASCII whitespace.splitlines($self, /, keepends=False) --
Return a list of the lines in the bytes, breaking at line boundaries.
Line breaks are not included in the resulting list unless keepends is given and true.split($self, /, sep=None, maxsplit=-1) --
Return a list of the sections in the bytes, using sep as the delimiter.
sep The delimiter according which to split the bytes. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit.rstrip($self, bytes=None, /) --
Strip trailing bytes contained in the argument.
If the argument is omitted or None, strip trailing ASCII whitespace.rsplit($self, /, sep=None, maxsplit=-1) --
Return a list of the sections in the bytes, using sep as the delimiter.
sep The delimiter according which to split the bytes. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit.
Splitting is done starting at the end of the bytes and working to the front.rpartition($self, sep, /) --
Partition the bytes into three parts using the given separator.
This will search for the separator sep in the bytes, starting at the end. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it.
If the separator is not found, returns a 3-tuple containing two empty bytes objects and the original bytes object.replace($self, old, new, count=-1, /) --
Return a copy with all occurrences of substring old replaced by new.
count Maximum number of occurrences to replace. -1 (the default value) means replace all occurrences.
If the optional argument count is given, only the first count occurrences are replaced.partition($self, sep, /) --
Partition the bytes into three parts using the given separator.
This will search for the separator sep in the bytes. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it.
If the separator is not found, returns a 3-tuple containing the original bytes object and two empty bytes objects.maketrans(frm, to, /) --
Return a translation table useable for the bytes or bytearray translate method.
The returned table will be one where each byte in frm is mapped to the byte at the same position in to.
The bytes objects frm and to must be of the same length.lstrip($self, bytes=None, /) --
Strip leading bytes contained in the argument.
If the argument is omitted or None, strip leading ASCII whitespace.join($self, iterable_of_bytes, /) --
Concatenate any number of bytes objects.
The bytes whose method is called is inserted in between each pair.
Create a string of hexadecimal numbers from a bytes object. Example: b'\xb9\x01\xef'.hex() -> 'b901ef'.fromhex($type, string, /) --
Create a bytes object from a string of hexadecimal numbers.
Spaces between two numbers are accepted. Example: bytes.fromhex('B9 01EF') -> b'\\xb9\\x01\\xef'.decode($self, /, encoding='utf-8', errors='strict') --
Decode the bytes using the codec registered for encoding.
encoding The encoding with which to decode the bytes. errors The error handling scheme to use for the handling of decoding errors. The default is 'strict' meaning that decoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that can handle UnicodeDecodeErrors.bytes(iterable_of_ints) -> bytes bytes(string, encoding[, errors]) -> bytes bytes(bytes_or_buffer) -> immutable copy of bytes_or_buffer bytes(int) -> bytes object of size given by the parameter initialized with null bytes bytes() -> empty bytes object
Construct an immutable array of bytes from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - any object implementing the buffer API. - an integerSet state information for unpickling.Return state information for pickling.Private method returning an estimate of len(list(it)).translate($self, table, /, delete=b'') --
Return a copy with each character mapped by the given translation table.
table Translation table, which must be a bytes object of length 256.
All characters occurring in the optional argument delete are removed. The remaining characters are mapped through the given translation table.strip($self, bytes=None, /) --
Strip leading and trailing bytes contained in the argument.
If the argument is omitted or None, strip leading and trailing ASCII whitespace.splitlines($self, /, keepends=False) --
Return a list of the lines in the bytearray, breaking at line boundaries.
Line breaks are not included in the resulting list unless keepends is given and true.split($self, /, sep=None, maxsplit=-1) --
Return a list of the sections in the bytearray, using sep as the delimiter.
sep The delimiter according which to split the bytearray. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit.rstrip($self, bytes=None, /) --
Strip trailing bytes contained in the argument.
If the argument is omitted or None, strip trailing ASCII whitespace.rsplit($self, /, sep=None, maxsplit=-1) --
Return a list of the sections in the bytearray, using sep as the delimiter.
sep The delimiter according which to split the bytearray. None (the default value) means split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). maxsplit Maximum number of splits to do. -1 (the default value) means no limit.
Splitting is done starting at the end of the bytearray and working to the front.rpartition($self, sep, /) --
Partition the bytearray into three parts using the given separator.
This will search for the separator sep in the bytearray, starting at the end. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it as new bytearray objects.
If the separator is not found, returns a 3-tuple containing two empty bytearray objects and the copy of the original bytearray object.reverse($self, /) --
Reverse the order of the values in B in place.replace($self, old, new, count=-1, /) --
Return a copy with all occurrences of substring old replaced by new.
count Maximum number of occurrences to replace. -1 (the default value) means replace all occurrences.
If the optional argument count is given, only the first count occurrences are replaced.remove($self, value, /) --
Remove the first occurrence of a value in the bytearray.
value The value to remove.pop($self, index=-1, /) --
Remove and return a single item from B.
index The index from where to remove the item. -1 (the default value) means remove the last item.
If no index argument is given, will pop the last item.partition($self, sep, /) --
Partition the bytearray into three parts using the given separator.
This will search for the separator sep in the bytearray. If the separator is found, returns a 3-tuple containing the part before the separator, the separator itself, and the part after it as new bytearray objects.
If the separator is not found, returns a 3-tuple containing the copy of the original bytearray object and two empty bytearray objects.maketrans(frm, to, /) --
Return a translation table useable for the bytes or bytearray translate method.
The returned table will be one where each byte in frm is mapped to the byte at the same position in to.
The bytes objects frm and to must be of the same length.lstrip($self, bytes=None, /) --
Strip leading bytes contained in the argument.
If the argument is omitted or None, strip leading ASCII whitespace.join($self, iterable_of_bytes, /) --
Concatenate any number of bytes/bytearray objects.
The bytearray whose method is called is inserted in between each pair.
The result is returned as a new bytearray object.insert($self, index, item, /) --
Insert a single item into the bytearray before the given index.
index The index where the value is to be inserted. item The item to be inserted.B.hex() -> string
Create a string of hexadecimal numbers from a bytearray object. Example: bytearray([0xb9, 0x01, 0xef]).hex() -> 'b901ef'.fromhex($type, string, /) --
Create a bytearray object from a string of hexadecimal numbers.
Spaces between two numbers are accepted. Example: bytearray.fromhex('B9 01EF') -> bytearray(b'\\xb9\\x01\\xef')extend($self, iterable_of_ints, /) --
Append all the items from the iterator or sequence to the end of the bytearray.
iterable_of_ints The iterable of items to append.decode($self, /, encoding='utf-8', errors='strict') --
Decode the bytearray using the codec registered for encoding.
encoding The encoding with which to decode the bytearray. errors The error handling scheme to use for the handling of decoding errors. The default is 'strict' meaning that decoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that can handle UnicodeDecodeErrors.copy($self, /) --
Return a copy of B.clear($self, /) --
Remove all items from the bytearray.append($self, item, /) --
Append a single item to the end of the bytearray.
item The item to be appended.__sizeof__($self, /) --
Returns the size of the bytearray object in memory, in bytes.__reduce_ex__($self, proto=0, /) --
Return state information for pickling.B.__alloc__() -> int
Return the number of bytes actually allocated.bytearray(iterable_of_ints) -> bytearray bytearray(string, encoding[, errors]) -> bytearray bytearray(bytes_or_buffer) -> mutable copy of bytes_or_buffer bytearray(int) -> bytes array of size given by the parameter initialized with null bytes bytearray() -> empty bytes array
Construct a mutable bytearray object from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - a bytes or a buffer object - any object implementing the buffer API. - an integerSet state information for unpickling.__reduce__($self, /) --
Return state information for pickling.Private method returning an estimate of len(list(it)).bool(x) -> bool
Returns True when the argument x is true, False otherwise. The builtins True and False are the only two instances of the class bool. The class bool is a subclass of the class int, and cannot be subclassed.